1LOCUS NC_001422 5386 bp ss-DNA circular PHG 09-JUL-2002 2DEFINITION Coliphage phiX174, complete genome. 3ACCESSION NC_001422 4VERSION NC_001422.1 GI:9626372 5KEYWORDS . 6SOURCE coliphage phiX174. 7 ORGANISM coliphage phiX174 8 Viruses; ssDNA viruses; Microviridae; Microvirus. 9REFERENCE 1 (bases 1047 to 1094) 10 AUTHORS Ziff,E.B., Sedat,J.W. and Galibert,F. 11 TITLE Determination of the nucleotide sequence of a fragment of 12 bacteriophage phiX 174 DNA 13 JOURNAL Nature New Biol. 241 (106), 34-37 (1973) 14 MEDLINE 73161741 15 PUBMED 4349156 16REFERENCE 2 (bases 2370 to 2421) 17 AUTHORS Robertson,H.D., Barrell,B.G., Weith,H.L. and Donelson,J.E. 18 TITLE Isolation and sequence analysis of a ribosome-protected fragment 19 from bacteriophage phiX 174 DNA 20 JOURNAL Nature New Biol. 241 (106), 38-40 (1973) 21 MEDLINE 73161742 22 PUBMED 4572838 23REFERENCE 3 (bases 2370 to 2420) 24 AUTHORS Barrell,B.G., Weith,H.L., Donelson,J.E. and Robertson,H.D. 25 TITLE Sequence analysis of the ribosome-protected bacteriophase phiX174 26 DNA fragment containing the gene G initiation site 27 JOURNAL J. Mol. Biol. 92 (3), 377-393 (1975) 28 MEDLINE 75192039 29 PUBMED 1095758 30REFERENCE 4 (bases 2365 to 2591) 31 AUTHORS Air,G.M., Blackburn,E.H., Sanger,F. and Coulson,A.R. 32 TITLE The nucleotide and amino acid sequences of the N (5') terminal 33 region of gene G of bacteriophage phiphiX 174 34 JOURNAL J. Mol. Biol. 96 (4), 703-719 (1975) 35 MEDLINE 76072037 36 PUBMED 1081600 37REFERENCE 5 (bases 2263 to 2421) 38 AUTHORS Fiddes,J.C. 39 TITLE Nucleotide sequence of the intercistronic region between genes G 40 and F in bacteriophage phiX174 DNA 41 JOURNAL J. Mol. Biol. 107 (1), 1-24 (1976) 42 MEDLINE 77074135 43 PUBMED 826639 44REFERENCE 6 (bases 4137 to 4207) 45 AUTHORS Mansfeld,A.D., Vereijken,J.M. and Jansz,H.S. 46 TITLE The nucleotide sequence of a DNA fragment, 71 base pairs in length, 47 near the origin of DNA replication of bacteriophage 0X174 48 JOURNAL Nucleic Acids Res. 3 (10), 2827-2844 (1976) 49 MEDLINE 77057432 50 PUBMED 995652 51REFERENCE 7 (bases 730 to 903) 52 AUTHORS Blackburn,E.H. 53 TITLE Transcription and sequence analysis of a fragment of bacteriophage 54 phiX174 DNA 55 JOURNAL J. Mol. Biol. 107 (4), 417-431 (1976) 56 MEDLINE 77074161 57 PUBMED 826641 58REFERENCE 8 (bases 1017 to 1081) 59 AUTHORS Sedat,J., Ziff,E. and Galibert,F. 60 TITLE Direct determination of DNA nucleotide sequences. Structure of 61 large specific fragments of bacteriophage phiX174 DNA 62 JOURNAL J. Mol. Biol. 107 (4), 391-416 (1976) 63 MEDLINE 77074160 64 PUBMED 1003475 65REFERENCE 9 (bases 1017 to 1762) 66 AUTHORS Air,G.M., Blackburn,E.H., Coulson,A.R., Galibert,F., Sanger,F., 67 Sedat,J.W. and Ziff,E.B. 68 TITLE Gene F of bacteriophage phiX174. Correlation of nucleotide 69 sequences from the DNA and amino acid sequences from the gene 70 product 71 JOURNAL J. Mol. Biol. 107 (4), 445-458 (1976) 72 MEDLINE 77074163 73 PUBMED 1088826 74REFERENCE 