1>5B64_B Chain B, A Novel Binding Mode Of Maguk Gk Domain Revealed By Dlg Gk Domain In Complex With Kif13b Mbs Domain 2GPGSATLNNSLMRLREQIVKANLLVREASYIAEELDKRTEYKVTLQIPTSSLDANRKRGSLLSEPAIQVRRKGKGKQIWS 3LEKLENRLLDMRDLYQEWKECEEDSPVSRSYFKRADPFYDEQENHS 4>4X62_M Chain M, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus4X64_M Chain M, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus4X65_m Chain m, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus4X66_M Chain M, Crystal Structure Of 30s Ribosomal Subunit From Thermus Thermophilus5WNQ_M Chain M, 30S ribosomal protein S135WNR_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus5WNS_M Chain M, 30S ribosomal protein S135WNU_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus5WNV_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus5WNP_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus5WNT_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus6CAO_M Chain M, 30S ribosomal protein S136CAP_MM Chain MM, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus in complex with Sisomicin6CAQ_M Chain M, Crystal Structure of 30S ribosomal subunit from Thermus thermophilus 5ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRL 6MDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG 7>4M64_A Chain A, 3d Crystal Structure Of Na+/melibiose Symporter Of Salmonella Typhimurium4M64_B Chain B, 3d Crystal Structure Of Na+/melibiose Symporter Of Salmonella Typhimurium4M64_C Chain C, 3d Crystal Structure Of Na+/melibiose Symporter Of Salmonella Typhimurium4M64_D Chain D, 3d Crystal Structure Of Na+/melibiose Symporter Of Salmonella Typhimurium 8MSISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINDPIMGWIVNATRSRWGKFKPWI 9LIGTLTNSLVLFLLFSAHLFEGTAQVVFVCVTYILWGMTYTIMDIPFWSLVPTITLDKREREQLVPFPRFFASLAGFVTA 10GITLPFVSYVGGADRGFGFQMFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTIVGLIYKNDQLSCLLGMA 11LAYNIASNIINGFAIYYFTYVIGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWAGASVMPVLSCAGLFAMALAD 12IHNAALIVAAGIFLNIGTALFWVLQVIMVADTVDYGEFKLNIRCESIAYSVQTMVVKGGSAFAAFFIALVLGLIGYTPNV 13AQSAQTLQGMQFIMIVLPVLFFMMTLVLYFRYYRLNGDMLRKIQIHLLDKYRKTPPFVEQPDSPAISVVATSDVKAHHHH 14HHHHHH 15>pdb|3S7Y|A Chain A, Crystal Structure Of Mmnags In Space Group P3121 At 4.3 A Resolution3S7Y_X Chain X, Crystal Structure Of Mmnags In Space Group P3121 At 4.3 A Resolution 16MGSSHHHHHHSSGLVPRGSHMNPNAPGVRQTIVQLLSHMRDGKEIREYLHRFSGIDQERFAVIKVGGAVIQDDLPGLASA 17LAFLQTVGLTPVVVHGGGPQLDAALEAADIPTERVDGLRVTRDEAIPIIRDTLTQANLALVDAIRDAGGRAAAVPRGVFE 18ADIVDADKLGRVGEPRHIHLDLVGSAARAGQAAILACLGETPDGTLVNINADVAVRALVHALQPYKVVFLTGTGGLLDED 19GDILSSINLATDFGDLMQADWVNGGMRLKLEEIKRLLDDLPLSSSVSITRPSELARELFTHAGSGTLIRRGERIVATDDK 20SSLDLGRLDNLVKAAFGRPAVEGYWDRLRVDRAFVTESYRAAAITTRLDGWVYLDKFAVLDDARGEGLGRTVWNRLVDYA 21PQLIWRSRTNNPVNGFYFEECDGAVRRDEWTVFWRGEMGPVEVADVVEKAFALPPTLEAPQ 22>3ETQ_A Chain A, X-ray Structure Of Cysteine-free Fragment Of Mhcn2 C-terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations3ETQ_B Chain B, X-ray Structure Of Cysteine-free Fragment Of Mhcn2 C-terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations 23LVPRGSDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMP 24LFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVR 25ADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKN 26>2KJ7_A Chain A, Three-Dimensional NMR Structure of Rat Islet Amyloid Polypeptide in DPC micelles 27KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYX 28>2KA9_B Chain B, Solution structure of PSD-95 PDZ12 complexed with cypin peptide2KA9_C Chain C, Solution structure of PSD-95 PDZ12 complexed with cypin peptide 29QVVPFSSSV 30>3G7D_A Chain A, Native Phpd With Cadmium Atoms3GBF_A Chain A, Phpd With Cadmium Complexed With Hydroethylphosphonate (Hep) 31XRIDPFKLAHWXNARKYTAAQTADLAGLPLDDLRRLLGDEANEPDPAAATALAEALSVEPSQLAADAHRNLTVVHKSAEE 32XHASRRPIQRDGIHFYNYYTLAAPEGRVAPVVLDILCPSDRLPALNNGHLEPAITVNLGPGDINGRWGEEITPQTWRVLH 33ANHGGDRWITGDSYVEPSYCPHSYSLAGDAPARIVSYTAQSNISPLXTEANNWSTGAFEEALKALSGKVSAGSVLDLFLA 34RRAHTRTSAAEAAGVPPADLEAALRSPASETGLTVLRTLGRALGFDYRVLLPADDQHDGVGKTWTTIEDSRRSRRTFGTY 35EAASXASAAHLPDLVGSFLRVDADGRGADLIDHAENHYVVTEGRLTLEWDGPDGPASVELEPDGSAWTGPFVRHRWHGTG 36TVLKFGSGAHLGYQDWLELTNTFEPAATLRRGRRDLAGWGYDN 37>2W80_A Chain A, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2W80_B Chain B, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2W80_eF Chain eF, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2V64_G Chain G, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2W81_A Chain A, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2W81_B Chain B, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H2W81_E Chain E, Structure Of A Complex Between Neisseria Meningitidis Factor H Binding Protein And Ccps 6-7 Of Human Complement Factor H 38TLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQ 39NHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCI 40>2K7W_B Chain B, BAX Activation is Initiated at a Novel Interaction Site 41EIWIAQELRRIGDEFNAYYA 42>2V64_B1 Chain B1, Crystallographic Structure Of The Conformational Dimer Of The Spindle Assembly Checkpoint Protein Mad2.2V64_b Chain b, Crystallographic Structure Of The Conformational Dimer Of The Spindle Assembly Checkpoint Protein Mad2.2V64_i4 Chain i4, Crystallographic Structure Of The Conformational Dimer Of The Spindle Assembly Checkpoint Protein Mad2.2QYF_E Chain E, Crystal Structure Of The Mad2/p31(comet)/mad2-binding Peptide Ternary Complex2QYF_F Chain F, Crystal Structure Of The Mad2/p31(comet)/mad2-binding Peptide Ternary Complex1KLQ_B Chain B, The Mad2 Spindle Checkpoint Protein Undergoes Similar Major Conformational Changes upon Binding to Either Mad1 or Cdc20 43SWYSYPPPQRAV 44>2Z64_A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex 45PCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNL 46ILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYI 47QTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDER 48NLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTL 49DLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLD 50FQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQL 51EQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQK 52FLQWVKEQKQFLVNVEQMTCATPVEMNTSLVLDFNNSTC 53>3MSI_A Chain A, Type Iii Antifreeze Protein Isoform Hplc 12 54MAQASVVANQLIPINTHLTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAA 55>1CLH_AA