1msgid "" 2msgstr "" 3"Content-Type: text/plain; charset=UTF-8\n" 4"Project-Id-Version: Lazarus ide\n" 5"POT-Creation-Date: 18.06.2019\n" 6"PO-Revision-Date: 2020-05-05 01:29+0300\n" 7"MIME-Version: 1.0\n" 8"Content-Transfer-Encoding: 8bit\n" 9"X-Generator: Poedit 2.3\n" 10"Last-Translator: Onur ERÇELEN <onur2x@gmail.com>\n" 11"Plural-Forms: nplurals=2; plural=(n != 1);\n" 12"Language: tr_TR\n" 13"X-Poedit-SourceCharset: UTF-8\n" 14"Language-Team: \n" 15 16#: lazarusidestrconsts.dbgbreakgroupdlgcaption 17msgid "Select Groups" 18msgstr "Grupları Seç" 19 20#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable 21msgid "Select groups to disable when breakpoint is hit" 22msgstr "Kesme noktasına gelindiğinde devre dışı bırakılacak grupları seç" 23 24#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable 25msgid "Select groups to enable when breakpoint is hit" 26msgstr "Kesme noktasına gelindiğinde etkinleştirilecek grupları seç" 27 28#: lazarusidestrconsts.dbgbreakpropertygroupnotfound 29#, object-pascal-format 30msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s" 31msgstr "Etkin/Devre dışı listesindeki bazı gruplar mevcut değil.%0:sOluşturulsun mu?%0:s%0:s%1:s" 32 33#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint 34#, object-pascal-format 35msgid "Address Breakpoint %s" 36msgstr "Adres Kesişim noktası %s" 37 38#: lazarusidestrconsts.dbgeventbreakataddress 39#, object-pascal-format 40msgid "at $%s" 41msgstr "$%s adresinde" 42 43#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline 44#, object-pascal-format 45msgid "at $%s: from origin %s line %d" 46msgstr "$%s adresinde: %s satır %d" 47 48#: lazarusidestrconsts.dbgeventbreakataddresssourceline 49#, object-pascal-format 50msgid "at $%s: %s line %d" 51msgstr "$%s adresinde: %s satır %d" 52 53#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint 54#, object-pascal-format 55msgid "Source Breakpoint %s" 56msgstr "Kaynak Kesme Noktası %s" 57 58#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint 59#, object-pascal-format 60msgid "Unknown Breakpoint %s" 61msgstr "Bilinmeyen Kesme Noktası %s" 62 63#: lazarusidestrconsts.dbgeventbreakwatchpoint 64#, object-pascal-format 65msgid "Watchpoint %s" 66msgstr "İzleme Noktası %s" 67 68#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended 69#, object-pascal-format 70msgid "Unknown Watchpoint out of scope %s" 71msgstr "Bilinmeyen İzleme Noktası kapsam dışında %s" 72 73#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered 74#, object-pascal-format 75msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\"" 76msgstr "Bilinmeyen İzleme Noktası tetiklendi %s. Eski değer \"%s\", Yeni Değer \"%s\"" 77 78#: lazarusidestrconsts.dbgeventwatchscopeended 79#, object-pascal-format 80msgid "Watchpoint for \"%s\" out of scope %s" 81msgstr "\"%s\" için İzleme Noktası kapsam dışında %s" 82 83#: lazarusidestrconsts.dbgeventwatchtriggered 84#, object-pascal-format 85msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\"" 86msgstr "\"%s\" için İzleme Noktası tetiklendi %s. Eski değer \"%s\", Yeni Değer \"%s\"" 87 88#: lazarusidestrconsts.dlfmousepredefinedscheme 89msgid "Use predefined scheme" 90msgstr "Öntanımlı düzeni kullan" 91 92#: lazarusidestrconsts.dlfmouseresetall 93msgid "Reset all settings" 94msgstr "Tüm ayarları sıfırla" 95 96#: lazarusidestrconsts.dlfmouseresetgutter 97msgid "Reset all gutter settings" 98msgstr "Tüm cilt ayarlarını sıfırla" 99 100#: lazarusidestrconsts.dlfmouseresettext 101msgid "Reset all text settings" 102msgstr "Tüm metin ayarlarını sıfırla" 103 104#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint 105msgid "Add history point" 106msgstr "Geçmiş noktası ekle" 107 108#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu 109msgid "Context Menu" 110msgstr "İçerik Menüsü" 111 112#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg 113msgid "Context Menu (debug)" 114msgstr "İçerik Menüsü (hata ayıklama)" 115 116#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab 117msgid "Context Menu (tab)" 118msgstr "İçerik Menüsü (sekme)" 119 120#: lazarusidestrconsts.dlfmousesimplebuttondeclaration 121msgid "Jumps to implementation" 122msgstr "İmplementation a atla" 123 124#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock 125msgid "Jumps to implementation/other block end" 126msgstr "İmplementation/diğer blok sonuna atla" 127 128#: lazarusidestrconsts.dlfmousesimplebuttonhistback 129msgid "History back" 130msgstr "Geçmiş geri" 131 132#: lazarusidestrconsts.dlfmousesimplebuttonhistforw 133msgid "History forward" 134msgstr "Geçmiş İleri" 135 136#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle 137msgid "Toggle extra Caret" 138msgstr "Ekstra düzenleme işaretini aç/kapat" 139 140#: lazarusidestrconsts.dlfmousesimplebuttonnothing 141msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing" 142msgid "Nothing/Default" 143msgstr "Hiçbir şey/Varsayılan" 144 145#: lazarusidestrconsts.dlfmousesimplebuttonpaste 146msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste" 147msgid "Paste" 148msgstr "Yapıştır" 149 150#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue 151#, object-pascal-format 152msgid "Continue %0:s (Bound to: %1:s)" 153msgstr "Devam et %0:s (%1:s bağlantılı)" 154 155#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain 156#, object-pascal-format 157msgid "Continue %0:s" 158msgstr "Devam et %0:s" 159 160#: lazarusidestrconsts.dlfmousesimplebuttonselect 161msgid "Select text" 162msgstr "Metni seçin" 163 164#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline 165msgid "Select text (lines)" 166msgstr "Metni seçin (satırlar)" 167 168#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken 169msgid "Select text (tokens)" 170msgstr "Metni seçin (jetonlar)" 171 172#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword 173msgid "Select text (words)" 174msgstr "Metni seçin (kelimeler)" 175 176#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn 177msgid "Select text (Column mode)" 178msgstr "Metni seçin (Sütun modu)" 179 180#: lazarusidestrconsts.dlfmousesimplebuttonselectline 181msgid "Select text (Line mode)" 182msgstr "Metni seçin (Hat modu)" 183 184#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark 185msgid "Set free bookmark" 186msgstr "Serbest yer imi ayarla" 187 188#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull 189msgid "Select current Line (Full)" 190msgstr "Geçerli Satırı Seç (Tam)" 191 192#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart 193msgid "Select current Line (Text)" 194msgstr "Geçerli Satırı Seç (Metin)" 195 196#: lazarusidestrconsts.dlfmousesimplebuttonsetpara 197msgid "Select current Paragraph" 198msgstr "Geçerli Paragraf Seç" 199 200#: lazarusidestrconsts.dlfmousesimplebuttonsetword 201msgid "Select current Word" 202msgstr "Geçerli Kelimeyi Seç" 203 204#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset 205msgid "Reset zoom" 206msgstr "Yakınlaştırmayı sıfırla" 207 208#: lazarusidestrconsts.dlfmousesimplediff 209msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" 210msgstr "Bu sayfa geçerli ayarlarınızı göstermiyor. Gelişmiş sayfaya bakınız. Gelişmiş değişiklikleri sıfırlamak için bu sayfayı kullanın" 211 212#: lazarusidestrconsts.dlfmousesimplegenericsect 213msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" 214msgid "General" 215msgstr "Genel" 216 217#: lazarusidestrconsts.dlfmousesimplegutterleftdown 218msgid "Standard, All actions (breakpoint, fold) on mouse down" 219msgstr "Standart, Tüm eylemler (kesme noktası, katlama) fareyle aşağıya doğru" 220 221#: lazarusidestrconsts.dlfmousesimplegutterleftup 222msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" 223msgstr "Genişletilmiş, Eylemler (kesme noktası, katlama) fareyle yukarı doğru fare üzerinde aşağıya doğru seçim ve taşıma" 224 225#: lazarusidestrconsts.dlfmousesimplegutterleftupright 226msgid "Extended, Actions, right gutter half only" 227msgstr "Genişletilmiş, Eylemler, sağ cilt payı f sadece yarım" 228 229#: lazarusidestrconsts.dlfmousesimplegutterlines 230msgid "Use line numbers to select lines" 231msgstr "Satırları seçmek için satır sayısını kullanın" 232 233#: lazarusidestrconsts.dlfmousesimpleguttersect 234msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" 235msgid "Gutter" 236msgstr "Cilt Payı" 237 238#: lazarusidestrconsts.dlfmousesimplerightmovecaret 239msgid "Right button click includes caret move" 240msgstr "Sağ fare hareketi içerir" 241 242#: lazarusidestrconsts.dlfmousesimpletextsect 243msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" 244msgid "Text" 245msgstr "Metin" 246 247#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel 248msgid "Alt-Ctrl Button" 249msgstr "Alt-Ctrl Düğmesi" 250 251#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel 252msgid "Alt-Ctrl Wheel" 253msgstr "Alt-Ctrl Tekerleği" 254 255#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel 256msgid "Alt Button" 257msgstr "Alt Düğme" 258 259#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel 260msgid "Alt Wheel" 261msgstr "Alt Tekerlek" 262 263#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel 264msgid "Ctrl Button" 265msgstr "Ctrl Düğmesi" 266 267#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel 268msgid "Ctrl Wheel" 269msgstr "Ctrl Tekerlek" 270 271#: lazarusidestrconsts.dlfmousesimpletextsectdrag 272msgid "Drag selection (copy/paste)" 273msgstr "Seçimi sürükleyin (kopyala / yapıştır)" 274 275#: lazarusidestrconsts.dlfmousesimpletextsectextra1label 276msgid "Extra-1 Button" 277msgstr "Ekstra-1 Düğmesi" 278 279#: lazarusidestrconsts.dlfmousesimpletextsectextra2label 280msgid "Extra-2 Button" 281msgstr "Ekstra 2 Düğme" 282 283#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel 284msgid "Alt Double" 285msgstr "Alt Çift" 286 287#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel 288msgid "Ctrl Double" 289msgstr "Ctrl Çift" 290 291#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel 292msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" 293msgid "Double" 294msgstr "Çift" 295 296#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel 297msgid "Shift Double" 298msgstr "Shift Çift" 299 300#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel 301msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" 302msgid "Quad" 303msgstr "Dörtlü" 304 305#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel 306msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel" 307msgid "Triple" 308msgstr "Üçlü" 309 310#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel 311msgid "Middle Button" 312msgstr "Orta Düğme" 313 314#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn 315msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn" 316msgid "Middle" 317msgstr "Orta" 318 319#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1 320msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1" 321msgid "Extra 1" 322msgstr "Ekstra 1" 323 324#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2 325msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2" 326msgid "Extra 2" 327msgstr "Ekstra 2" 328 329#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel 330msgid "Horizontal-Wheel" 331msgstr "Yatay tekerlek" 332 333#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod 334msgid "Left 1" 335msgstr "Sol 1" 336 337#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti 338msgid "Left 2" 339msgstr "Sol 2" 340 341#: lazarusidestrconsts.dlfmousesimpletextsectpageright 342msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright" 343msgid "Right" 344msgstr "Sağ" 345 346#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel 347msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel" 348msgid "Wheel" 349msgstr "Tekerlek" 350 351#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel 352msgid "Right Button" 353msgstr "Sağ Düğme" 354 355#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel 356msgid "Shift-Alt-Ctrl Button" 357msgstr "Shift-Alt-Ctrl Düğmesi" 358 359#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel 360msgid "Shift-Alt-Ctrl" 361msgstr "Shift-Alt-Ctrl" 362 363#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel 364msgid "Shift-Alt Button" 365msgstr "ÜstKrkt-Alt Düğmesi" 366 367#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel 368msgid "Shift-Alt Wheel" 369msgstr "ÜstKrkt-Alt Tekerlek" 370 371#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel 372msgid "Shift-Ctrl Button" 373msgstr "Shift-Ctrl Düğmesi" 374 375#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel 376msgid "Shift-Ctrl Wheel" 377msgstr "Üst Karakter-Ctrl Tekerleği" 378 379#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel 380msgid "Shift Button" 381msgstr "Üst Karakter Düğmesi" 382 383#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel 384msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel" 385msgid "Wheel" 386msgstr "Tekerlek" 387 388#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel 389msgid "Shift Wheel" 390msgstr "Tekerlek kaydırması" 391 392#: lazarusidestrconsts.dlfmousesimplewarning 393msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" 394msgstr "Kaydedilmemiş değişiklikleriniz mevcut. Bu sayfanın kullanılması, gelişmiş sayfada yapılan değişiklikleri geri alır" 395 396#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef 397msgid "Scroll horizontal (System speed)" 398msgstr "Yatay kaydır (Sistem hızı)" 399 400#: lazarusidestrconsts.dlfmousesimplewheelhsrollline 401msgid "Scroll horizontal (Single line)" 402msgstr "Yatay kaydır (Tek satır)" 403 404#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage 405msgid "Scroll horizontal (Page)" 406msgstr "Yatay kaydır (Sayfa)" 407 408#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf 409msgid "Scroll horizontal (Half page)" 410msgstr "Yatay kaydır (yarım sayfa)" 411 412#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless 413msgid "Scroll horizontal (Page, less one line)" 414msgstr "Yatay kaydır (Sayfa, daha az bir satır)" 415 416#: lazarusidestrconsts.dlfmousesimplewheelnothing 417msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing" 418msgid "Nothing/Default" 419msgstr "Hiçbir şey / Varsayılan" 420 421#: lazarusidestrconsts.dlfmousesimplewheelsrolldef 422msgid "Scroll (System speed)" 423msgstr "Kaydırma (Sistem hızı)" 424 425#: lazarusidestrconsts.dlfmousesimplewheelsrollline 426msgid "Scroll (Single line)" 427msgstr "Kaydır (Tek satır)" 428 429#: lazarusidestrconsts.dlfmousesimplewheelsrollpage 430msgid "Scroll (Page)" 431msgstr "Kaydırma (Sayfa)" 432 433#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf 434msgid "Scroll (Half page)" 435msgstr "Kaydırma (Yarım sayfa)" 436 437#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless 438msgid "Scroll (Page, less one line)" 439msgstr "Kaydırma (Sayfa, daha az bir satır)" 440 441#: lazarusidestrconsts.dlfmousesimplewheelzoom 442msgid "Zoom" 443msgstr "Yakınlaştırma" 444 445#: lazarusidestrconsts.dlfnopredefinedscheme 446msgid "< None >" 447msgstr "<Hiçbiri>" 448 449#: lazarusidestrconsts.dlfreadonlycolor 450msgctxt "lazarusidestrconsts.dlfreadonlycolor" 451msgid "Read Only" 452msgstr "Sadece oku" 453 454#: lazarusidestrconsts.dlg1up2low 455msgid "Lowercase, first letter up" 456msgstr "Küçük harf, ilk harf büyük" 457 458#: lazarusidestrconsts.dlgactivedesktop 459msgid "active" 460msgstr "aktif" 461 462#: lazarusidestrconsts.dlgaddassignmentoperator 463msgid "Add assignment operator :=" 464msgstr "Atama operatörü ekle :=" 465 466#: lazarusidestrconsts.dlgaddhiattrbracketmatch 467msgid "Brackets highlight" 468msgstr "Parantezleri vurgula" 469 470#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree 471msgid "Code folding tree" 472msgstr "Kod katlama ağacı" 473 474#: lazarusidestrconsts.dlgaddhiattrdefault 475msgid "Default Text" 476msgstr "Varsayılan Metin" 477 478#: lazarusidestrconsts.dlgaddhiattrdefaultwindow 479msgid "Default Text / Window" 480msgstr "Varsayılan Metin/Pencere" 481 482#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint 483msgid "Disabled breakpoint" 484msgstr "Kesme noktasını devre dışı bırak" 485 486#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint 487msgid "Enabled breakpoint" 488msgstr "Kesme noktasını aktif et" 489 490#: lazarusidestrconsts.dlgaddhiattrerrorline 491msgid "Error line" 492msgstr "Hata satırı" 493 494#: lazarusidestrconsts.dlgaddhiattrexecutionpoint 495msgid "Execution point" 496msgstr "Uygulama noktası" 497 498#: lazarusidestrconsts.dlgaddhiattrfoldedcode 499msgid "Folded code marker" 500msgstr "Katlanmış kod işaretleyici" 501 502#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline 503msgid "Fold start-line" 504msgstr "Katlama başlangıç çizgisi" 505 506#: lazarusidestrconsts.dlgaddhiattrgroupdefault 507msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" 508msgid "Global" 509msgstr "Küresel" 510 511#: lazarusidestrconsts.dlgaddhiattrgroupgutter 512msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" 513msgid "Gutter" 514msgstr "Cilt Payı" 515 516#: lazarusidestrconsts.dlgaddhiattrgroupifdef 517msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef" 518msgid "IfDef" 519msgstr "Ifdef" 520 521#: lazarusidestrconsts.dlgaddhiattrgroupline 522msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" 523msgid "Line" 524msgstr "Satır" 525 526#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors 527msgid "Outline Colors" 528msgstr "Anahat Renkleri" 529 530#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit 531msgid "Syncron Edit" 532msgstr "Senkron Düzenle" 533 534#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit 535msgid "Template Edit" 536msgstr "Şablon Düzenle" 537 538#: lazarusidestrconsts.dlgaddhiattrgrouptext 539msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" 540msgid "Text" 541msgstr "Metin" 542 543#: lazarusidestrconsts.dlgaddhiattrgutterseparator 544msgid "Gutter Separator" 545msgstr "Cilt Payı Ayırıcı" 546 547#: lazarusidestrconsts.dlgaddhiattrhiddencodeline 548msgid "Hide start-line" 549msgstr "Başlangıç çizgisini gizle" 550 551#: lazarusidestrconsts.dlgaddhiattrhighlightall 552msgid "Incremental others" 553msgstr "Artımlı diğerleri" 554 555#: lazarusidestrconsts.dlgaddhiattrhighlightprefix 556msgid "Highlight prefix" 557msgstr "Öneki vurgula" 558 559#: lazarusidestrconsts.dlgaddhiattrhighlightword 560msgid "Highlight current word" 561msgstr "Geçerli kelimeyi vurgula" 562 563#: lazarusidestrconsts.dlgaddhiattrincrementalsearch 564msgid "Incremental search" 565msgstr "Artımlı arama" 566 567#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint 568msgid "Invalid breakpoint" 569msgstr "Geçersiz kesme noktası" 570 571#: lazarusidestrconsts.dlgaddhiattrlinehighlight 572msgid "Current line highlight" 573msgstr "Geçerli satır vurgula" 574 575#: lazarusidestrconsts.dlgaddhiattrlinenumber 576msgid "Line number" 577msgstr "Satır numarası" 578 579#: lazarusidestrconsts.dlgaddhiattrmodifiedline 580msgid "Modified line" 581msgstr "Değiştirilmiş satır" 582 583#: lazarusidestrconsts.dlgaddhiattrmouselink 584msgid "Mouse link" 585msgstr "Fare bağlantısı" 586 587#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color 588msgid "Level 10" 589msgstr "Seviye 10" 590 591#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color 592msgid "Level 1" 593msgstr "Seviye 1" 594 595#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color 596msgid "Level 2" 597msgstr "Seviye 2" 598 599#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color 600msgid "Level 3" 601msgstr "Seviye 3" 602 603#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color 604msgid "Level 4" 605msgstr "Seviye 4" 606 607#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color 608msgid "Level 5" 609msgstr "Seviye 5" 610 611#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color 612msgid "Level 6" 613msgstr "Seviye 6" 614 615#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color 616msgid "Level 7" 617msgstr "Seviye 7" 618 619#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color 620msgid "Level 8" 621msgstr "Seviye 8" 622 623#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color 624msgid "Level 9" 625msgstr "Seviye 9" 626 627#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea 628msgid "Selected Area" 629msgstr "Seçilen Alan" 630 631#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur 632msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" 633msgid "Active Cell" 634msgstr "Aktif Hücre" 635 636#: lazarusidestrconsts.dlgaddhiattrsyncroeditother 637msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" 638msgid "Other Cells" 639msgstr "Diğer Hücreler" 640 641#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync 642msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" 643msgid "Syncronized Cells" 644msgstr "Senkronize Hücreler" 645 646#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur 647msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" 648msgid "Active Cell" 649msgstr "Aktif Hücre" 650 651#: lazarusidestrconsts.dlgaddhiattrtemplateeditother 652msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" 653msgid "Other Cells" 654msgstr "Diğer Hücreler" 655 656#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync 657msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" 658msgid "Syncronized Cells" 659msgstr "Senkronize Hücreler" 660 661#: lazarusidestrconsts.dlgaddhiattrtextblock 662msgid "Text block" 663msgstr "Metin bloğu" 664 665#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint 666msgid "Unknown breakpoint" 667msgstr "Bilinmeyen kesme noktası" 668 669#: lazarusidestrconsts.dlgaddhiattrwindowborder 670msgid "Window border" 671msgstr "Pencere kenarı" 672 673#: lazarusidestrconsts.dlgaddhiattrwordgroup 674msgid "Word-Brackets" 675msgstr "Kelime-Parantezler" 676 677#: lazarusidestrconsts.dlgaddhispecialvisiblechars 678msgid "Visualized Special Chars" 679msgstr "Görselleştirilen Özel Kare" 680 681#: lazarusidestrconsts.dlgaddnewmode 682msgid "Add new mode" 683msgstr "Yeni mod ekle" 684 685#: lazarusidestrconsts.dlgaddsemicolon 686msgid "Add semicolon" 687msgstr "Noktalı virgül ekleyin" 688 689#: lazarusidestrconsts.dlgadjusttopline 690msgid "Adjust top line due to comment in front" 691msgstr "Önündeki yorum nedeniyle üst çizgiyi ayarla" 692 693#: lazarusidestrconsts.dlgalphabetically 694msgid "Alphabetically" 695msgstr "Alfabetik" 696 697#: lazarusidestrconsts.dlgalwaysvisiblecursor 698msgid "Always keep caret in visible area of editor" 699msgstr "Düzeltme işaretleri daima editörün görünür alanında tutun" 700 701#: lazarusidestrconsts.dlgambigfileact 702msgid "Ambiguous file action:" 703msgstr "Belirsiz dosya eylemi:" 704 705#: lazarusidestrconsts.dlgambigwarn 706msgid "Warn on compile" 707msgstr "Derleme uyarısı" 708 709#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown 710msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case." 711msgstr "Bir mesajın önünde hata/uyarı/ipucu simgesi gösterilir. Aynı simge kaynak editörü oluklarında her durumda gösterir." 712 713#: lazarusidestrconsts.dlgansicommenttab 714msgid "Ansi (* *)" 715msgstr "Ansi (* *)" 716 717#: lazarusidestrconsts.dlgapplicationsettings 718msgid "Application settings" 719msgstr "Uygulama ayarları" 720 721#: lazarusidestrconsts.dlgassertcode 722msgid "Include assertion code" 723msgstr "Onay kodunu dahil et" 724 725#: lazarusidestrconsts.dlgassociateddebugdesktop 726#, object-pascal-format 727msgid "Associated debug desktop for \"%s\"" 728msgstr "İlişkili hata ayıklama masaüstü \"%s\"" 729 730#: lazarusidestrconsts.dlgassociateddebugdesktophint 731msgid "If you select the desktop, the associated debug desktop will be selected as well." 732msgstr "Masaüstünü seçerseniz, ilişkili hata ayıklama masaüstü de seçilecektir." 733 734#: lazarusidestrconsts.dlgautocreateforms 735msgid "Auto-create forms:" 736msgstr "Formları otomatik oluştur:" 737 738#: lazarusidestrconsts.dlgautocreateformshint 739msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically." 740msgstr "Ana .lpr birimi, her formu Application.CreateForm () ile oluşturur ve otomatik olarak serbest bırakılır." 741 742#: lazarusidestrconsts.dlgautocreatenewforms 743msgid "Auto-create new forms" 744msgstr "Yeni formları Otomatik oluştur" 745 746#: lazarusidestrconsts.dlgautodel 747msgid "Auto delete file" 748msgstr "Dosyayı otomatik sil" 749 750#: lazarusidestrconsts.dlgautodisplayfuncproto 751msgid "Auto Display Function Prototypes" 752msgstr "Otomatik Görüntü İşlev Prototipleri" 753 754#: lazarusidestrconsts.dlgautohidecursor 755msgid "Hide mouse pointer when typing" 756msgstr "Yazarken fareyi gizle" 757 758#: lazarusidestrconsts.dlgautoindent 759msgctxt "lazarusidestrconsts.dlgautoindent" 760msgid "Auto indent" 761msgstr "Otomatik girinti" 762 763#: lazarusidestrconsts.dlgautoindentlink 764msgid "(Set up smart indent)" 765msgstr "(Akıllı girinti oluştur)" 766 767#: lazarusidestrconsts.dlgautoindenttype 768msgctxt "lazarusidestrconsts.dlgautoindenttype" 769msgid "Auto indent" 770msgstr "Otomatik girinti" 771 772#: lazarusidestrconsts.dlgautoremoveemptymethods 773msgid "Auto remove empty methods" 774msgstr "Boş yöntemleri otomatik olarak kaldır" 775 776#: lazarusidestrconsts.dlgautoren 777msgid "Auto rename file lowercase" 778msgstr "Otomatik olarak küçük harfleri yeniden adlandır" 779 780#: lazarusidestrconsts.dlgautosaveactivedesktop 781msgid "Auto save active desktop" 782msgstr "Aktif masaüstünü otomatik kaydet" 783 784#: lazarusidestrconsts.dlgautosaveactivedesktophint 785msgid "" 786"Save active desktop on IDE close\n" 787"Save debug desktop on IDE close and debug end" 788msgstr "" 789"IDE'ye aktif masaüstünü kaydet kapat\n" 790"IDE'ye hata ayıklama masaüstünden tasarruf edin" 791 792#: lazarusidestrconsts.dlgavailableforms 793msgid "Available forms:" 794msgstr "Mevcut Formlar:" 795 796#: lazarusidestrconsts.dlgavailableformshint 797msgid "These forms must be created and freed in the program code." 798msgstr "Bu formlar program kodunda oluşturulmalı ve serbest bırakılmalıdır." 