10 (bases 2395 to 2922) 75 AUTHORS Air,G.M., Sanger,F. and Coulson,A.R. 76 TITLE Nucleotide and amino acid sequences of gene G of omegaX174 77 JOURNAL J. Mol. Biol. 108 (3), 519-533 (1976) 78 MEDLINE 77121207 79 PUBMED 1088827 80REFERENCE 11 (bases 5022 to 5132) 81 AUTHORS Brown,N.L. and Smith,M. 82 TITLE DNA sequence of a region of the phi X174 genome coding for a 83 ribosome binding site 84 JOURNAL Nature 265 (5596), 695-698 (1977) 85 MEDLINE 77171176 86 PUBMED 859573 87REFERENCE 12 (bases 5346 to 5386; 1 to 159) 88 AUTHORS Smith,M., Brown,N.L., Air,G.M., Barrell,B.G., Coulson,A.R., 89 Hutchison,C.A. III and Sanger,F. 90 TITLE DNA sequence at the C termini of the overlapping genes A and B in 91 bacteriophage phi X174 92 JOURNAL Nature 265 (5596), 702-705 (1977) 93 MEDLINE 77171178 94 PUBMED 859575 95REFERENCE 13 (bases 1 to 5375) 96 AUTHORS Sanger,F., Air,G.M., Barrell,B.G., Brown,N.L., Coulson,A.R., 97 Fiddes,C.A., Hutchison,C.A., Slocombe,P.M. and Smith,M. 98 TITLE Nucliotide sequence of bacteriophage phi X174 DNA 99 JOURNAL Nature 265 (5596), 687-695 (1977) 100 MEDLINE 77171175 101 PUBMED 870828 102REFERENCE 14 (bases 4505 to 5374) 103 AUTHORS Brown,N.L. and Smith,M. 104 TITLE The sequence of a region of bacteriophage phiX174 DNA coding for 105 parts of genes A and B 106 JOURNAL J. Mol. Biol. 116 (1), 1-28 (1977) 107 MEDLINE 78069208 108 PUBMED 592379 109REFERENCE 15 (sites) 110 AUTHORS Fiddes,J.C. 111 TITLE The nucleotide sequence of a viral DNA 112 JOURNAL Sci. Am. 237 (6), 54-67 (1977) 113 MEDLINE 78054683 114 PUBMED 929160 115REFERENCE 16 (bases 1 to 5386) 116 AUTHORS Sanger,F., Coulson,A.R., Friedmann,T., Air,G.M., Barrell,B.G., 117 Brown,N.L., Fiddes,J.C., Hutchison,C.A. III, Slocombe,P.M. and 118 Smith,M. 119 TITLE The nucleotide sequence of bacteriophage phiX174 120 JOURNAL J. Mol. Biol. 125 (2), 225-246 (1978) 121 MEDLINE 79091185 122 PUBMED 731693 123REFERENCE 17 (bases 1290 to 1302; 1340 to 1430; 1510 to 1570; 1600 to 1750) 124 AUTHORS Air,G.M., Coulson,A.R., Fiddes,J.C., Friedmann,T., Hutchison,C.A. 125 III, Sanger,F., Slocombe,P.M. and Smith,A.J. 126 TITLE Nucleotide sequence of the F protein coding region of bacteriophage 127 phiX174 and the amino acid sequence of its product 128 JOURNAL J. Mol. Biol. 125 (2), 247-254 (1978) 129 MEDLINE 79091186 130 PUBMED 731694 131REFERENCE 18 (bases 4256 to 4317) 132 AUTHORS Langeveld,S.A., van Mansfeld,A.D., de Winter,J.M. and Weisbeek,P.J. 133 TITLE Cleavage of single-stranded DNA by the A and A* proteins of 134 bacteriophage phi X174 135 JOURNAL Nucleic Acids Res. 7 (8), 2177-2188 (1979) 136 MEDLINE 80101074 137 PUBMED 160544 138REFERENCE 19 (bases 4248 to 4332) 139 AUTHORS Heidekamp,F., Langeveld,S.A., Baas,P.D. and Jansz,H.S. 140 TITLE Studies of the recognition sequence of phi X174 gene A protein. 