Chain A, THREE-DIMENSIONAL SOLUTION STRUCTURE OF ESCHERICHIA COLI PERIPLASMIC CYCLOPHILIN 56AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNG 57LRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVIL 58SAKVLP 59>1JJ2_Y Chain Y, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution1KQS_Y Chain Y, The Haloarcula Marismortui 50s Complexed With A Pretranslocational Intermediate In Protein Synthesis1K8A_1 Chain 1, Co-Crystal Structure Of Carbomycin A Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui1K9M_1 Chain 1, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui1KD1_1 Chain 1, Co-crystal Structure Of Spiramycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui1M1K_1 Chain 1, Co-Crystal Structure Of Azithromycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui1M90_1 Chain 1, Co-crystal structure of CCA-Phe-caproic acid-biotin and sparsomycin bound to the 50S ribosomal subunit1K73_1 Chain 1, Co-Crystal Structure Of Anisomycin Bound To The 50s Ribosomal Subunit1KC8_12 Chain 12, Co-Crystal Structure Of Blasticidin S Bound To The 50s Ribosomal Subunit1N8R_1 Chain 1, Structure Of Large Ribosomal Subunit In Complex With Virginiamycin M1NJI_1 Chain 1, Structure Of Chloramphenicol Bound To The 50s Ribosomal Subunit1Q7Y_1 Chain 1, Crystal Structure of CCdAP-Puromycin bound at the Peptidyl transferase center of the 50S ribosomal subunit1Q81_1 Chain 1, Crystal Structure of minihelix with 3' puromycin bound to A-site of the 50S ribosomal subunit.1Q82_1b Chain 1b, Crystal Structure of CC-Puromycin bound to the A-site of the 50S ribosomal subunit1Q86_1 Chain 1, Crystal structure of CCA-Phe-cap-biotin bound simultaneously at half occupancy to both the A-site and P-site of the the 50S ribosomal Subunit.1QVF_Y Chain Y, Structure of a deacylated tRNA minihelix bound to the E site of the large ribosomal subunit of Haloarcula marismortui1QVG_Y Chain Y, Structure Of Cca Oligonucleotide Bound To The Trna Binding Sites Of The Large Ribosomal Subunit Of Haloarcula Marismortui1W2B_YY Chain YY, Trigger Factor Ribosome Binding Domain In Complex With 50s3CXC_Y Chain Y, The Structure Of An Enhanced Oxazolidinone Inhibitor Bound To The 50s Ribosomal Subunit Of H. Marismortui3OW2_Y Chain Y, Crystal Structure Of Enhanced Macrolide Bound To 50s Ribosomal Subunit 60RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 61>6ES9_A Chain A, Methylsuccinyl-CoA dehydrogenase of Paracoccus denitrificans with bound flavin adenine dinucleotidepdb|6ES9|aB Chain B, Methylsuccinyl-CoA dehydrogenase of Paracoccus denitrificans with bound flavin adenine dinucleotide 62MKDMPAMPADTPSALLALAGEALPELESLQSRATEALRALVAPAGKPQPALLEQHQHAAHALSWLTTYVESIRQLSGWAG 63RLAEAGNLGRIEALILQIGLGEYLGQIAGGIPMSQTEFARLSDLELDWQPGEAAAKLMRGNTAPARAELARLMQDNHGRA 64TFGATGLDEDLEMIRDQFRRYAEERVIPNAHEWHLKDQLIPMEIIEELAELGVFGLTIPEEFGGLGLSKASMVVVTEELS 65RGYIGVGSLGTRSEIAAELILCGGTEAQKAKWLPGLASGEILSTAVFTEPNTGSDLGSLRTRAVRDGEDWVVTGNKTWIT 66HAQRTHVMTLLARTDPETTDWRGLSMFLAEKEPGTDDDPFPTPGMTGGEIEVLGYRGMKEYELGFDGFRIKGENLLGGEP 67GRGFKQLMETFESARIQTAARAVGVAQSAAEIGMRYAVDRKQFGKSLIEFPRVADKLAMMAVEIMIARQLTYFSAWEKDH 68GRRCDLEAGMAKLLGARVAWAAADNALQIHGGNGFALEYAISRVLCDARILNIFEGAAEIQAQVIARRLLD 69