799 800#: lazarusidestrconsts.dlgavoidunnecessaryjumps 801msgid "Avoid unnecessary jumps" 802msgstr "Gereksiz atlamalardan kaçının" 803 804#: lazarusidestrconsts.dlgbackcolor 805msgid "Background" 806msgstr "Arkaplan" 807 808#: lazarusidestrconsts.dlgbaknosubdirectory 809msgid "(no subdirectory)" 810msgstr "(Alt dizin yok)" 811 812#: lazarusidestrconsts.dlgbckupsubdir 813msgid "Same name (in subdirectory)" 814msgstr "Aynı ad (alt dizinde)" 815 816#: lazarusidestrconsts.dlgbehindmethods 817msgid "Behind methods" 818msgstr "Yöntemlerin arkasında" 819 820#: lazarusidestrconsts.dlgblockgroupoptions 821msgctxt "lazarusidestrconsts.dlgblockgroupoptions" 822msgid "Selection" 823msgstr "Seçim" 824 825#: lazarusidestrconsts.dlgblockindent 826msgid "Block indent (spaces)" 827msgstr "Girintiyi engelle (boşluklar)" 828 829#: lazarusidestrconsts.dlgblockindentkeys 830msgid "Block indent" 831msgstr "Girintiyi engelle" 832 833#: lazarusidestrconsts.dlgblockindentlink 834msgid "(edit keys)" 835msgstr "(Tuşları düzenle)" 836 837#: lazarusidestrconsts.dlgblockindenttypecopy 838msgid "Space/tab as prev Line" 839msgstr "Alan/sekme prev satırı" 840 841#: lazarusidestrconsts.dlgblockindenttypepos 842msgid "Position only" 843msgstr "Yalnızca pozisyon" 844 845#: lazarusidestrconsts.dlgblockindenttypespace 846msgid "Spaces" 847msgstr "Boşluklar" 848 849#: lazarusidestrconsts.dlgblockindenttypetabonly 850msgid "Tabs, cut off" 851msgstr "Sekmeler, kesildi" 852 853#: lazarusidestrconsts.dlgblockindenttypetabspace 854msgid "Tabs, then spaces" 855msgstr "Sekmeler, ardından boşluklar" 856 857#: lazarusidestrconsts.dlgblocktabindent 858msgid "Block indent (tabs)" 859msgstr "Girintiyi engelle (sekmeler)" 860 861#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor 862msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0." 863msgstr "Sınır alanı, Çapa düzenleyicide ayarlanabilir. Boşluk> 0 dan büyük ise kırmızı bir çizgi gösterilir." 864 865#: lazarusidestrconsts.dlgbrackethighlight 866msgid "Bracket highlight" 867msgstr "Parantezi vurgula" 868 869#: lazarusidestrconsts.dlgbracketmatchgroup 870msgid "Matching bracket and quote pairs" 871msgstr "Eşleştirme parantezi ve alıntı çiftleri" 872 873#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop 874msgid "You cannot use docked desktop in undocked environment and vice versa." 875msgstr "Yerleşik masaüstünü yerleştirilmemiş bir ortamda kullanamazsınız." 876 877#: lazarusidestrconsts.dlgcaretbackcolor 878msgid "Multi/2nd (NotXor)" 879msgstr "Çoklu/2. (NotXor)" 880 881#: lazarusidestrconsts.dlgcaretcolor 882msgctxt "lazarusidestrconsts.dlgcaretcolor" 883msgid "Caret" 884msgstr "Düzeltme işareti" 885 886#: lazarusidestrconsts.dlgcaretforecolor 887msgid "Color (NotXor)" 888msgstr "Renk (NotXor)" 889 890#: lazarusidestrconsts.dlgcaretgroupoptions 891msgid "Caret (Text Cursor)" 892msgstr "Düzeltme işareti (Metin İmleç)" 893 894#: lazarusidestrconsts.dlgcasesensitive 895msgid "&Case sensitive" 896msgstr "&Harfe duyarlı" 897 898#: lazarusidestrconsts.dlgccocaption 899msgid "Checking compiler options" 900msgstr "Derleyici seçeneklerini kontrol etme" 901 902#: lazarusidestrconsts.dlgccoorphanedfilefound 903#, object-pascal-format 904msgid "orphaned file found: %s" 905msgstr "artık dosya bulundu: %s" 906 907#: lazarusidestrconsts.dlgccoresults 908msgid "Results" 909msgstr "Sonuçlar" 910 911#: lazarusidestrconsts.dlgccotest 912msgid "Test" 913msgstr "Test" 914 915#: lazarusidestrconsts.dlgccotestcheckingcompiler 916msgid "Test: Checking compiler ..." 917msgstr "Test: Derleyici denetleniyor ..." 918 919#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig 920msgid "Test: Checking compiler configuration ..." 921msgstr "Test: derleyici yapılandırmasını denetleme ..." 922 923#: lazarusidestrconsts.dlgccotestcompilerdate 924msgid "Test: Checking compiler date ..." 925msgstr "Test: Derleyici tarihini denetleme ..." 926 927#: lazarusidestrconsts.dlgccotestcompilingemptyfile 928msgid "Test: Compiling an empty file ..." 929msgstr "Test: boş bir dosyayı derleme ..." 930 931#: lazarusidestrconsts.dlgccotestrtlunits 932msgid "Test: Checking RTL units ..." 933msgstr "Test: RTL birimlerini kontrol ediyor ..." 934 935#: lazarusidestrconsts.dlgccotestsrcinppupaths 936msgid "Test: Checking sources in fpc ppu search paths ..." 937msgstr "Test: fpc ppu arama yollarındaki kaynakları kontrol et ..." 938 939#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile 940msgid "Test: Compiling an empty file" 941msgstr "Test: boş bir dosyayı derleme" 942 943#: lazarusidestrconsts.dlgccousingconfigfile 944#, object-pascal-format 945msgid "using config file %s" 946msgstr "kullanılan %s yapılandırma dosyası" 947 948#: lazarusidestrconsts.dlgcdtclassorder 949msgid "Class order" 950msgstr "Sınıfsal düzen" 951 952#: lazarusidestrconsts.dlgcdtlast 953msgid "Last" 954msgstr "Son" 955 956#: lazarusidestrconsts.dlgcdtlower 957msgid "lowercase" 958msgstr "küçük" 959 960#: lazarusidestrconsts.dlgcdtpreview 961msgid "Preview (max line length = 1)" 962msgstr "Önizleme (maks. Satır uzunluğu = 1)" 963 964#: lazarusidestrconsts.dlgcdtreadprefix 965msgid "Read prefix" 966msgstr "Okunan önek" 967 968#: lazarusidestrconsts.dlgcdtstoredpostfix 969msgid "Stored postfix" 970msgstr "Saklanan sonek" 971 972#: lazarusidestrconsts.dlgcdtuppercase 973msgid "UPPERCASE" 974msgstr "BÜYÜK" 975 976#: lazarusidestrconsts.dlgcdtvariableprefix 977msgid "Variable prefix" 978msgstr "Değişken önek" 979 980#: lazarusidestrconsts.dlgcdtwriteprefix 981msgid "Write prefix" 982msgstr "Yazma öneki" 983 984#: lazarusidestrconsts.dlgcharcasefileact 985msgid "Save As - auto rename Pascal files lower case" 986msgstr "Farklı Kaydet - otomatik olarak Pascal dosyalarını küçük harflerle yeniden adlandır" 987 988#: lazarusidestrconsts.dlgcheckandautosavefiles 989msgid "Check and Auto Save Files" 990msgstr "Dosyaları Kontrol Et ve Otomatik Kaydet" 991 992#: lazarusidestrconsts.dlgcheckpackagesonformcreate 993msgid "Check packages on form create" 994msgstr "Form oluşturma paketlerini kontrol et" 995 996#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint 997msgid "The form may require a package to work. Install such a package automatically." 998msgstr "Formun çalışması için bir paket gerekebilir, böyle bir paketi otomatik olarak yükleyin." 999 1000#: lazarusidestrconsts.dlgchscodetempl 1001msgid "Choose code template file (*.dci)" 1002msgstr "Kod şablon dosyası (* .dci) seç" 1003 1004#: lazarusidestrconsts.dlgclosebuttonsnotebook 1005msgid "Show close buttons in notebook" 1006msgstr "Not defterinde yakın düğmeleri göster" 1007 1008#: lazarusidestrconsts.dlgclrscheme 1009msgid "Color Scheme" 1010msgstr "Renk uyumu" 1011 1012#: lazarusidestrconsts.dlgcmacro 1013msgid "C style macros (global)" 1014msgstr "C stili makrolar (global)" 1015 1016#: lazarusidestrconsts.dlgcoansistr 1017msgctxt "lazarusidestrconsts.dlgcoansistr" 1018msgid "Use Ansistrings" 1019msgstr "Ansistrings kullanın" 1020 1021#: lazarusidestrconsts.dlgcoasmstyle 1022msgid "Assembler style" 1023msgstr "Assembler stili" 1024 1025#: lazarusidestrconsts.dlgcocfgcmpmessages 1026msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" 1027msgid "Messages" 1028msgstr "Mesajlar" 1029 1030#: lazarusidestrconsts.dlgcochecksandassertion 1031msgid "Checks and assertion" 1032msgstr "Çekler ve iddia" 1033 1034#: lazarusidestrconsts.dlgcocompilercommands 1035msgid "Compiler Commands" 1036msgstr "Derleyici Komutları" 1037 1038#: lazarusidestrconsts.dlgcocops 1039msgid "C style operators (*=, +=, /= and -=)" 1040msgstr "C stil operatörleri (* =, + =, / = ve - =)" 1041 1042#: lazarusidestrconsts.dlgcocreatemakefile 1043msgctxt "lazarusidestrconsts.dlgcocreatemakefile" 1044msgid "Create Makefile" 1045msgstr "Makefile Oluştur" 1046 1047#: lazarusidestrconsts.dlgcodebugging 1048msgid "Debugging" 1049msgstr "Hata Ayıklama" 1050 1051#: lazarusidestrconsts.dlgcodebugpath 1052msgid "Debugger path addition (none):" 1053msgstr "Hata ayıklayıcı yolunun eklenmesi (yok):" 1054 1055#: lazarusidestrconsts.dlgcodecreation 1056msgid "Code Creation" 1057msgstr "Kod Oluştur" 1058 1059#: lazarusidestrconsts.dlgcodefoldenableboth 1060msgid "Both" 1061msgstr "Her ikisi de" 1062 1063#: lazarusidestrconsts.dlgcodefoldenablefold 1064msgid "Fold" 1065msgstr "Katla" 1066 1067#: lazarusidestrconsts.dlgcodefoldenablehide 1068msgid "Hide" 1069msgstr "Gizle" 1070 1071#: lazarusidestrconsts.dlgcodefoldpopuporder 1072msgid "Reverse fold-order in Popup" 1073msgstr "Açılır pencerede katlama sırasını tersine çevir" 1074 1075#: lazarusidestrconsts.dlgcogdb 1076msgid "Generate info for the debugger (slower / increases exe-size)" 1077msgstr "Hata ayıklayıcı için bilgi üret (yavaş / exe-boyutu artar)" 1078 1079#: lazarusidestrconsts.dlgcoheaptrc 1080msgid "Use Heaptrc unit (check for mem-leaks)" 1081msgstr "Heaptrc birimini kullanın (mem-leak'leri kontrol edin)" 1082 1083#: lazarusidestrconsts.dlgcoincfiles 1084msgid "Include files (-Fi):" 1085msgstr "Dosyaları ekle (-Fi):" 1086 1087#: lazarusidestrconsts.dlgcoinfoforgdb 1088msgid "Debugger info" 1089msgstr "Hata ayıklayıcı bilgisi" 1090 1091#: lazarusidestrconsts.dlgcolibraries 1092msgid "Libraries (-Fl):" 1093msgstr "Kütüphaneler (-Fl):" 1094 1095#: lazarusidestrconsts.dlgcolinking 1096msgid "Linking" 1097msgstr "Bağlanıyor" 1098 1099#: lazarusidestrconsts.dlgcoloadsavehint 1100msgid "Compiler options can be saved to an XML file." 1101msgstr "Derleyici seçenekleri bir XML dosyasına kaydedilebilir." 1102 1103#: lazarusidestrconsts.dlgcolor 1104msgid "Color" 1105msgstr "Renk" 1106 1107#: lazarusidestrconsts.dlgcolorlink 1108msgid "(Edit Color)" 1109msgstr "(Renk Düzenle)" 1110 1111#: lazarusidestrconsts.dlgcolornotmodified 1112msgid "Not modified" 1113msgstr "Değiştirilmedi" 1114 1115#: lazarusidestrconsts.dlgcolors 1116msgid "Colors" 1117msgstr "Renkler" 1118 1119#: lazarusidestrconsts.dlgcommandlineparams 1120msgid "Command line parameters (without application name)" 1121msgstr "Komut satırı parametreleri (uygulama adı olmadan)" 1122 1123#: lazarusidestrconsts.dlgcommentalignmaxdefault 1124msgid "Max indent for new line if prefix is based on start of comment on first comment line:" 1125msgstr "Yorum, sütunda açılırsa yeni satıra varsayılan girinti yapın:" 1126 1127#: lazarusidestrconsts.dlgcommentalignmaxtoken 1128msgid "Limit indent to" 1129msgstr "Girintiyi sınırla" 1130 1131#: lazarusidestrconsts.dlgcommentcontinue 1132msgid "Prefix comments on linebreak" 1133msgstr "Linebreak'de önek yorumları" 1134 1135#: lazarusidestrconsts.dlgcommentcontinuematch 1136msgid "Match current line" 1137msgstr "Geçerli satırı eşleştir" 1138 1139#: lazarusidestrconsts.dlgcommentcontinuematchasterisk 1140msgid "Match text including \"*\" of token \"(*\"" 1141msgstr "\"*\" \"(* İşaretinin dahil olduğu metin eşleşmesi" 1142 1143#: lazarusidestrconsts.dlgcommentcontinuematchline 1144msgid "Match whole line" 1145msgstr "Bütün satırla eşleş" 1146 1147#: lazarusidestrconsts.dlgcommentcontinuematchtext 1148#, object-pascal-format 1149msgid "Match text after token \"%s\"" 1150msgstr "\"%s\" belirtecinden sonraki metni eşleştir" 1151 1152#: lazarusidestrconsts.dlgcommentcontinuematchtoken 1153#, object-pascal-format 1154msgid "Match text including token \"%s\"" 1155msgstr "\"%s\" belirteci içeren eşleme metni" 1156 1157#: lazarusidestrconsts.dlgcommentcontinueprefix 1158msgid "Prefix new line" 1159msgstr "Yeni satırı önekle" 1160 1161#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault 1162msgid "Align Prefix at indent of previous line" 1163msgstr "Bir önceki satırın girintisine Hizala Önek" 1164 1165#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch 1166msgid "Align Prefix below start of comment on first comment line" 1167msgstr "İlk yorum satırında yorum başlangıcının altındaki Öneki Hizala" 1168 1169#: lazarusidestrconsts.dlgcommentcontinueprefixindnone 1170msgid "Do not indent prefix" 1171msgstr "Önek girinti yapmayın" 1172 1173#: lazarusidestrconsts.dlgcommentindentgroupoptions 1174msgid "Comments and Strings" 1175msgstr "Yorumlar ve Stringler" 1176 1177#: lazarusidestrconsts.dlgcommentshlashextendalways 1178msgid "Extend if matched or not matched" 1179msgstr "Eşleştirilirse veya eşleştirilmemişse uzat" 1180 1181#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit 1182msgid "Extend if matched or not matched (not at EOL)" 1183msgstr "Eşleştirilirse veya eşleştirilmemişse (EOL'de değil) genişlesin" 1184 1185#: lazarusidestrconsts.dlgcommentshlashextendmatch 1186msgid "Extend if matched" 1187msgstr "Eşleştirilirse uzat" 1188 1189#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit 1190msgid "Extend if matched and caret in the middle of text (not at EOL)" 1191msgstr "Metnin ortasında eşleştirilirse ve metnin ortasına getirilirse (EOL'de değil) genişlesin" 1192 1193#: lazarusidestrconsts.dlgcompilationandlinking 1194msgid "Compilation and Linking" 1195msgstr "Derleme ve Bağlama" 1196 1197#: lazarusidestrconsts.dlgcompilermessage 1198msgid "Compiler messages" 1199msgstr "Derleyici mesajları" 1200 1201#: lazarusidestrconsts.dlgcompilermessages 1202msgid "Compiler messages language file (*.msg)" 1203msgstr "Derleyici ileti dili dosyası (* .msg)" 1204 1205#: lazarusidestrconsts.dlgcompileroptions 1206msgid "Compiler Options" 1207msgstr "Derleyici Seçenekleri" 1208 1209#: lazarusidestrconsts.dlgcompleteproperties 1210msgid "Complete properties" 1211msgstr "Komple özellikleri" 1212 1213#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected 1214msgid "Component under mouse cursor is first selected, then the popup menu commands work on it." 1215msgstr "Önce fare imleci altındaki bileşen seçildiğinde açılır menü komutları üzerinde çalışıyor." 