141 Cleavage site of phi X gene A protein in St-1 RFI DNA 142 JOURNAL Nucleic Acids Res. 8 (9), 2009-2021 (1980) 143 MEDLINE 81053861 144 PUBMED 6253953 145REFERENCE 20 (bases 436 to 490; 630 to 669; 930 to 979) 146 AUTHORS Takeshita,M., Kappen,L.S., Grollman,A.P., Eisenberg,M. and 147 Goldberg,I.H. 148 TITLE Strand scission of deoxyribonucleic acid by neocarzinostatin, 149 auromomycin, and bleomycin: studies on base release and nucleotide 150 sequence specificity 151 JOURNAL Biochemistry (N.Y.) 20 (26), 7599-7606 (1981) 152 MEDLINE 82113627 153 PUBMED 6173064 154REFERENCE 21 (bases 449 to 482; 504 to 598; 1047 to 1111) 155 AUTHORS Ueda,K., Morita,J. and Komano,T. 156 TITLE Sequence specificity of heat-labile sites in DNA induced by 157 mitomycin C 158 JOURNAL Biochemistry (N.Y.) 23 (8), 1634-1640 (1984) 159 MEDLINE 84203526 160 PUBMED 6232949 161REFERENCE 22 (bases 1064 to 1757) 162 AUTHORS Merville,M.P., Piette,J., Lopez,M., Decuyper,J. and van de Vorst,A. 163 TITLE Termination sites of the in vitro DNA synthesis on single-stranded 164 DNA photosensitized by promazines 165 JOURNAL J. Biol. Chem. 259 (24), 15069-15077 (1984) 166 MEDLINE 85079985 167 PUBMED 6239864 168REFERENCE 23 (bases 2380 to 2512; 2593 to 2786; 2788 to 2947) 169 AUTHORS Air,G.M., Els,M.C., Brown,L.E., Laver,W.G. and Webster,R.G. 170 TITLE Location of antigenic sites on the three-dimensional structure of 171 the influenza N2 virus neuraminidase 172 JOURNAL Virology 145 (2), 237-248 (1985) 173 MEDLINE 85274373 174 PUBMED 2411049 175COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The 176 reference sequence was derived from J02482. 177 [8] intermittent sequences. 178 [15] review; discussion of complete genome. 179 Double checked with sumex tape. 180 Single-stranded circular DNA which codes for eleven proteins. 181 Replicative form is duplex, icosahedron, related to s13 & g4. [21] 182 indicates that mitomycin C reduced with sodium borohydride induced 183 heat-labile sites in DNA most preferentially at dinucleotide 184 sequence 'gt' (especially 'Pu-g-t'). 185 Bacteriophage phi-X174 single stranded DNA molecules were 186 irradiated with near UV light in the presence of promazine 187 derivatives, after priming with restriction fragments or synthetic 188 primers [22]. The resulting DNA fragments were used as templates 189 for in vitro complementary chain synthesis by E.coli DNA polymerase 190 I [22]. More than 90% of the observed chain terminations were 191 mapped one nucleotide before a guanine residue [22]. Photoreaction 192 occurred more predominantly with guanine residues localized in 193 single-stranded parts of the genome [22]. These same guanine 194 residues could also be damaged when the reaction was performed in 195 the dark, in the presence of promazine cation radicals [22]. 