1216 1217#: lazarusidestrconsts.dlgconfigandtarget 1218msgid "Config and Target" 1219msgstr "Yapılandırma ve Hedef" 1220 1221#: lazarusidestrconsts.dlgconfigfiles 1222msgid "Config files" 1223msgstr "Yapılandırma dosyaları" 1224 1225#: lazarusidestrconsts.dlgcootherdebugginginfo 1226msgid "Other debugging info" 1227msgstr "Diğer hata ayıklama bilgileri" 1228 1229#: lazarusidestrconsts.dlgcooverflow 1230msgid "Overflow" 1231msgstr "Taşma" 1232 1233#: lazarusidestrconsts.dlgcoparsing 1234msgid "Parsing" 1235msgstr "Ayrıştırma" 1236 1237#: lazarusidestrconsts.dlgcopypastekeepfolds 1238msgid "Copy/Paste with fold info" 1239msgstr "Katlama bilgileriyle birlikte kopyala / yapıştır" 1240 1241#: lazarusidestrconsts.dlgcopywordatcursoroncopynone 1242msgid "Copy current word when no selection exists" 1243msgstr "Seçim yapılmadan kopyalanamaz" 1244 1245#: lazarusidestrconsts.dlgcorange 1246msgctxt "lazarusidestrconsts.dlgcorange" 1247msgid "Range" 1248msgstr "Aralık" 1249 1250#: lazarusidestrconsts.dlgcorelocatable 1251msgid "Relocatable" 1252msgstr "Taşınabilir" 1253 1254#: lazarusidestrconsts.dlgcosetasdefault 1255msgid "Set compiler options as default" 1256msgstr "Derleyici seçeneklerini varsayılan olarak ayarla" 1257 1258#: lazarusidestrconsts.dlgcoshowerr 1259msgid "Show errors" 1260msgstr "Hataları göster" 1261 1262#: lazarusidestrconsts.dlgcoshowoptions 1263msgid "&Show Options" 1264msgstr "&Seçenekleri Göster" 1265 1266#: lazarusidestrconsts.dlgcosmartlinkable 1267msgid "Smart linkable" 1268msgstr "Akıllı bağlanabilir" 1269 1270#: lazarusidestrconsts.dlgcosources 1271msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)" 1272msgstr "Diğer kaynaklar (.pp / .pas dosyaları, Sadece IDE tarafından kullanılır derlenemez)" 1273 1274#: lazarusidestrconsts.dlgcostack 1275msgid "Stack" 1276msgstr "Yığın" 1277 1278#: lazarusidestrconsts.dlgcostrip 1279msgid "Strip symbols from executable" 1280msgstr "Çalıştırılabilir simgeleri şeritten çıkarma" 1281 1282#: lazarusidestrconsts.dlgcosymboltype 1283msgid "Type of debug info" 1284msgstr "Hata ayıklama bilgisi türü" 1285 1286#: lazarusidestrconsts.dlgcosymboltypeauto 1287msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" 1288msgid "Automatic" 1289msgstr "Otomatik" 1290 1291#: lazarusidestrconsts.dlgcosymboltypedwarf2 1292msgid "Dwarf2" 1293msgstr "Dwarf2" 1294 1295#: lazarusidestrconsts.dlgcosymboltypedwarf2set 1296msgid "Dwarf with sets" 1297msgstr "Dwarf ile ayarla" 1298 1299#: lazarusidestrconsts.dlgcosymboltypedwarf3 1300msgid "Dwarf3 (beta)" 1301msgstr "Dwarf3 (beta)" 1302 1303#: lazarusidestrconsts.dlgcosymboltypestabs 1304msgid "Stabs" 1305msgstr "Stabs" 1306 1307#: lazarusidestrconsts.dlgcotrashvariables 1308msgid "Trash variables" 1309msgstr "Çöp değişkenleri" 1310 1311#: lazarusidestrconsts.dlgcounitstyle 1312msgid "Unit style" 1313msgstr "Birim tarzı" 1314 1315#: lazarusidestrconsts.dlgcovalgrind 1316msgid "Generate code for valgrind" 1317msgstr "Valgrind için kod üret" 1318 1319#: lazarusidestrconsts.dlgcoverbosity 1320msgid "Verbosity" 1321msgstr "Ayrıntı" 1322 1323#: lazarusidestrconsts.dlgcppinline 1324msgid "C++ styled INLINE" 1325msgstr "C ++ styled INLINE" 1326 1327#: lazarusidestrconsts.dlgcreatenewrunparameterssettings 1328msgid "Create new Run Parameters settings" 1329msgstr "Yeni Çalıştırma Parametreleri ayarı oluştur" 1330 1331#: lazarusidestrconsts.dlgcurlycommenttab 1332msgid "Curly { }" 1333msgstr "Kıvırcık { }" 1334 1335#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow 1336msgid "Currently respected by messages window, jump history and search results." 1337msgstr "Şu anda mesaj penceresinde saygın, atlama geçmişi ve arama sonuçları." 1338 1339#: lazarusidestrconsts.dlgcursorbeyondeol 1340msgid "Cursor beyond EOL" 1341msgstr "İmleç EOL'nin ötesinde" 1342 1343#: lazarusidestrconsts.dlgcursormoveclearsselection 1344msgid "Caret left/right clears selection (no move)" 1345msgstr "Sol/sağ köşe seçimi temizler (hareketsiz)" 1346 1347#: lazarusidestrconsts.dlgcursorskipsselection 1348msgid "Caret skips selection" 1349msgstr "İmleç seçim atlar" 1350 1351#: lazarusidestrconsts.dlgcursorskipstab 1352msgid "Caret skips tabs" 1353msgstr "Imleç sekmeleri atlar" 1354 1355#: lazarusidestrconsts.dlgcustomext 1356msgid "User defined extension (.pp.xxx)" 1357msgstr "Kullanıcı tanımlı uzantısı (.pp.xxx)" 1358 1359#: lazarusidestrconsts.dlgdebugdesktop 1360msgid "debug" 1361msgstr "hata ayıkla" 1362 1363#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption 1364msgid "Path Editor" 1365msgstr "Yol Editörü" 1366 1367#: lazarusidestrconsts.dlgdebugtype 1368msgid "Debugger type and path" 1369msgstr "Hata ayıklayıcı türü ve yolu" 1370 1371#: lazarusidestrconsts.dlgdefaulteditorfont 1372msgid "Default editor font" 1373msgstr "Varsayılan düzenleyici yazı tipi" 1374 1375#: lazarusidestrconsts.dlgdefvaluecolor 1376msgid "Default Value" 1377msgstr "Varsayılan değer" 1378 1379#: lazarusidestrconsts.dlgdeletemode 1380msgid "Delete mode" 1381msgstr "Modu sil" 1382 1383#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption 1384msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption" 1385msgid "Delete" 1386msgstr "Sil" 1387 1388#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint 1389msgid "Delete selected desktop" 1390msgstr "Seçili masaüstünü Sil" 1391 1392#: lazarusidestrconsts.dlgdeltemplate 1393msgid "Delete template " 1394msgstr "Şablonu sil " 1395 1396#: lazarusidestrconsts.dlgdesktopbuttons 1397msgid "Buttons - " 1398msgstr "Düğmeler - " 1399 1400#: lazarusidestrconsts.dlgdesktophints 1401msgid "Hints" 1402msgstr "İpuçları" 1403 1404#: lazarusidestrconsts.dlgdesktopmenus 1405msgid "Menus - " 1406msgstr "Menüler - " 1407 1408#: lazarusidestrconsts.dlgdesktopname 1409msgid "Desktop name" 1410msgstr "Masaüstü adı" 1411 1412#: lazarusidestrconsts.dlgdesktopsexported 1413#, object-pascal-format 1414msgid "%d desktop(s) successfully exported to \"%s\"" 1415msgstr "%d masaüstü \"%s\" e başarıyla dışa aktarıldı" 1416 1417#: lazarusidestrconsts.dlgdesktopsimported 1418#, object-pascal-format 1419msgid "%d desktop(s) successfully imported from \"%s\"" 1420msgstr "%d masaüstü \"%s\" den başarıyla içe aktarıldı." 1421 1422#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor 1423msgid "Different values background" 1424msgstr "Farklı değerler arkaplan" 1425 1426#: lazarusidestrconsts.dlgdirection 1427msgid "Direction" 1428msgstr "Yön" 1429 1430#: lazarusidestrconsts.dlgdisableantialiasing 1431msgid "Disable anti-aliasing" 1432msgstr "Kenar yumuşatmayı devre dışı bırak" 1433 1434#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep 1435msgid "Distance between grid points is the smallest step when moving a control." 1436msgstr "Izgara noktaları arasındaki mesafe, bir denetimi taşırken en küçük adımdır." 1437 1438#: lazarusidestrconsts.dlgdividercolordefault 1439msgid "Use right margin color" 1440msgstr "Sağ kenar boşluğu rengini kullan" 1441 1442#: lazarusidestrconsts.dlgdividerdrawdepth 1443msgid "Draw divider level" 1444msgstr "Bölücü seviyesini çiz" 1445 1446#: lazarusidestrconsts.dlgdividernestcolor 1447msgid "Nested line color" 1448msgstr "İç içe çizgi rengi" 1449 1450#: lazarusidestrconsts.dlgdividertopcolor 1451msgid "Line color" 1452msgstr "Çizgi rengi" 1453 1454#: lazarusidestrconsts.dlgdivpasbeginendname 1455msgid "Begin/End" 1456msgstr "Begin/End" 1457 1458#: lazarusidestrconsts.dlgdivpasprocedurename 1459msgid "Procedure/Function" 1460msgstr "Procedure/Function" 1461 1462#: lazarusidestrconsts.dlgdivpasstructglobalname 1463msgid "Class/Struct" 1464msgstr "Class/Struct" 1465 1466#: lazarusidestrconsts.dlgdivpasstructlocalname 1467msgid "Class/Struct (local)" 1468msgstr "Class/Struct (yerel)" 1469 1470#: lazarusidestrconsts.dlgdivpastryname 1471msgid "Try/Except" 1472msgstr "Try/Except" 1473 1474#: lazarusidestrconsts.dlgdivpasunitsectionname 1475msgid "Unit sections" 1476msgstr "Birim bölümleri" 1477 1478#: lazarusidestrconsts.dlgdivpasusesname 1479msgid "Uses clause" 1480msgstr "Uses maddesi" 1481 1482#: lazarusidestrconsts.dlgdivpasvarglobalname 1483msgid "Var/Type" 1484msgstr "Var/Type" 1485 1486#: lazarusidestrconsts.dlgdivpasvarlocalname 1487msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" 1488msgid "Var/Type (local)" 1489msgstr "Var/Type (yerel)" 1490 1491#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit 1492msgid "Draw the component's name below it." 1493msgstr "Bileşenin adını altına çizin." 1494 1495#: lazarusidestrconsts.dlgedback 1496msgid "Back" 1497msgstr "Geri" 1498 1499#: lazarusidestrconsts.dlgedbold 1500msgid "Bold" 1501msgstr "Kalın" 1502 1503#: lazarusidestrconsts.dlgedbsubdir 1504msgid "Sub directory" 1505msgstr "Alt dizin" 1506 1507#: lazarusidestrconsts.dlgedcodetempl 1508msgctxt "lazarusidestrconsts.dlgedcodetempl" 1509msgid "Code Templates" 1510msgstr "Kod Şablonları" 1511 1512#: lazarusidestrconsts.dlgedcompleteblocks 1513msgid "Add close statement for Pascal blocks" 1514msgstr "Pascal blokları için açık bildiri ekleyin" 1515 1516#: lazarusidestrconsts.dlgedcustomext 1517msgid "User defined extension" 1518msgstr "Kullanıcı tanımlı uzantı" 1519 1520#: lazarusidestrconsts.dlgeddelayinsec 1521#, object-pascal-format 1522msgid "(%s sec delay)" 1523msgstr "(%s sn gecikme)" 1524 1525#: lazarusidestrconsts.dlgeddisplay 1526msgid "Display" 1527msgstr "Ekran" 1528 1529#: lazarusidestrconsts.dlgedfiles 1530msgid "Editor Files" 1531msgstr "Editör Dosyaları" 1532 1533#: lazarusidestrconsts.dlgedidcomlet 1534msgid "Identifier completion" 1535msgstr "Tanımlayıcı tamamlama" 1536 1537#: lazarusidestrconsts.dlgedinvert 1538msgid "Invert" 1539msgstr "Ters çevir" 1540 1541#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit 1542msgid "Ignore Locks, use longest unused editor" 1543msgstr "Kilitleri yoksay, kullanılmayan en uzun editörü kullan" 1544 1545#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit 1546msgid "Ignore Locks, if editor is current" 1547msgstr "Editör güncelse, Kilitleri yoksay" 1548 1549#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin 1550msgid "Ignore Locks, if editor in current window" 1551msgstr "Geçerli pencerede düzenleyici varsa, Kilitleri yoksay" 1552 1553#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview 1554msgid "Locked, if text in view" 1555msgstr "Eğer metin görünüyorsa kilidi kaldır" 1556 1557#: lazarusidestrconsts.dlgeditaccesscaptionunlocked 1558msgid "Unlocked" 1559msgstr "Kilitsiz" 1560 1561#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview 1562msgid "Unlocked, if text in centered view" 1563msgstr "Metin ortalanmış görünümdeyse, kilidi kaldır" 1564 1565#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin 1566msgid "New tab, existing or new window" 1567msgstr "Yeni sekme, varolan veya yeni pencere" 1568 1569#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin 1570msgid "New tab in new window" 1571msgstr "Yeni pencerede yeni sekme" 1572 1573#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin 1574msgid "New tab in existing window" 1575msgstr "Mevcut pencerede yeni sekme" 1576 1577#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit 1578msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." 1579msgstr "Bu seçenek, kilitli ve / veya kaydırma gerektirse bile dosya için kullanılmayan en uzun düzenleyiciyi kullanır. Kullanılmayan en uzun editörün belirlenmesi, \"aynı kriter düzeni\" ayarı tarafından ayarlanmış olsa bile, pencerelerin odaklandığı sıraya bakmaz. Bu seçenek her zaman başarılı olacak, başka seçenekler test edilmeyecektir." 1580 1581#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit 1582msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." 1583msgstr "Bu seçenek, geçerli etkin düzenleyicinin hedef dosyaya sahip olup olmadığını ve eğer öyleyse, onu kullanacaklarını kontrol edecek." 1584 1585#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin 1586msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." 1587msgstr "Bu seçenek, geçerli pencerede hedef dosya için bir düzenleyici olup olmadığını kontrol eder ve eğer varsa, kilitli ve / veya kaydırma gerektirse bile bu düzenleyiciyi kullanacaktır." 1588 1589#: lazarusidestrconsts.dlgeditaccessdesclockedinview 1590msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." 1591msgstr "Bu seçenek, hedef atlama noktasını görüntülemek için kaydırılması gerekmeyen kilitli (ve yalnızca kilitli) bir Düzenleyici kullanır (hedef atlama noktası zaten görünür ekran alanındadır)." 1592 1593#: lazarusidestrconsts.dlgeditaccessdescunlocked 1594msgid "This option will use any not locked Editor." 1595msgstr "Bu seçenek kilitli herhangi bir editörü kullanmaz." 1596 1597#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview 1598msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." 1599msgstr "Bu seçenek, hedef atlama noktasını görüntülemek için kaydırılması gerekmeyen kilitlenmemiş bir Düzenleyici kullanır (hedef atlama noktası zaten üstte / altta 2-5 satır hariç, görünür ekran orta alanındadır)." 1600 1601#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin 1602msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested." 1603msgstr "Bu seçenek, kilidi açılmış bir sekme bulunmazsa mevcut veya yeni bir Pencerede yeni bir Sekme açacaktır. Bu seçenek her zaman başarılı olur, başka seçenekler asla test edilmez." 1604 1605#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin 1606msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." 1607msgstr "Kilitli olmayan bir sekme bulunmazsa, bu seçenek yeni bir Pencerede yeni bir Sekme açacaktır (diğer sekmeler yeni sekme için kullanılabilse bile). Bu seçenek her zaman başarılı olur, başka seçenekler asla test edilmez." 1608 1609#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin 1610msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet." 1611msgstr "Kilidi açılmış bir sekme bulunmazsa, bu seçenek varolan (ve yalnızca varolan) bir Pencerede yeni bir Sekme açar. Bir sekme, ancak henüz hedef dosya için düzenleyici olmayan bir pencere varsa açılır." 1612 1613#: lazarusidestrconsts.dlgedital 1614msgid "Italic" 1615msgstr "İtalik" 1616 1617#: lazarusidestrconsts.dlgeditorfontsize 1618msgid "Editor font size" 1619msgstr "Editör yazıtipi boyutu" 1620 1621#: lazarusidestrconsts.dlgeditoroptions 1622msgid "Editor options" 1623msgstr "Editör seçenekleri" 1624 1625#: lazarusidestrconsts.dlgeditschemdefaults 1626msgid "Scheme globals" 1627msgstr "Şema globals" 1628 1629#: lazarusidestrconsts.dlgedmisc 1630msgctxt "lazarusidestrconsts.dlgedmisc" 1631msgid "Miscellaneous" 1632msgstr "Çeşitli" 1633 1634#: lazarusidestrconsts.dlgedoff 1635msgid "Off" 1636msgstr "Kapalı" 1637 1638#: lazarusidestrconsts.dlgedon 1639msgid "On" 1640msgstr "Açık" 1641 1642#: lazarusidestrconsts.dlgedtabindent 1643msgid "Tab and Indent" 1644msgstr "Sekme ve Girinti" 1645 1646#: lazarusidestrconsts.dlgedunder 1647msgid "Underline" 1648msgstr "Altını çiz" 1649 1650#: lazarusidestrconsts.dlgelementattributes 1651msgid "Element Attributes" 1652msgstr "Öğe Öznitelikleri" 1653 1654#: lazarusidestrconsts.dlgendkeyjumpstoneareststart 1655msgid "End key jumps to nearest end" 1656msgstr "End tuşu en yakın noktaya atlar" 1657 1658#: lazarusidestrconsts.dlgenvask 1659msgid "Ask" 1660msgstr "Sor" 1661 1662#: lazarusidestrconsts.dlgenvbackuphelpnote 1663msgid "Notes: Project files are all files in the project directory" 1664msgstr "Notlar: Proje dosyaları, proje dizinindeki tüm dosyalardır" 1665 1666#: lazarusidestrconsts.dlgenvbckup 1667msgid "Backup" 1668msgstr "Yedek" 1669 1670#: lazarusidestrconsts.dlgenvfiles 1671msgid "Files" 1672msgstr "Dosyalar" 1673 1674#: lazarusidestrconsts.dlgenvgrid 1675msgid "Grid" 1676msgstr "Izgara" 1677 1678#: lazarusidestrconsts.dlgenvidestartup 1679msgid "IDE Startup" 1680msgstr "" 1681 1682#: lazarusidestrconsts.dlgenvlanguage 1683msgctxt "lazarusidestrconsts.dlgenvlanguage" 1684msgid "Language" 1685msgstr "Dil" 1686 1687#: lazarusidestrconsts.dlgenvlanguagehint 1688msgid "Language of all IDE strings. Restart IDE after changing it for best result." 1689msgstr "Tüm IDE stringlerinin dili. En iyi sonuç için değiştirdikten sonra IDE'yi yeniden başlatın." 1690 1691#: lazarusidestrconsts.dlgenvlguidelines 1692msgid "Guide lines" 1693msgstr "Kılavuz çizgiler" 1694 1695#: lazarusidestrconsts.dlgenvmisc 1696msgctxt "lazarusidestrconsts.dlgenvmisc" 1697msgid "Miscellaneous" 1698msgstr "Çeşitli" 1699 1700#: lazarusidestrconsts.dlgenvnone 1701msgctxt "lazarusidestrconsts.dlgenvnone" 1702msgid "None" 1703msgstr "Yok" 1704 1705#: lazarusidestrconsts.dlgenvotherfiles 1706msgid "Other Files" 1707msgstr "Diğer dosyalar" 1708 1709#: lazarusidestrconsts.dlgenvproject 1710msgid "Tabs for project" 1711msgstr "Projenin sekmeleri" 1712 1713#: lazarusidestrconsts.dlgenvtype 1714msgctxt "lazarusidestrconsts.dlgenvtype" 1715msgid "Type" 1716msgstr "Tür" 1717 1718#: lazarusidestrconsts.dlgeofocusmessagesatcompilation 1719msgid "Focus messages at compilation" 1720msgstr "Derleme anında mesajları odakla" 1721 1722#: lazarusidestrconsts.dlgextracharspacing 1723msgid "Extra character spacing" 1724msgstr "Ekstra karakter aralığı" 1725 1726#: lazarusidestrconsts.dlgextralinespacing 1727msgid "Extra line spacing" 1728msgstr "Ekstra satır aralığı" 1729 1730#: lazarusidestrconsts.dlgextsymb 1731msgid "Use external debug symbols file" 1732msgstr "Harici hata ayıklama sembolleri dosyasını kullan" 1733 1734#: lazarusidestrconsts.dlgfileassociationinos 1735msgid "Opening Files from OS" 1736msgstr "" 1737 1738#: lazarusidestrconsts.dlgfileexts 1739msgid "File extensions" 1740msgstr "Dosya uzantıları" 1741 1742#: lazarusidestrconsts.dlgfiles 1743#, object-pascal-format 1744msgid "%s files" 1745msgstr "%s dosyası" 1746 1747#: lazarusidestrconsts.dlgfilterall 1748msgid "All files" 1749msgstr "Tüm dosyalar" 1750 1751#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile 1752msgid "CodeTools template file" 1753msgstr "CodeTools şablon dosyası" 1754 1755#: lazarusidestrconsts.dlgfilterdcifile 1756msgid "DCI file" 1757msgstr "DCI dosyası" 1758 1759#: lazarusidestrconsts.dlgfilterdelphiform 1760msgid "Delphi form" 1761msgstr "Delphi formu" 1762 1763#: lazarusidestrconsts.dlgfilterdelphipackage 1764msgid "Delphi package" 1765msgstr "Delphi paketi" 1766 1767#: lazarusidestrconsts.dlgfilterdelphiproject 1768msgid "Delphi project" 1769msgstr "Delphi projesi" 1770 1771#: lazarusidestrconsts.dlgfilterdelphiunit 1772msgid "Delphi unit" 1773msgstr "Delphi birimi" 1774 1775#: lazarusidestrconsts.dlgfilterexecutable 1776msgid "Executable" 1777msgstr "Çalıştırılabilir" 1778 1779#: lazarusidestrconsts.dlgfilterfpcmessagefile 1780msgid "FPC message file" 1781msgstr "FPC mesaj dosyası" 1782 1783#: lazarusidestrconsts.dlgfilterhtml 1784msgid "HTML files" 1785msgstr "HTML dosyaları" 1786 1787#: lazarusidestrconsts.dlgfilterimagesbitmap 1788msgid "Bitmap images" 1789msgstr "Bitmap görüntüleri" 1790 1791#: lazarusidestrconsts.dlgfilterimagespixmap 1792msgid "Pixmap images" 1793msgstr "Pixmap görüntüleri" 1794 1795#: lazarusidestrconsts.dlgfilterimagespng 1796msgid "PNG images" 1797msgstr "PNG resimleri" 1798 1799#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings 1800msgid "Lazarus Desktop Settings" 1801msgstr "Lazarus Masaüstü Ayarları" 1802 1803#: lazarusidestrconsts.dlgfilterlazaruseditorfile 1804msgid "Editor file types" 1805msgstr "Editör dosya türleri" 1806 1807#: lazarusidestrconsts.dlgfilterlazarusfile 1808msgid "Lazarus file" 1809msgstr "Lazarus dosyası" 1810 1811#: lazarusidestrconsts.dlgfilterlazarusform 1812msgid "Lazarus form" 1813msgstr "Lazarus formu" 1814 1815#: lazarusidestrconsts.dlgfilterlazarusinclude 1816msgid "Lazarus include file" 1817msgstr "Lazarus dosya ekle" 1818 1819#: lazarusidestrconsts.dlgfilterlazarusotherfile 1820msgid "Lazarus other file" 1821msgstr "Lazarus diğer dosya" 1822 1823#: lazarusidestrconsts.dlgfilterlazaruspackage 1824msgid "Lazarus package" 1825msgstr "Lazarus paketi" 1826 1827#: lazarusidestrconsts.dlgfilterlazarusproject 1828msgid "Lazarus project" 1829msgstr "Lazarus projesi" 1830 1831#: lazarusidestrconsts.dlgfilterlazarusprojectsource 1832msgid "Lazarus project source" 1833msgstr "Lazarus proje kaynağı" 1834 1835#: lazarusidestrconsts.dlgfilterlazarussession 1836msgid "Lazarus session" 1837msgstr "Lazarus oturumu" 1838 1839#: lazarusidestrconsts.dlgfilterlazarusunit 1840msgid "Lazarus unit" 1841msgstr "Lazarus birimi" 1842 1843#: lazarusidestrconsts.dlgfilterpascalfile 1844msgid "Pascal file" 1845msgstr "Pascal dosyası" 1846 1847#: lazarusidestrconsts.dlgfilterprograms 1848msgid "Programs" 1849msgstr "Programlar" 1850 1851#: lazarusidestrconsts.dlgfilterxml 1852msgid "XML files" 1853msgstr "XML dosyaları" 1854 1855#: lazarusidestrconsts.dlgfindtextatcursor 1856msgid "Find text at cursor" 1857msgstr "İmleçte metin bulun" 1858 1859#: lazarusidestrconsts.dlgfolddiffchunk 1860msgid "Chunk" 1861msgstr "Yığın" 1862 1863#: lazarusidestrconsts.dlgfolddiffchunksect 1864msgid "Chunk section" 1865msgstr "Yığın bölümü" 1866 1867#: lazarusidestrconsts.dlgfoldhtmlasp 1868msgid "ASP" 1869msgstr "ASP" 1870 1871#: lazarusidestrconsts.dlgfoldhtmlcomment 1872msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" 1873msgid "Comment" 1874msgstr "Açıklama" 1875 1876#: lazarusidestrconsts.dlgfoldhtmlnode 1877msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" 1878msgid "Node" 1879msgstr "Düğüm" 1880 1881#: lazarusidestrconsts.dlgfoldlfmitem 1882msgid "Item" 1883msgstr "Item" 1884 1885#: lazarusidestrconsts.dlgfoldlfmlist 1886msgid "List <>" 1887msgstr "List <>" 1888 1889#: lazarusidestrconsts.dlgfoldlfmobject 1890msgid "Object (inherited, inline)" 1891msgstr "Object (inherited, inline)" 1892 1893#: lazarusidestrconsts.dlgfoldlocalpasvartype 1894msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" 1895msgid "Var/Type (local)" 1896msgstr "Var/Type (yerel)" 1897 1898#: lazarusidestrconsts.dlgfoldpasansicomment 1899msgid "Comment (* *)" 1900msgstr "Açıklama (* *)" 1901 1902#: lazarusidestrconsts.dlgfoldpasasm 1903msgid "Asm" 1904msgstr "Asm" 1905 1906#: lazarusidestrconsts.dlgfoldpasbeginend 1907msgid "Begin/End (nested)" 1908msgstr "Begin/End (iç içe geçmiş)" 1909 1910#: lazarusidestrconsts.dlgfoldpasborcomment 1911msgid "Comment { }" 1912msgstr "Açıklama { }" 1913 1914#: lazarusidestrconsts.dlgfoldpascase 1915msgid "Case" 1916msgstr "Case" 1917 1918#: lazarusidestrconsts.dlgfoldpasclass 1919msgid "Class/Object" 1920msgstr "Class/Object" 1921 1922#: lazarusidestrconsts.dlgfoldpasclasssection 1923msgid "public/private" 1924msgstr "public/private" 1925 1926#: lazarusidestrconsts.dlgfoldpasexcept 1927msgid "Except/Finally" 1928msgstr "Except/Finally" 1929 1930#: lazarusidestrconsts.dlgfoldpasfordo 1931msgid "For/Do" 1932msgstr "For/Do döngüsü" 1933 1934#: lazarusidestrconsts.dlgfoldpasifdef 1935msgid "{$IfDef}" 1936msgstr "{$IfDef}" 1937 1938#: lazarusidestrconsts.dlgfoldpasifthen 1939msgid "If/Then/Else" 1940msgstr "If/Then/Else" 1941 1942#: lazarusidestrconsts.dlgfoldpasnestedcomment 1943msgid "Nested Comment" 1944msgstr "İç içe Yorum" 1945 1946#: lazarusidestrconsts.dlgfoldpasprocbeginend 1947msgid "Begin/End (procedure)" 1948msgstr "Begin/End (procedure)" 1949 1950#: lazarusidestrconsts.dlgfoldpasprocedure 1951msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" 1952msgid "Procedure" 1953msgstr "Prosedür" 1954 1955#: lazarusidestrconsts.dlgfoldpasprogram 1956msgctxt "lazarusidestrconsts.dlgfoldpasprogram" 1957msgid "Program" 1958msgstr "Program" 1959 1960#: lazarusidestrconsts.dlgfoldpasrecord 1961msgctxt "lazarusidestrconsts.dlgfoldpasrecord" 1962msgid "Record" 1963msgstr "Kayıt" 1964 1965#: lazarusidestrconsts.dlgfoldpasrepeat 1966msgctxt "lazarusidestrconsts.dlgfoldpasrepeat" 1967msgid "Repeat" 1968msgstr "Tekrar et" 1969 1970#: lazarusidestrconsts.dlgfoldpasslashcomment 1971msgid "Comment //" 1972msgstr "Açıklama //" 1973 1974#: lazarusidestrconsts.dlgfoldpastry 1975msgid "Try" 1976msgstr "Try" 1977 1978#: lazarusidestrconsts.dlgfoldpasunit 1979msgctxt "lazarusidestrconsts.dlgfoldpasunit" 1980msgid "Unit" 1981msgstr "Birim" 1982 1983#: lazarusidestrconsts.dlgfoldpasunitsection 1984msgid "Unit section" 1985msgstr "Birim bölümü" 1986 1987#: lazarusidestrconsts.dlgfoldpasuserregion 1988msgid "{%Region}" 1989msgstr "{%Bölge}" 1990 1991#: lazarusidestrconsts.dlgfoldpasuses 1992msgctxt "lazarusidestrconsts.dlgfoldpasuses" 1993msgid "Uses" 1994msgstr "Uses" 1995 1996#: lazarusidestrconsts.dlgfoldpasvartype 1997msgid "Var/Type (global)" 1998msgstr "Var/Type (global)" 1999 2000#: lazarusidestrconsts.dlgfoldpaswhiledo 2001msgid "While/Do" 2002msgstr "While/Do" 2003 2004#: lazarusidestrconsts.dlgfoldpaswithdo 2005msgid "With/Do" 2006msgstr "With/Do" 2007 2008#: lazarusidestrconsts.dlgfoldxmlcdata 2009msgid "CData" 2010msgstr "CData" 2011 2012#: lazarusidestrconsts.dlgfoldxmlcomment 2013msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" 2014msgid "Comment" 2015msgstr "Açıklama" 2016 2017#: lazarusidestrconsts.dlgfoldxmldoctype 2018msgid "DocType" 2019msgstr "DocType" 2020 2021#: lazarusidestrconsts.dlgfoldxmlnode 2022msgctxt "lazarusidestrconsts.dlgfoldxmlnode" 2023msgid "Node" 2024msgstr "Düğüm" 2025 2026#: lazarusidestrconsts.dlgfoldxmlprocess 2027msgid "Processing Instruction" 2028msgstr "İşleme Yönergesi" 2029 2030#: lazarusidestrconsts.dlgforcedpiscalingindesigntime 2031msgid "Force DPI scaling in design-time" 2032msgstr "Tasarım zamanında DPI ölçeklendirmesini zorla" 2033 2034#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint 2035msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account." 2036msgstr "Kontrol edildiğinde proje ölçeklendirme ayarları dikkate alınmayacaktır - sadece form / frame / datamodule ölçeklendirme özelliği dikkate alınacaktır." 2037 2038#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror 2039msgid "The running Lazarus instance cannot accept any files." 2040msgstr "Çalışan Lazarus örneği herhangi bir dosyayı kabul edemez." 2041 2042#: lazarusidestrconsts.dlgforecolor 2043msgid "Foreground" 2044msgstr "Ön plan" 2045 2046#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector 2047msgid "Change Object Inspector contents on clicking form title bar" 2048msgstr "Form başlığı çubuğuna tıklayarak Nesne Denetçisi içeriğini değiştir" 2049 2050#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint 2051msgid "Show a form's properties in Object Inspector by clicking on its title bar." 2052msgstr "Bir formun özelliklerini başlık çubuğuna tıklayarak Nesne denetçisinde göster." 2053 2054#: lazarusidestrconsts.dlgforwardprocsinsertpolicy 2055msgid "Procedure insert policy" 2056msgstr "Prosedür ekleme politikası" 2057 2058#: lazarusidestrconsts.dlgforwardprocskeeporder 2059msgid "Keep order of procedures" 2060msgstr "Usullerin düzenini sürdürün" 2061 2062#: lazarusidestrconsts.dlgfpcexecutable 2063#, object-pascal-format 2064msgid "Compiler executable (e.g. %s)" 2065msgstr "Derleyici çalıştırılabilir (örn. %s)" 2066 2067#: lazarusidestrconsts.dlgfpcsrcpath 2068msgid "FPC source directory" 2069msgstr "FPC kaynak dizini" 2070 2071#: lazarusidestrconsts.dlgfppkgconfigurationfile 2072msgid "Fppkg configuration file (e.g. fppkg.cfg)" 2073msgstr "Fppkg yapılandırma dosyası (örn. fppkg. cfg)" 2074 2075#: lazarusidestrconsts.dlgframecolor 2076msgid "Text-mark" 2077msgstr "Metin işareti" 2078 2079#: lazarusidestrconsts.dlgfrmeditor 2080msgid "Form Editor" 2081msgstr "Form Editörü" 2082 2083#: lazarusidestrconsts.dlgfrombeginning 2084msgid "From b&eginning" 2085msgstr "Başlangıçta&n itibaren" 2086 2087#: lazarusidestrconsts.dlgfromcursor 2088#, fuzzy 2089#| msgid "&From cursor" 2090msgid "From c&ursor" 2091msgstr "&İmleçten" 2092 2093#: lazarusidestrconsts.dlgglobal 2094msgid "&Global" 2095msgstr "&Küresel" 2096 2097#: lazarusidestrconsts.dlggprof 2098msgid "Generate code for gprof" 2099msgstr "Gprof için kod üret" 2100 2101#: lazarusidestrconsts.dlggrabbercolor 2102msgid "Grabber color" 2103msgstr "Rengi yakala" 2104 2105#: lazarusidestrconsts.dlggrayeddesktopsdocked 2106msgid "Grayed desktops are for docked environment." 