196FEATURES Location/Qualifiers 197 source 1..5386 198 /organism="coliphage phiX174" 199 /specific_host="Escherichia coli" 200 /db_xref="taxon:10847" 201 CDS join(3981..5386,1..136) 202 /codon_start=1 203 /transl_table=11 204 /product="rf replication, viral strand synthesis protein" 205 /protein_id="NP_040703.1" 206 /db_xref="GI:9626373" 207 /translation="MVRSYYPSECHADYFDFERIEALKPAIEACGISTLSQSPMLGFH 208 KQMDNRIKLLEEILSFRMQGVEFDNGDMYVDGHKAASDVRDEFVSVTEKLMDELAQCY 209 NVLPQLDINNTIDHRPEGDEKWFLENEKTVTQFCRKLAAERPLKDIRDEYNYPKKKGI 210 KDECSRLLEASTMKSRRGFAIQRLMNAMRQAHADGWFIVFDTLTLADDRLEAFYDNPN 211 ALRDYFRDIGRMVLAAEGRKANDSHADCYQYFCVPEYGTANGRLHFHAVHFMRTLPTG 212 SVDPNFGRRVRNRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWLWPVDAKGEPLKA 213 TSYMAVGFYVAKYVNKKSDMDLAAKGLGAKEWNNSLKTKLSLLPKKLFRIRMSRNFGM 214 KMLTMTNLSTECLIQLTKLGYDATPFNQILKQNAKREMRLRLGKVTVADVLAAQPVTT 215 NLLKFMRASIKMIGVSNLQSFIASMTQKLTLSDISDESKNYLDKAGITTACLRIKSKW 216 TAGGK" 217 CDS join(4497..5386,1..136) 218 /codon_start=1 219 /transl_table=11 220 /product="shut off host DNA synthesis protein" 221 /protein_id="NP_040704.1" 222 /db_xref="GI:9626374" 223 /translation="MKSRRGFAIQRLMNAMRQAHADGWFIVFDTLTLADDRLEAFYDN 224 PNALRDYFRDIGRMVLAAEGRKANDSHADCYQYFCVPEYGTANGRLHFHAVHFMRTLP 225 TGSVDPNFGRRVRNRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWLWPVDAKGEPL 226 KATSYMAVGFYVAKYVNKKSDMDLAAKGLGAKEWNNSLKTKLSLLPKKLFRIRMSRNF 227 GMKMLTMTNLSTECLIQLTKLGYDATPFNQILKQNAKREMRLRLGKVTVADVLAAQPV 228 TTNLLKFMRASIKMIGVSNLQSFIASMTQKLTLSDISDESKNYLDKAGITTACLRIKS 229 KWTAGGK" 230 CDS join(5075..5386,1..51) 231 /codon_start=1 232 /transl_table=11 233 /product="capsid morphogenesis protein" 234 /protein_id="NP_040705.1" 235 /db_xref="GI:9626375" 236 /translation="MEQLTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTY 237 QAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQ 238 PAEFYRFHDAEVNTFGYF" 239 variation 23 240 /note="c in wt; t in am18 and am35 [14]" 241 variation 25 242 /note="g in wt; c in ts116 [14]" 243 CDS 51..221 244 /codon_start=1 245 /transl_table=11 246 /product="gene K protein" 247 /protein_id="NP_040706.1" 248 /db_xref="GI:9626376" 249 /translation="MSRKIILIKQELLLLVYELNRSGLLAENEKIRPILAQLEKLLLC 250 DLSPSTNDSVKN" 251 variation 57 252 /note="c in wt; t in am6 [14]" 253 variation 117 254 /note="g in wt; a in am6 [14]" 255 CDS 133..393 256 /codon_start=1 257 /transl_table=11 258 /product="DNA maturation protein" 259 /protein_id="NP_040707.1" 260 /db_xref="GI:9626377" 261 /translation="MRKFDLSLRSSRSSYFATFRHQLTILSKTDALDEEKWLNMLGTF 262 VKDWFRYESHFVHGRDSLVDILKERGLLSESDAVQPLIGKKS" 263 mRNA 358..3975 264 /note="mRNA (major alt.)" 265 mRNA 358..991 266 /note="mRNA (minor alt.)" 267 CDS 390..848 268 /codon_start=1 269 /transl_table=11 270 /product="capsid morphogenesis protein" 271 /protein_id="NP_040708.1" 272 /db_xref="GI:9626378" 273 /translation="MSQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWI 274 ATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAE 275 FTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM" 276 CDS 568..843 277 /codon_start=1 278 /transl_table=11 279 /product="cell lysis protein" 280 /protein_id="NP_040709.1" 281 /db_xref="GI:9626379" 282 /translation="MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNL 283 