2107msgstr "Gri renkli masaüstleri yerleşik ortamlar içindir." 2108 2109#: lazarusidestrconsts.dlggrayeddesktopsundocked 2110msgid "Grayed desktops are for undocked environment." 2111msgstr "Gri tonlamalı masaüstü bilgisayarları kurtarma ortamı içindir." 2112 2113#: lazarusidestrconsts.dlggridcolor 2114msgid "Grid color" 2115msgstr "Izgara rengi" 2116 2117#: lazarusidestrconsts.dlggridconsistsofsmalldots 2118msgid "Grid consists of small dots which help aligning controls." 2119msgstr "Izgara, kontrolleri hizalamaya yardımcı olan küçük noktalardan oluşur." 2120 2121#: lazarusidestrconsts.dlggridx 2122msgid "Grid size X" 2123msgstr "Izgara ebadı X" 2124 2125#: lazarusidestrconsts.dlggridxhint 2126msgid "Horizontal grid step size" 2127msgstr "Yatay kılavuz adım boyutu" 2128 2129#: lazarusidestrconsts.dlggridy 2130msgid "Grid size Y" 2131msgstr "Izgara ebadı Y" 2132 2133#: lazarusidestrconsts.dlggridyhint 2134msgid "Vertical grid step size" 2135msgstr "Dikey grid adımı boyutu" 2136 2137#: lazarusidestrconsts.dlggroupcodeexplorer 2138msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" 2139msgid "Code Explorer" 2140msgstr "Kod Explorer" 2141 2142#: lazarusidestrconsts.dlggroupcodetools 2143msgid "Codetools" 2144msgstr "Kod Araçları" 2145 2146#: lazarusidestrconsts.dlggroupdebugger 2147msgctxt "lazarusidestrconsts.dlggroupdebugger" 2148msgid "Debugger" 2149msgstr "Hata ayıklayıcı" 2150 2151#: lazarusidestrconsts.dlggroupeditor 2152msgid "Editor" 2153msgstr "Editör" 2154 2155#: lazarusidestrconsts.dlggroupenvironment 2156msgctxt "lazarusidestrconsts.dlggroupenvironment" 2157msgid "Environment" 2158msgstr "Çevre" 2159 2160#: lazarusidestrconsts.dlggroupundo 2161msgid "Group Undo" 2162msgstr "Grup Geri Al" 2163 2164#: lazarusidestrconsts.dlgguidelines 2165msgid "Show Guide Lines" 2166msgstr "Kılavuz Çizgileri Göster" 2167 2168#: lazarusidestrconsts.dlgguidelineshint 2169msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown." 2170msgstr "Bir denetim başka denetimlerle yatay veya dikey olarak hizalandığında, mavi bir kılavuz çizgisi görünür." 2171 2172#: lazarusidestrconsts.dlggutter 2173msgctxt "lazarusidestrconsts.dlggutter" 2174msgid "Gutter" 2175msgstr "Cilt Payı" 2176 2177#: lazarusidestrconsts.dlgguttercollapsedcolor 2178msgid "Collapsed" 2179msgstr "Çöktü" 2180 2181#: lazarusidestrconsts.dlgguttercolor 2182msgid "Gutter Color" 2183msgstr "Cilt Payı Boyası" 2184 2185#: lazarusidestrconsts.dlggutteredgecolor 2186msgid "Gutter Edge Color" 2187msgstr "Gutter Edge Color" 2188 2189#: lazarusidestrconsts.dlggutterseparatorindex 2190msgid "Gutter separator index" 2191msgstr "Cilt ayırıcı indeksi" 2192 2193#: lazarusidestrconsts.dlghalfpagescroll 2194msgid "Half page scroll" 2195msgstr "Yarım sayfa kaydırma" 2196 2197#: lazarusidestrconsts.dlgheapandstacksize 2198msgid "Heap and stack sizes" 2199msgstr "Yığın ve yığın boyutları" 2200 2201#: lazarusidestrconsts.dlgheapsize 2202msgid "Heap size" 2203msgstr "Yığın boyutu" 2204 2205#: lazarusidestrconsts.dlgheightofonepropertyingrid 2206msgid "Height of one property in the grid." 2207msgstr "Şebekedeki bir mülkün yüksekliği." 2208 2209#: lazarusidestrconsts.dlgheightpos 2210msgid "Height:" 2211msgstr "Yükseklik:" 2212 2213#: lazarusidestrconsts.dlghideideonrun 2214msgid "Hide IDE windows on run" 2215msgstr "Çalıştırıldığında IDE pencerelerini gizle" 2216 2217#: lazarusidestrconsts.dlghideideonrunhint 2218msgid "Do not show the IDE at all while program is running." 2219msgstr "Program çalışırken IDE 'yi hiç gösterme." 2220 2221#: lazarusidestrconsts.dlghidesingletabinnotebook 2222msgid "Hide tab in single page windows" 2223msgstr "Tek sayfa ise sekmeyi gizle" 2224 2225#: lazarusidestrconsts.dlghighlightcolor 2226msgid "Highlight Color" 2227msgstr "Rengi Vurgula" 2228 2229#: lazarusidestrconsts.dlghighlightfontcolor 2230msgid "Highlight Font Color" 2231msgstr "Yazı tipi rengini vurgula" 2232 2233#: lazarusidestrconsts.dlghighlightleftofcursor 2234msgid "Left Of Caret" 2235msgstr "Sola Düzeltme işareti" 2236 2237#: lazarusidestrconsts.dlghighlightrightofcursor 2238msgid "Right Of Caret" 2239msgstr "Sağa Düzeltme işareti" 2240 2241#: lazarusidestrconsts.dlghintsparametersendernotused 2242msgid "Show hints for parameter \"Sender\" not used" 2243msgstr "Kullanılmayan \"Sender\" parametresinin ipuçlarını göster" 2244 2245#: lazarusidestrconsts.dlghintsunused 2246msgid "Show hints for unused units in main" 2247msgstr "Kullanılmayan birimler için ana ipuçlarını göster" 2248 2249#: lazarusidestrconsts.dlghomekeyjumpstoneareststart 2250msgid "Home key jumps to nearest start" 2251msgstr "Home tuşu en yakın başlangıca atlar" 2252 2253#: lazarusidestrconsts.dlghostapplication 2254msgid "Host application" 2255msgstr "Ana bilgisayar uygulaması" 2256 2257#: lazarusidestrconsts.dlgidentifiercompletion 2258msgid "Identifier Completion" 2259msgstr "Tanımlayıcı Tamamlama" 2260 2261#: lazarusidestrconsts.dlgidentifierpolicy 2262msgid "Identifier policy" 2263msgstr "Tanımlayıcı politikası" 2264 2265#: lazarusidestrconsts.dlgideoptions 2266msgid "IDE Options" 2267msgstr "IDE Seçenekleri" 2268 2269#: lazarusidestrconsts.dlgifdefblockactive 2270msgid "Active $IFDEF code" 2271msgstr "Aktif $IFDEF kodu" 2272 2273#: lazarusidestrconsts.dlgifdefblockinactive 2274msgid "Inactive $IFDEF code" 2275msgstr "Etkin değil $IFDEF kodu" 2276 2277#: lazarusidestrconsts.dlgifdefblocktmpactive 2278msgid "Included mixed state $IFDEF code" 2279msgstr "Karma durum $IFDEF kodu dahil" 2280 2281#: lazarusidestrconsts.dlgifdefnodeactive 2282msgid "Active $IFDEF node" 2283msgstr "Aktif $IFDEF düğümü" 2284 2285#: lazarusidestrconsts.dlgifdefnodeinactive 2286msgid "Inactive $IFDEF node" 2287msgstr "$IFDEF düğümünü pasif et" 2288 2289#: lazarusidestrconsts.dlgifdefnodetmpactive 2290msgid "Included mixed state $IFDEF node" 2291msgstr "Karma durum $IFDEF düğümü dahil et" 2292 2293#: lazarusidestrconsts.dlgimportdesktopexists 2294msgid "" 2295"A desktop with the same name already exists.\n" 2296"Please confirm the desktop name:" 2297msgstr "" 2298"Aynı ada sahip bir masaüstü zaten var.\n" 2299"Lütfen masaüstü adını doğrulayın:" 2300 2301#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl 2302msgid "Include code templates" 2303msgstr "Kod şablonları ekle" 2304 2305#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix 2306msgid "Include identifiers containing prefix" 2307msgstr "Önek içeren tanımlayıcıları dahil et" 2308 2309#: lazarusidestrconsts.dlgincludesystemvariables 2310msgid "Include system variables" 2311msgstr "Sistem değişkenlerini dahil et" 2312 2313#: lazarusidestrconsts.dlgincludewordstoidentcompl 2314msgid "Include words" 2315msgstr "Kelimeleri dahil et" 2316 2317#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude 2318msgid "don't include" 2319msgstr "dahil etme" 2320 2321#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits 2322msgid "from all units" 2323msgstr "tüm birimlerden" 2324 2325#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit 2326msgid "from current unit" 2327msgstr "mevcut birimden" 2328 2329#: lazarusidestrconsts.dlgindentsindentgroupoptions 2330msgid "Indent" 2331msgstr "Girinti" 2332 2333#: lazarusidestrconsts.dlgindentstabsgroupoptions 2334msgid "Tabs" 2335msgstr "Sekmeler" 2336 2337#: lazarusidestrconsts.dlginfrontofmethods 2338msgid "In front of methods" 2339msgstr "Yöntemlerin önünde" 2340 2341#: lazarusidestrconsts.dlginitdoneonly 2342msgid "Constructor name must be 'init' (destructor must be 'done')" 2343msgstr "Yapıcı adı 'init' olmalıdır (yıkıcı 'yapılmalıdır')" 2344 2345#: lazarusidestrconsts.dlginsertclassparts 2346msgid "Insert class parts" 2347msgstr "Sınıf parçaları ekle" 2348 2349#: lazarusidestrconsts.dlginsertimplementation 2350msgid "Implementation" 2351msgstr "Uygulama" 2352 2353#: lazarusidestrconsts.dlginsertinterface 2354msgid "Interface" 2355msgstr "Arayüz" 2356 2357#: lazarusidestrconsts.dlginsertmethods 2358msgid "Insert method implementations" 2359msgstr "Implementations bölümüne ekle" 2360 2361#: lazarusidestrconsts.dlginsertsection 2362msgid "Insert into Uses section of" 2363msgstr "Uses bölümüne ekleyin" 2364 2365#: lazarusidestrconsts.dlginsspaceafter 2366msgid "Insert space after" 2367msgstr "Sona boşluk ekle" 2368 2369#: lazarusidestrconsts.dlginsspacefront 2370msgid "Insert space in front of" 2371msgstr "Önüne boşluk ekle" 2372 2373#: lazarusidestrconsts.dlgintvinsec 2374msgid "Interval in secs" 2375msgstr "Saniye Aralığı" 2376 2377#: lazarusidestrconsts.dlgjumpcodeblockpos 2378msgid "Vertical position for a code block jump in % (0=top, 100=bottom)" 2379msgstr "Bir kod bloğu için dikey konum % cinsinden atlama (0 = üst, 100 = alt)" 2380 2381#: lazarusidestrconsts.dlgjumpingetc 2382msgid "Jumping (e.g. Method Jumping)" 2383msgstr "Atlama (ör. Yöntem Atlama)" 2384 2385#: lazarusidestrconsts.dlgjumpsinglelinepos 2386msgid "Vertical position for a single line jump in % (0=top, 100=bottom)" 2387msgstr "Tek satırlık bir atlama için dikey konum % (0 = üst, 100 = alt)" 2388 2389#: lazarusidestrconsts.dlgjumptomethodbody 2390msgid "Jump directly to method body" 2391msgstr "Doğrudan yöntem gövdesine atla" 2392 2393#: lazarusidestrconsts.dlgkeepcursorx 2394msgid "Keep caret X position when navigating up/down" 2395msgstr "İmleci X konumunda tut" 2396 2397#: lazarusidestrconsts.dlgkeylink 2398msgid "(Edit Key)" 2399msgstr "(Tuş Düzenle)" 2400 2401#: lazarusidestrconsts.dlgkeymapping 2402msgid "Key Mappings" 2403msgstr "Tuş haritası" 2404 2405#: lazarusidestrconsts.dlgkeymappingerrors 2406msgid "Key mapping errors" 2407msgstr "Tuş haritası hataları" 2408 2409#: lazarusidestrconsts.dlgkeywordpolicy 2410msgid "Keyword policy" 2411msgstr "Anahtar kelime politikası" 2412 2413#: lazarusidestrconsts.dlglabelgoto 2414msgid "Allow LABEL and GOTO" 2415msgstr "LABEL ve GOTO'ya izin ver" 2416 2417#: lazarusidestrconsts.dlglang 2418msgctxt "lazarusidestrconsts.dlglang" 2419msgid "Language" 2420msgstr "Dil" 2421 2422#: lazarusidestrconsts.dlglast 2423msgid "Last (i.e. at end of source)" 2424msgstr "Son (yani kaynağın sonunda)" 2425 2426#: lazarusidestrconsts.dlglazarusdir 2427msgid "Lazarus directory (default for all projects)" 2428msgstr "Lazarus dizini (tüm projeler için varsayılan)" 2429 2430#: lazarusidestrconsts.dlglazarusinstances 2431msgid "Lazarus instances" 2432msgstr "" 2433 2434#: lazarusidestrconsts.dlglefttopclr 2435msgid "Guide lines Left,Top" 2436msgstr "Kılavuz Çizgileri Sol, Üst" 2437 2438#: lazarusidestrconsts.dlglevel1opt 2439msgid "1 (quick, debugger friendly with small limitations)" 2440msgstr "1 (hızlı, hata ayıklayıcı küçük sınırlamalarla)" 2441 2442#: lazarusidestrconsts.dlglevel2opt 2443msgid "2 (-O1 + quick optimizations)" 2444msgstr "2 (-O1 + hızlı optimizasyon)" 2445 2446#: lazarusidestrconsts.dlglevel3opt 2447msgid "3 (-O2 + slow optimizations)" 2448msgstr "3 (-O2 + yavaş optimizasyon)" 2449 2450#: lazarusidestrconsts.dlglevel4opt 2451msgid "4 (-O3 + aggressive optimizations, beware)" 2452msgstr "4 (-O3 + agresif optimizasyon, dikkatli olun)" 2453 2454#: lazarusidestrconsts.dlglevelnoneopt 2455msgid "0 (no optimization, for debugging)" 2456msgstr "0 (hata ayıklayıcı için optimizasyon yok)" 2457 2458#: lazarusidestrconsts.dlglinesplitting 2459msgid "Line Splitting" 2460msgstr "Satır Bölme" 2461 2462#: lazarusidestrconsts.dlglinksmart 2463msgid "Link smart" 2464msgstr "Akıllı bağlantı" 2465 2466#: lazarusidestrconsts.dlglnumsbct 2467msgid "Display line numbers in run-time error backtraces" 2468msgstr "Çalışma zamanı hatasındaki geriye dönük izleme satır numaralarını görüntüle" 2469 2470#: lazarusidestrconsts.dlgmainmenu 2471msgid "Main Menu" 2472msgstr "Ana menü" 2473 2474#: lazarusidestrconsts.dlgmainviewforms 2475msgid "View Project Forms" 2476msgstr "Proje Formlarını Görüntüle" 2477 2478#: lazarusidestrconsts.dlgmainviewframes 2479msgid "View Project Frames" 2480msgstr "Proje Çerçevelerini Görüntüle" 2481 2482#: lazarusidestrconsts.dlgmainviewunits 2483msgid "View Project Units" 2484msgstr "Proje Birimlerini Görüntüle" 2485 2486#: lazarusidestrconsts.dlgmakeexecutable 2487msgid "\"Make\" executable" 2488msgstr "Çalıştırılablir Yap" 2489 2490#: lazarusidestrconsts.dlgmanagedesktops 2491msgid "Manage desktops" 2492msgstr "Masaüstlerini yönet" 2493 2494#: lazarusidestrconsts.dlgmargingutter 2495msgid "Margin and gutter" 2496msgstr "Kenar boşluğu ve cilt payı" 2497 2498#: lazarusidestrconsts.dlgmarkercolor 2499msgid "Marker color" 2500msgstr "İşaretçi rengi" 2501 2502#: lazarusidestrconsts.dlgmarkupfoldcolor 2503msgid "Vertical-mark" 2504msgstr "Dikey-işareti" 2505 2506#: lazarusidestrconsts.dlgmarkupgroup 2507msgid "Highlight all occurrences of Word under Caret" 2508msgstr "Şapka işareti altındaki kelimenin bütün oluşumlarını vurgula" 2509 2510#: lazarusidestrconsts.dlgmarkupoutline 2511msgid "Outline (global)" 2512msgstr "Anahat (genel)" 2513 2514#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor 2515msgid "Warning: There are no colors configured for the selected language" 2516msgstr "Uyarı: Seçilen dil için yapılandırılmış renk yok" 2517 2518#: lazarusidestrconsts.dlgmarkupuserdefined 2519msgid "User defined markup" 2520msgstr "Kullanıcı tanımlı biçimlendirme" 2521 2522#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption 2523msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption" 2524msgid "Delete" 2525msgstr "Sil" 2526 2527#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt 2528#, object-pascal-format 2529msgid "Delete list \"%s\"?" 2530msgstr "Listeyi sil \"%s\"?" 2531 2532#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd 2533msgid "Add Word or Term" 2534msgstr "Kelime veya Terim Ekle" 2535 2536#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove 2537msgid "Remove Word or Term" 2538msgstr "Kelimeyi veya Terimi Kaldır" 2539 2540#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle 2541msgid "Toggle Word or Term" 2542msgstr "Kelimeyi veya Terimi Değiştir" 2543 2544#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate 2545msgid "Duplicate Term" 2546msgstr "Yinelenen Terim" 2547 2548#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg 2549#, object-pascal-format 2550msgid "The term %s already exists. Duplicates will be removed when the list is saved." 2551msgstr "%s terimi zaten var. Liste kaydedildiğinde yinelenenler kaldırılacak." 2552 2553#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist 2554msgid "Add/Remove in all editors" 2555msgstr "Tüm editörlerde Ekle/Kaldır" 2556 2557#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel 2558msgid "Delete list" 2559msgstr "Listeyi sil" 2560 2561#: lazarusidestrconsts.dlgmarkupuserdefinedlistname 2562msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname" 2563msgid "Name" 2564msgstr "Ad" 2565 2566#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew 2567msgid "Add list" 2568msgstr "Liste ekle" 2569 2570#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase 2571msgid "Case sensitive" 2572msgstr "Harfe duyarlı" 2573 2574#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound 2575msgid "Set bound at term end" 2576msgstr "Terim sonunda sınırlanmış olarak ayarla" 2577 2578#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound 2579msgid "Set bound at term start" 2580msgstr "Terim başında sınırlandırılmış ayarla" 2581 2582#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen 2583msgid "Ignore bounds for terms longer than" 2584msgstr "Sınırlarından daha uzun olan terimler için sınırları yoksay" 2585 2586#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect 2587msgid "selection" 2588msgstr "seçim" 2589 2590#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword 2591msgid "current word" 2592msgstr "geçerli kelime" 2593 2594#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts 2595msgid "Settings for terms added by key" 2596msgstr "Tuş tarafından eklenen terimlerin ayarları" 2597 2598#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect 2599msgid "Smart match selection bounds" 2600msgstr "Akıllı eşleşme seçimi sınırlar" 2601 2602#: lazarusidestrconsts.dlgmarkupuserdefinednewname 2603msgid "New list" 2604msgstr "Yeni liste" 2605 2606#: lazarusidestrconsts.dlgmarkupuserdefinednolists 2607msgid "No lists" 2608msgstr "Liste yok" 2609 2610#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel 2611msgid "Select ..." 2612msgstr "Seç ..." 2613 2614#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys 2615msgid "Key Settings" 2616msgstr "Tuş Ayarları" 2617 2618#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain 2619msgid "Main settings" 2620msgstr "Ana ayarlar" 2621 2622#: lazarusidestrconsts.dlgmarkupwordbracket 2623msgid "Keyword brackets on caret (global)" 2624msgstr "Şapkadaki anahtar sözcükler (global)" 2625 2626#: lazarusidestrconsts.dlgmarkupwordfulllen 2627msgid "Match whole words, if length is less or equal to:" 2628msgstr "Bu uzunluğa kadar kelimelerin kelime sınırlarını eşleştirin:" 2629 2630#: lazarusidestrconsts.dlgmarkupwordnokeyword 2631msgid "Ignore keywords" 2632msgstr "Anahtar kelimeleri yoksay" 2633 2634#: lazarusidestrconsts.dlgmarkupwordnotimer 2635msgid "Disable timer for markup current word" 2636msgstr "Geçerli kelimeyi biçimlendirmek için zamanlayıcıyı devre dışı bırak" 2637 2638#: lazarusidestrconsts.dlgmarkupwordtrim 2639msgid "Trim spaces (when highlighting current selection)" 2640msgstr "Boşlukları kırp(geçerli seçimi vurgularken)" 2641 2642#: lazarusidestrconsts.dlgmaxcntr 2643msgid "Maximum counter" 2644msgstr "Maksimum sayaç" 2645 2646#: lazarusidestrconsts.dlgmaxlinelength 2647msgid "Max line length:" 2648msgstr "Maks. Satır uzunluğu:" 2649 2650#: lazarusidestrconsts.dlgmaxrecentfiles 2651msgid "Max recent files" 2652msgstr "Son güncellenen dosyalar" 2653 2654#: lazarusidestrconsts.dlgmaxrecenthint 2655msgid "Value 0 means unlimited." 2656msgstr "0 değeri sınırsız demektir." 2657 2658#: lazarusidestrconsts.dlgmaxrecentprojs 2659msgid "Max recent project files" 2660msgstr "Maksimum yeni proje dosyaları" 2661 2662#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod 2663msgid "Middle-click-modifier to close all other tabs" 2664msgstr "Diğer tüm sekmeleri kapatmak için orta tıklamayla değiştirir" 2665 2666#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod 2667msgid "Middle-click-modifier to close tabs on the right" 2668msgstr "Sağdaki sekmeleri kapatmak için orta tıklama değiştir" 2669 2670#: lazarusidestrconsts.dlgmixmethodsandproperties 2671msgid "Mix methods and properties" 2672msgstr "Karışım yöntemleri ve özellikleri" 2673 2674#: lazarusidestrconsts.dlgmode 2675msgid "Mode" 2676msgstr "Mod" 2677 2678#: lazarusidestrconsts.dlgmouseaction 2679msgid "Mouse Action" 2680msgstr "Fare Hareketi" 2681 2682#: lazarusidestrconsts.dlgmouseoptbtn1 2683msgctxt "lazarusidestrconsts.dlgmouseoptbtn1" 2684msgid "Single" 2685msgstr "Tek" 2686 2687#: lazarusidestrconsts.dlgmouseoptbtn2 2688msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" 2689msgid "Double" 2690msgstr "Çift" 2691 2692#: lazarusidestrconsts.dlgmouseoptbtn3 2693msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" 2694msgid "Triple" 2695msgstr "Üçlü" 2696 2697#: lazarusidestrconsts.dlgmouseoptbtn4 2698msgctxt "lazarusidestrconsts.dlgmouseoptbtn4" 2699msgid "Quad" 2700msgstr "Dörtlü" 2701 2702#: lazarusidestrconsts.dlgmouseoptbtnany 2703msgid "Any" 2704msgstr "Herhangi biri" 2705 2706#: lazarusidestrconsts.dlgmouseoptbtnextra1 2707msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1" 2708msgid "Extra 1" 2709msgstr "Ekstra 1" 2710 2711#: lazarusidestrconsts.dlgmouseoptbtnextra2 2712msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2" 2713msgid "Extra 2" 2714msgstr "Ekstra 2" 2715 2716#: lazarusidestrconsts.dlgmouseoptbtnleft 2717msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" 2718msgid "Left" 2719msgstr "Ayrıldı" 2720 2721#: lazarusidestrconsts.dlgmouseoptbtnmiddle 2722msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" 2723msgid "Middle" 2724msgstr "Orta" 2725 2726#: lazarusidestrconsts.dlgmouseoptbtnmoddef 2727msgid "Make Fallback" 2728msgstr "Geri Dönüş Yap" 2729 2730#: lazarusidestrconsts.dlgmouseoptbtnright 2731msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" 2732msgid "Right" 2733msgstr "Sağ" 2734 2735#: lazarusidestrconsts.dlgmouseoptbtnwheeldown 2736msgid "Wheel down" 2737msgstr "Tekerlek indir" 2738 2739#: lazarusidestrconsts.dlgmouseoptbtnwheelleft 2740msgid "Wheel left" 2741msgstr "Sol tekerlek" 2742 2743#: lazarusidestrconsts.dlgmouseoptbtnwheelright 2744msgid "Wheel right" 2745msgstr "Sağ tekerlek" 2746 2747#: lazarusidestrconsts.dlgmouseoptbtnwheelup 2748msgid "Wheel up" 2749msgstr "Tekerlek yukarı" 2750 2751#: lazarusidestrconsts.dlgmouseoptcapture 2752msgid "Capture" 2753msgstr "Ele geçirmek" 2754 2755#: lazarusidestrconsts.dlgmouseoptcaretmove 2756msgid "Move Caret (extra)" 2757msgstr "Taşıyıcıyı Taşı (ekstra)" 2758 2759#: lazarusidestrconsts.dlgmouseoptcheckupdown 2760msgid "Act on Mouse up" 2761msgstr "Fareyi yukarı kaldırma yasası" 2762 2763#: lazarusidestrconsts.dlgmouseoptdescaction 2764msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" 2765msgid "Action" 2766msgstr "Aksiyon" 2767 2768#: lazarusidestrconsts.dlgmouseoptdescbutton 2769msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" 2770msgid "Click" 2771msgstr "Tıkla" 2772 2773#: lazarusidestrconsts.dlgmouseoptdlgtitle 2774msgid "Edit Mouse" 2775msgstr "Fare Düzenle" 2776 2777#: lazarusidestrconsts.dlgmouseopterrordup 2778msgid "Duplicate Entry" 2779msgstr "Yinelenen Giriş" 2780 2781#: lazarusidestrconsts.dlgmouseopterrorduptext 2782msgid "This entry conflicts with an existing entry" 2783msgstr "Bu giriş mevcut bir girişle çakışıyor" 2784 2785#: lazarusidestrconsts.dlgmouseoptheadalt 2786msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" 2787msgid "Alt" 2788msgstr "Alt" 2789 2790#: lazarusidestrconsts.dlgmouseoptheadbtn 2791msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" 2792msgid "Button" 2793msgstr "Düğme" 2794 2795#: lazarusidestrconsts.dlgmouseoptheadcaret 2796msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret" 2797msgid "Caret" 2798msgstr "Düzeltme işareti" 2799 2800#: lazarusidestrconsts.dlgmouseoptheadcontext 2801msgid "Context" 2802msgstr "Bağlam" 2803 2804#: lazarusidestrconsts.dlgmouseoptheadcount 2805msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" 2806msgid "Click" 2807msgstr "Tıkla" 2808 2809#: lazarusidestrconsts.dlgmouseoptheadctrl 2810msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" 2811msgid "Ctrl" 2812msgstr "Ctrl" 2813 2814#: lazarusidestrconsts.dlgmouseoptheaddesc 2815msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" 2816msgid "Action" 2817msgstr "Aksiyon" 2818 2819#: lazarusidestrconsts.dlgmouseoptheaddir 2820msgid "Up/Down" 2821msgstr "Yukarı aşağı" 2822 2823#: lazarusidestrconsts.dlgmouseoptheadopt 2824msgid "Option" 2825msgstr "Seçenek" 2826 2827#: lazarusidestrconsts.dlgmouseoptheadorder 2828msgid "Order" 2829msgstr "Sipariş" 2830 2831#: lazarusidestrconsts.dlgmouseoptheadpriority 2832msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" 2833msgid "Priority" 2834msgstr "Öncelikli" 2835 2836#: lazarusidestrconsts.dlgmouseoptheadshift 2837msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" 2838msgid "Shift" 2839msgstr "Shift" 2840 2841#: lazarusidestrconsts.dlgmouseoptions 2842msgid "Mouse" 2843msgstr "Fare" 2844 2845#: lazarusidestrconsts.dlgmouseoptionsadv 2846msgid "Advanced" 2847msgstr "İleri" 2848 2849#: lazarusidestrconsts.dlgmouseoptionsyncommand 2850msgid "IDE-Command" 2851msgstr "IDE-Komut" 2852 2853#: lazarusidestrconsts.dlgmouseoptmodalt 2854msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" 2855msgid "Alt" 2856msgstr "Alt" 2857 2858#: lazarusidestrconsts.dlgmouseoptmodctrl 2859msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" 2860msgid "Ctrl" 2861msgstr "Ctrl" 2862 2863#: lazarusidestrconsts.dlgmouseoptmodkeyfalse 2864msgid "n" 2865msgstr "n" 2866 2867#: lazarusidestrconsts.dlgmouseoptmodkeyignore 2868msgid "-" 2869msgstr "-" 2870 2871#: lazarusidestrconsts.dlgmouseoptmodkeytrue 2872msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" 2873msgid "Y" 2874msgstr "Y" 2875 2876#: lazarusidestrconsts.dlgmouseoptmodshift 2877msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" 2878msgid "Shift" 2879msgstr "Shift" 2880 2881#: lazarusidestrconsts.dlgmouseoptmovemousetrue 2882msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" 2883msgid "Y" 2884msgstr "Y" 2885 2886#: lazarusidestrconsts.dlgmouseoptnodeall 2887msgctxt "lazarusidestrconsts.dlgmouseoptnodeall" 2888msgid "All" 2889msgstr "Herşey" 2890 2891#: lazarusidestrconsts.dlgmouseoptnodegutter 2892msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" 2893msgid "Gutter" 2894msgstr "Cilt Payı" 2895 2896#: lazarusidestrconsts.dlgmouseoptnodegutterchanges 2897msgid "Line Changes" 2898msgstr "Satır Değişiklikleri" 2899 2900#: lazarusidestrconsts.dlgmouseoptnodegutterfold 2901msgid "Fold Tree" 2902msgstr "Kat Ağacı" 2903 2904#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol 2905msgid "Collapsed [+]" 2906msgstr "Daraltılmış [+]" 2907 2908#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp 2909msgid "Expanded [-]" 2910msgstr "Genişletilmiş [-]" 2911 2912#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview 2913msgid "Overview" 2914msgstr "Genel bakış" 2915 2916#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks 2917msgid "Overview Mark" 2918msgstr "Genel Bakış Mark" 2919 2920#: lazarusidestrconsts.dlgmouseoptnodegutterlines 2921msgid "Line Numbers" 2922msgstr "Satır Numaraları" 2923 2924#: lazarusidestrconsts.dlgmouseoptnodemain 2925msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" 2926msgid "Text" 2927msgstr "Metin" 2928 2929#: lazarusidestrconsts.dlgmouseoptnodeselect 2930msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" 2931msgid "Selection" 2932msgstr "Seçim" 2933 2934#: lazarusidestrconsts.dlgmouseoptopt2label 2935msgid "Opt" 2936msgstr "Opt" 2937 2938#: lazarusidestrconsts.dlgmouseoptotheract 2939msgid "Other actions using the same button" 2940msgstr "Aynı düğmeyi kullanan diğer eylemler" 2941 2942#: lazarusidestrconsts.dlgmouseoptotheracthint 2943msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." 