RKTLLMASSVRLKPLNCSRLPCVYAQETLTFLLTQKKTCVKNYVRKE" 284 CDS 848..964 285 /codon_start=1 286 /transl_table=11 287 /product="core protein, DNA condensation protein" 288 /protein_id="NP_040710.1" 289 /db_xref="GI:9626380" 290 /translation="MSKGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF" 291 CDS 1001..2284 292 /codon_start=1 293 /transl_table=11 294 /product="major coat protein" 295 /protein_id="NP_040711.1" 296 /db_xref="GI:9626381" 297 /translation="MSNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEM 298 DAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQWIKFMKDGVNATPLPTVNTTG 299 YIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYG 300 FRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHD 301 VISSFGGKTSYDADNRPLLVMRSNLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRF 302 FVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREISMKDV 303 FRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYD 304 QCFQSVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS" 305 CDS 2395..2922 306 /codon_start=1 307 /transl_table=11 308 /product="major spike protein" 309 /protein_id="NP_040712.1" 310 /db_xref="GI:9626382" 311 /translation="MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYF 312 DSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTT 313 LPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVS 314 LNQVIKEIICLQPLK" 315 CDS 2931..3917 316 /codon_start=1 317 /transl_table=11 318 /product="minor spike protein, adsorption" 319 /protein_id="NP_040713.1" 320 /db_xref="GI:9626383" 321 /translation="MFGAIAGGIASALAGGAMSKLFGGGQKAASGGIQGDVLATDNNT 322 VGMGDAGIKSAIQGSNVPNPDEAAPSFVSGAMAKAGKGLLEGTLQAGTSAVSDKLLDL 323 VGLGGKSAADKGKDTRDYLAAAFPELNAWERAGADASSAGMVDAGFENQKELTKMQLD 324 NQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQNEMLAYQQKESTARVASIMENTN 325 LSKQQQVSEIMRQMLTQAQTAGQYFTNDQIKEMTRKVSAEVDLVHQQTQNQRYGSSHI 326 GATAKDISNVVTDAASGVVDIFHGIDKAVADTWNNFWKDGKADGIGSNLSRK" 327 misc_feature 3962 328 /note="transcription start site" 329 rep_origin 4306 330 /note="origin of viral strand synthesis" 331 misc_feature 4899 332 /note="transcription start site" 333BASE COUNT 1291 a 1157 c 1254 g 1684 t 334ORIGIN 335 1 gagttttatc gcttccatga cgcagaagtt aacactttcg gatatttctg atgagtcgaa 336 61 aaattatctt gataaagcag gaattactac tgcttgttta cgaattaaat cgaagtggac 337 121 tgctggcgga aaatgagaaa attcgaccta tccttgcgca gctcgagaag ctcttacttt 338 181 gcgacctttc gccatcaact aacgattctg tcaaaaactg acgcgttgga tgaggagaag 339 241 tggcttaata tgcttggcac gttcgtcaag gactggttta gatatgagtc acattttgtt 340 301 catggtagag attctcttgt tgacatttta aaagagcgtg gattactatc tgagtccgat 341 361 gctgttcaac cactaatagg taagaaatca tgagtcaagt tactgaacaa tccgtacgtt 342 421 tccagaccgc tttggcctct attaagctca ttcaggcttc tgccgttttg gatttaaccg 343 481 aagatgattt cgattttctg acgagtaaca aagtttggat tgctactgac cgctctcgtg 344 541 ctcgtcgctg cgttgaggct tgcgtttatg gtacgctgga ctttgtggga taccctcgct 345 601 ttcctgctcc tgttgagttt attgctgccg tcattgctta ttatgttcat cccgtcaaca 346 661 ttcaaacggc ctgtctcatc atggaaggcg ctgaatttac ggaaaacatt attaatggcg 347 721 tcgagcgtcc ggttaaagcc gctgaattgt tcgcgtttac cttgcgtgta cgcgcaggaa 348 781 acactgacgt tcttactgac gcagaagaaa acgtgcgtca aaaattacgt gcggaaggag 349 841 tgatgtaatg tctaaaggta aaaaacgttc tggcgctcgc cctggtcgtc cgcagccgtt 350 901 gcgaggtact aaaggcaagc gtaaaggcgc tcgtctttgg tatgtaggtg gtcaacaatt 351 961 ttaattgcag gggcttcggc cccttacttg aggataaatt atgtctaata ttcaaactgg 352 1021 cgccgagcgt atgccgcatg acctttccca tcttggcttc cttgctggtc agattggtcg 353 1081 tcttattacc atttcaacta ctccggttat cgctggcgac tccttcgaga tggacgccgt 354 1141 tggcgctctc cgtctttctc cattgcgtcg tggccttgct attgactcta ctgtagacat 355 1201 ttttactttt tatgtccctc atcgtcacgt ttatggtgaa cagtggatta agttcatgaa 356 1261 ggatggtgtt aatgccactc ctctcccgac tgttaacact actggttata ttgaccatgc 357 1321 cgcttttctt ggcacgatta accctgatac caataaaatc cctaagcatt tgtttcaggg 358 1381 ttatttgaat atctataaca actattttaa agcgccgtgg atgcctgacc gtaccgaggc 359 1441 taaccctaat gagcttaatc aagatgatgc tcgttatggt ttccgttgct gccatctcaa 360 1501 aaacatttgg actgctccgc ttcctcctga gactgagctt tctcgccaaa tgacgacttc 361 1561 taccacatct attgacatta tgggtctgca agctgcttat gctaatttgc atactgacca 362 1621 agaacgtgat tacttcatgc agcgttacca tgatgttatt tcttcatttg gaggtaaaac 363 1681 ctcttatgac gctgacaacc gtcctttact tgtcatgcgc tctaatctct gggcatctgg 364 1741 ctatgatgtt gatggaactg accaaacgtc gttaggccag ttttctggtc gtgttcaaca 365 1801 gacctataaa cattctgtgc cgcgtttctt tgttcctgag catggcacta tgtttactct 366 1861 tgcgcttgtt cgttttccgc ctactgcgac taaagagatt cagtacctta acgctaaagg 367 1921 tgctttgact tataccgata ttgctggcga ccctgttttg tatggcaact tgccgccgcg 368 1981 tgaaatttct atgaaggatg ttttccgttc tggtgattcg tctaagaagt ttaagattgc 369 2041 tgagggtcag tggtatcgtt atgcgccttc gtatgtttct cctgcttatc accttcttga 370 2101 aggcttccca ttcattcagg aaccgccttc tggtgatttg caagaacgcg tacttattcg 371 2161 ccaccatgat tatgaccagt gtttccagtc cgttcagttg ttgcagtgga atagtcaggt 372 2221 taaatttaat gtgaccgttt atcgcaatct gccgaccact cgcgattcaa tcatgacttc 373 2281 gtgataaaag attgagtgtg aggttataac gccgaagcgg taaaaatttt aatttttgcc 374 2341 gctgaggggt tgaccaagcg aagcgcggta ggttttctgc ttaggagttt aatcatgttt 375 2401 cagactttta tttctcgcca taattcaaac tttttttctg ataagctggt tctcacttct 376 2461 gttactccag cttcttcggc acctgtttta cagacaccta aagctacatc gtcaacgtta 377 2521 tattttgata gtttgacggt taatgctggt aatggtggtt ttcttcattg cattcagatg 378 2581 gatacatctg tcaacgccgc taatcaggtt gtttctgttg gtgctgatat tgcttttgat 379 2641 gccgacccta aattttttgc ctgtttggtt cgctttgagt cttcttcggt tccgactacc 380 2701 ctcccgactg cctatgatgt ttatcctttg aatggtcgcc atgatggtgg ttattatacc 381 2761 gtcaaggact gtgtgactat tgacgtcctt ccccgtacgc cgggcaataa cgtttatgtt 382 2821 ggtttcatgg tttggtctaa ctttaccgct actaaatgcc gcggattggt ttcgctgaat 383 2881 caggttatta aagagattat ttgtctccag ccacttaagt gaggtgattt atgtttggtg 384 2941 ctattgctgg cggtattgct tctgctcttg ctggtggcgc catgtctaaa ttgtttggag 385 3001 gcggtcaaaa agccgcctcc ggtggcattc aaggtgatgt gcttgctacc gataacaata 386 3061 ctgtaggcat gggtgatgct ggtattaaat ctgccattca aggctctaat gttcctaacc 387 3121 ctgatgaggc cgcccctagt tttgtttctg gtgctatggc taaagctggt aaaggacttc 388 3181 ttgaaggtac gttgcaggct ggcacttctg ccgtttctga taagttgctt gatttggttg 389 3241 gacttggtgg caagtctgcc gctgataaag gaaaggatac tcgtgattat cttgctgctg 390 3301 catttcctga gcttaatgct tgggagcgtg ctggtgctga tgcttcctct gctggtatgg 391 3361 ttgacgccgg atttgagaat caaaaagagc ttactaaaat gcaactggac aatcagaaag 392 3421 agattgccga gatgcaaaat gagactcaaa aagagattgc tggcattcag tcggcgactt 393 3481 cacgccagaa tacgaaagac caggtatatg cacaaaatga gatgcttgct tatcaacaga 394 3541 aggagtctac tgctcgcgtt gcgtctatta tggaaaacac caatctttcc aagcaacagc 395 3601 aggtttccga gattatgcgc caaatgctta ctcaagctca aacggctggt cagtatttta 396 3661 ccaatgacca aatcaaagaa atgactcgca aggttagtgc tgaggttgac ttagttcatc 397 3721 agcaaacgca gaatcagcgg tatggctctt ctcatattgg cgctactgca aaggatattt 398 3781 ctaatgtcgt cactgatgct gcttctggtg tggttgatat ttttcatggt attgataaag 399 3841 ctgttgccga tacttggaac aatttctgga aagacggtaa agctgatggt attggctcta 400 3901 atttgtctag gaaataaccg tcaggattga caccctccca attgtatgtt ttcatgcctc 401 3961 caaatcttgg aggctttttt atggttcgtt cttattaccc ttctgaatgt cacgctgatt 402 4021 attttgactt tgagcgtatc gaggctctta aacctgctat tgaggcttgt ggcatttcta 403 4081 ctctttctca atccccaatg cttggcttcc ataagcagat ggataaccgc atcaagctct 404 4141 tggaagagat tctgtctttt cgtatgcagg gcgttgagtt cgataatggt gatatgtatg 405 4201 ttgacggcca taaggctgct tctgacgttc gtgatgagtt tgtatctgtt actgagaagt 406 4261 taatggatga attggcacaa tgctacaatg tgctccccca acttgatatt aataacacta 407 4321 tagaccaccg ccccgaaggg gacgaaaaat ggtttttaga gaacgagaag acggttacgc 408 4381 agttttgccg caagctggct gctgaacgcc ctcttaagga tattcgcgat gagtataatt 409 4441 accccaaaaa gaaaggtatt aaggatgagt gttcaagatt gctggaggcc tccactatga 410 4501 aatcgcgtag aggctttgct attcagcgtt tgatgaatgc aatgcgacag gctcatgctg 411 4561 atggttggtt tatcgttttt gacactctca cgttggctga cgaccgatta gaggcgtttt 412 4621 atgataatcc caatgctttg cgtgactatt ttcgtgatat tggtcgtatg gttcttgctg 413 4681 ccgagggtcg caaggctaat gattcacacg ccgactgcta tcagtatttt tgtgtgcctg 414 4741 agtatggtac agctaatggc cgtcttcatt tccatgcggt gcactttatg cggacacttc 415 4801 ctacaggtag cgttgaccct aattttggtc gtcgggtacg caatcgccgc cagttaaata 416 4861 gcttgcaaaa tacgtggcct tatggttaca gtatgcccat cgcagttcgc tacacgcagg 417 4921 acgctttttc acgttctggt tggttgtggc ctgttgatgc taaaggtgag ccgcttaaag 418 4981 ctaccagtta tatggctgtt ggtttctatg tggctaaata cgttaacaaa aagtcagata 419 5041 tggaccttgc tgctaaaggt ctaggagcta aagaatggaa caactcacta aaaaccaagc 420 5101 tgtcgctact tcccaagaag ctgttcagaa tcagaatgag ccgcaacttc gggatgaaaa 421 5161 tgctcacaat gacaaatctg tccacggagt gcttaatcca acttaccaag ctgggttacg 422 5221 acgcgacgcc gttcaaccag atattgaagc agaacgcaaa aagagagatg agattgaggc 423 5281 tgggaaaagt tactgtagcc gacgttttgg cggcgcaacc tgtgacgaca aatctgctca 424 5341 aatttatgcg cgcttcgata aaaatgattg gcgtatccaa cctgca 425// 426