2944msgstr "Değiştirme Tuşları, Ayrıntılı Ayarlar, Tek/Çift, Yukarı/Aşağı öğelerine bağlı olarak çalıştırılabilirler...." 2945 2946#: lazarusidestrconsts.dlgmouseoptotheracttoggle 2947msgid "Filter Mod-Keys" 2948msgstr "Filtre Mod Anahtarları" 2949 2950#: lazarusidestrconsts.dlgmouseoptpriorlabel 2951msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" 2952msgid "Priority" 2953msgstr "Öncelikli" 2954 2955#: lazarusidestrconsts.dlgmsgs 2956msgctxt "lazarusidestrconsts.dlgmsgs" 2957msgid "Messages" 2958msgstr "Mesajlar" 2959 2960#: lazarusidestrconsts.dlgmsgwincolorurgentdebug 2961msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug" 2962msgid "Debug" 2963msgstr "Hata ayıklama" 2964 2965#: lazarusidestrconsts.dlgmsgwincolorurgenterror 2966msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror" 2967msgid "Error" 2968msgstr "Hata" 2969 2970#: lazarusidestrconsts.dlgmsgwincolorurgentfatal 2971msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal" 2972msgid "Fatal" 2973msgstr "Ölümcül" 2974 2975#: lazarusidestrconsts.dlgmsgwincolorurgenthint 2976msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint" 2977msgid "Hint" 2978msgstr "İpucu" 2979 2980#: lazarusidestrconsts.dlgmsgwincolorurgentimportant 2981msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant" 2982msgid "Important" 2983msgstr "Önemli" 2984 2985#: lazarusidestrconsts.dlgmsgwincolorurgentnone 2986msgid "Normal" 2987msgstr "Normal" 2988 2989#: lazarusidestrconsts.dlgmsgwincolorurgentnote 2990msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote" 2991msgid "Note" 2992msgstr "Not" 2993 2994#: lazarusidestrconsts.dlgmsgwincolorurgentpanic 2995msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic" 2996msgid "Panic" 2997msgstr "Panik" 2998 2999#: lazarusidestrconsts.dlgmsgwincolorurgentprogress 3000msgid "Time and statistics" 3001msgstr "Zaman ve istatistikler" 3002 3003#: lazarusidestrconsts.dlgmsgwincolorurgentverbose 3004msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose" 3005msgid "Verbose" 3006msgstr "Ayrıntılı" 3007 3008#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2 3009msgid "Verbose 2" 3010msgstr "Verbose 2" 3011 3012#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3 3013msgid "Verbose 3" 3014msgstr "Verbose 3" 3015 3016#: lazarusidestrconsts.dlgmsgwincolorurgentwarning 3017msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning" 3018msgid "Warning" 3019msgstr "Uyarı" 3020 3021#: lazarusidestrconsts.dlgmulticaretcolumnmode 3022msgid "Navigation keys move all carets (column-select)" 3023msgstr "Çoklu liste (sütun seçimi) imleci hareket ettir" 3024 3025#: lazarusidestrconsts.dlgmulticaretdelskipcr 3026msgid "Skip delete key at EOL (do not join lines)" 3027msgstr "EOL'deki silme anahtarını atla (satırlara katılma)" 3028 3029#: lazarusidestrconsts.dlgmulticaretgroupoptions 3030msgid "Multi-caret" 3031msgstr "Çok Düzeltme işareti" 3032 3033#: lazarusidestrconsts.dlgmulticaretmode 3034msgid "Navigation keys move all carets" 3035msgstr "İmleçle birlikte çok satırlı hareket" 3036 3037#: lazarusidestrconsts.dlgmulticaretoncolumnselection 3038msgid "Enable multi-caret for column selection" 3039msgstr "Sütun seçimi için çoklu dizge etkinleştir" 3040 3041#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew 3042msgid "always start a new instance" 3043msgstr "her zaman yeni bir Lazarus da dosyayı aç" 3044 3045#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance 3046msgid "do not allow multiple instances" 3047msgstr "aynı anda birden fazla Lazarus çalışmasın" 3048 3049#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning 3050msgid "open files in a running instance" 3051msgstr "çalışan mevcut Lazarus da dosyaları aç" 3052 3053#: lazarusidestrconsts.dlgmultiselect 3054msgid "Multi Select" 3055msgstr "Çoklu seçim" 3056 3057#: lazarusidestrconsts.dlgmultiwinaccessgroup 3058msgid "Jump target priority between multiple editors" 3059msgstr "Birden çok editör arasında hedef önceliğini atla" 3060 3061#: lazarusidestrconsts.dlgmultiwinaccessorder 3062msgid "Order to use for editors matching the same criteria" 3063msgstr "Aynı kriterlere uyan editörler için kullanmak üzere sipariş ver" 3064 3065#: lazarusidestrconsts.dlgmultiwinaccessorderedit 3066msgid "Most recent focused editor for this file" 3067msgstr "Bu dosya için en son odaklanmış editör" 3068 3069#: lazarusidestrconsts.dlgmultiwinaccessorderwin 3070msgid "Editor (for file) in most recent focused window" 3071msgstr "En son odaklanan pencerede Editör (dosya için)" 3072 3073#: lazarusidestrconsts.dlgmultiwinaccesstype 3074msgid "Priority list of criteria to choose an editor:" 3075msgstr "Bir düzenleyici seçmek için kriterlerin öncelik listesi:" 3076 3077#: lazarusidestrconsts.dlgmultiwinoptions 3078msgid "Pages and Windows" 3079msgstr "Sayfalar ve Pencereler" 3080 3081#: lazarusidestrconsts.dlgmultiwintabgroup 3082msgid "Notebook Tabs" 3083msgstr "Editör Sekmeleri" 3084 3085#: lazarusidestrconsts.dlgnaming 3086msgid "Naming" 3087msgstr "Adlandırma" 3088 3089#: lazarusidestrconsts.dlgnewdesktop 3090msgid "New desktop ..." 3091msgstr "Yeni masaüstü ..." 3092 3093#: lazarusidestrconsts.dlgnewprojecttype 3094msgid "New Project Type" 3095msgstr "" 3096 3097#: lazarusidestrconsts.dlgnoautomaticrenaming 3098msgid "No automatic renaming" 3099msgstr "Otomatik yeniden adlandırma yok" 3100 3101#: lazarusidestrconsts.dlgnoavailableunits 3102msgid "No available units to add." 3103msgstr "Eklenebilecek birim yok." 3104 3105#: lazarusidestrconsts.dlgnobrackethighlight 3106msgid "No Highlight" 3107msgstr "Vurgulama Yok" 3108 3109#: lazarusidestrconsts.dlgnonformbackgroundcolor 3110msgid "Other Designer background color (e. g. TDataModule)" 3111msgstr "" 3112 3113#: lazarusidestrconsts.dlgnotebooktabpos 3114msgid "Source notebook tabs position" 3115msgstr "Kaynak sekmeleri konumu" 3116 3117#: lazarusidestrconsts.dlgnotsplitlineafter 3118msgid "Do not split line after" 3119msgstr "Satırın sonuna bölme" 3120 3121#: lazarusidestrconsts.dlgnotsplitlinefront 3122msgid "Do not split line in front of" 3123msgstr "Satırın önüne bölme" 3124 3125#: lazarusidestrconsts.dlgnsprincipalclass 3126msgid "NSPrincipalClass" 3127msgstr "" 3128 3129#: lazarusidestrconsts.dlgobjinsp 3130msgctxt "lazarusidestrconsts.dlgobjinsp" 3131msgid "Object Inspector" 3132msgstr "Nesne(Bileşen) Özellikleri" 3133 3134#: lazarusidestrconsts.dlgoiitemheight 3135msgid "Item height (0 = auto)" 3136msgstr "Öğe yüksekliği(otomatik=0)" 3137 3138#: lazarusidestrconsts.dlgoimiscellaneous 3139msgctxt "lazarusidestrconsts.dlgoimiscellaneous" 3140msgid "Miscellaneous" 3141msgstr "Çeşitli" 3142 3143#: lazarusidestrconsts.dlgoispeedsettings 3144msgid "Speed settings" 3145msgstr "Hızlı ayarlar" 3146 3147#: lazarusidestrconsts.dlgoiusedefaultdelphisettings 3148msgid "Use default Delphi settings" 3149msgstr "Delphi varsayılan ayarlarını kullan" 3150 3151#: lazarusidestrconsts.dlgoiusedefaultlazarussettings 3152msgid "Use default Lazarus settings" 3153msgstr "Lazarus varsayılan ayarlarını kullan" 3154 3155#: lazarusidestrconsts.dlgoptimizationlevels 3156msgid "Optimization levels" 3157msgstr "Optimizasyon seviyeleri" 3158 3159#: lazarusidestrconsts.dlgotheroptimizations 3160msgid "Other optimizations" 3161msgstr "Diğer optimizasyonlar" 3162 3163#: lazarusidestrconsts.dlgotherunitfiles 3164msgid "Other unit files (-Fu):" 3165msgstr "Diğer birim dosyaları (-Fu):" 3166 3167#: lazarusidestrconsts.dlgoverviewgutterback1color 3168msgid "Background 1" 3169msgstr "Arkaplan 1" 3170 3171#: lazarusidestrconsts.dlgoverviewgutterback2color 3172msgid "Background 2" 3173msgstr "Arkaplan 2" 3174 3175#: lazarusidestrconsts.dlgoverviewguttercolor 3176msgid "Overview Gutter" 3177msgstr "Genel Bakış" 3178 3179#: lazarusidestrconsts.dlgoverviewgutterpagecolor 3180msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor" 3181msgid "Page" 3182msgstr "Sayfa" 3183 3184#: lazarusidestrconsts.dlgoverwriteblock 3185msgid "Overwrite block" 3186msgstr "Üstüne yaz blok" 3187 3188#: lazarusidestrconsts.dlgoverwritedesktop 3189#, object-pascal-format 3190msgid "" 3191"Desktop with the name \"%s\" was found.\n" 3192"Should the old desktop be overwritten?" 3193msgstr "" 3194"\"%s\" adında bir masaüstü bulundu.\n" 3195"Eski masaüstünün üzerine yazılsın mı?" 3196 3197#: lazarusidestrconsts.dlgpalhints 3198msgid "Hints for component palette" 3199msgstr "Bileşen paleti için İpuçları" 3200 3201#: lazarusidestrconsts.dlgpasext 3202msgid "Default Pascal extension" 3203msgstr "Varsayılan Pascal uzantısı" 3204 3205#: lazarusidestrconsts.dlgpasextkeywords 3206msgid "Highlight control statements as keywords" 3207msgstr "Kontrol ifadelerini anahtar kelime olarak vurgulayın" 3208 3209#: lazarusidestrconsts.dlgpasextkeywordsgroup 3210msgid "Extended Pascal Keyword Options" 3211msgstr "Genişletilmiş Pascal Anahtar Kelime Seçenekleri" 3212 3213#: lazarusidestrconsts.dlgpaskeywordsmarkup 3214msgid "Markup (on caret)" 3215msgstr "İşaretle (şapka işareti üzerinde)" 3216 3217#: lazarusidestrconsts.dlgpaskeywordsmatches 3218msgid "Matching Keywords" 3219msgstr "Eşleşen Anahtar Kelimeler" 3220 3221#: lazarusidestrconsts.dlgpaskeywordsoutline 3222msgid "Outline" 3223msgstr "Taslak" 3224 3225#: lazarusidestrconsts.dlgpassoptslinker 3226msgid "Pass options to linker with \"-k\", delimiter is space" 3227msgstr "Seçenekleri \"-k\" ile birleştiriciye geçir, sınırlayıcı boşluktur" 3228 3229#: lazarusidestrconsts.dlgpasstringkeywords 3230msgid "Highlight \"String\" keyword(s)" 3231msgstr "\"String\" anahtar kelimelerini vurgula" 3232 3233#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault 3234msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" 3235msgid "Default" 3236msgstr "Varsayılan" 3237 3238#: lazarusidestrconsts.dlgpasstringkeywordsoptnone 3239msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" 3240msgid "None" 3241msgstr "Yok" 3242 3243#: lazarusidestrconsts.dlgpasstringkeywordsoptstring 3244msgid "Only \"String\"" 3245msgstr "Sadece \"String\"" 3246 3247#: lazarusidestrconsts.dlgpersistentblock 3248msgid "Persistent block" 3249msgstr "Kalıcı blok" 3250 3251#: lazarusidestrconsts.dlgpersistentcursor 3252msgid "Visible caret in unfocused editor" 3253msgstr "Kalıcı imleç" 3254 3255#: lazarusidestrconsts.dlgpersistentcursornoblink 3256msgid "Caret in unfocused editor does not blink" 3257msgstr "Odaklanmamış düzenleyicideki şapka işareti yanıp sönmüyor" 3258 3259#: lazarusidestrconsts.dlgpoansiutf8 3260msgid "ANSI codepage is UTF-8 (Windows 10 1903+)" 3261msgstr "ANSI kod sayfası UTF-8 'dir (Windows 10 1903+)" 3262 3263#: lazarusidestrconsts.dlgpoapplication 3264msgid "Application" 3265msgstr "Uygulama" 3266 3267#: lazarusidestrconsts.dlgpoasinvoker 3268msgid "as invoker (asInvoker)" 3269msgstr "invoker (asInvoker) olarak" 3270 3271#: lazarusidestrconsts.dlgpoclearicon 3272msgid "&Clear Icon" 3273msgstr "&Simgeyi Sil" 3274 3275#: lazarusidestrconsts.dlgpocreateappbundle 3276msgid "Create Application Bundle" 3277msgstr "Uygulama Paketini Oluşturun" 3278 3279#: lazarusidestrconsts.dlgpodebugger 3280msgctxt "lazarusidestrconsts.dlgpodebugger" 3281msgid "Debugger" 3282msgstr "Hata ayıklayıcı" 3283 3284#: lazarusidestrconsts.dlgpodefaulticon 3285msgid "Load &Default" 3286msgstr "Varsayılanı yükle" 3287 3288#: lazarusidestrconsts.dlgpodpiawareness 3289msgid "DPI awareness" 3290msgstr "DPI farkındalığı" 3291 3292#: lazarusidestrconsts.dlgpodpiawarenessoff 3293msgid "off" 3294msgstr "kapalı" 3295 3296#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor 3297msgid "Vista-8: off, 8.1+: per monitor" 3298msgstr "Vista-8: kapalı, 8.1+: monitör başına" 3299 3300#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor 3301msgid "Vista-8: on, 8.1+: per monitor" 3302msgstr "Vista-8: açık, 8.1+: monitör başına" 3303 3304#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2 3305msgid "Vista-8: on, 8.1/10+: per monitor/V2" 3306msgstr "Vista-8: açık, 8.1/10+: monitör başına /V2" 3307 3308#: lazarusidestrconsts.dlgpodpiawarenesson 3309msgid "on" 3310msgstr "on" 3311 3312#: lazarusidestrconsts.dlgpoexecutionlevel 3313msgid "Execution Level" 3314msgstr "Yürütme Seviyesi" 3315 3316#: lazarusidestrconsts.dlgpofroms 3317msgid "Forms" 3318msgstr "Formlar" 3319 3320#: lazarusidestrconsts.dlgpohighestavailable 3321msgid "highest available (highestAvailable)" 3322msgstr "mevcut en yüksek (en yüksek kullanılabilir)" 3323 3324#: lazarusidestrconsts.dlgpoi18n 3325msgid "i18n" 3326msgstr "i18n" 3327 3328#: lazarusidestrconsts.dlgpoicon 3329msgid "Icon:" 3330msgstr "Simge:" 3331 3332#: lazarusidestrconsts.dlgpoicondesc 3333#, object-pascal-format 3334msgid "(size: %d:%d, bpp: %d)" 3335msgstr "(Boyut: %d:%d, bpp: %d)" 3336 3337#: lazarusidestrconsts.dlgpoicondescnone 3338msgid "(none)" 3339msgstr "(Yok)" 3340 3341#: lazarusidestrconsts.dlgpoloadicon 3342msgid "&Load Icon" 3343msgstr "&Simge Yükle" 3344 3345#: lazarusidestrconsts.dlgpolongpathaware 3346msgid "Long path awareness" 3347msgstr "Uzun yol farkındalığı" 3348 3349#: lazarusidestrconsts.dlgpomisc 3350msgctxt "lazarusidestrconsts.dlgpomisc" 3351msgid "Miscellaneous" 3352msgstr "Çeşitli" 3353 3354#: lazarusidestrconsts.dlgporequireadministrator 3355msgid "require administrator (requireAdministrator)" 3356msgstr "yönetici gerektirir (yönetici gerektir)" 3357 3358#: lazarusidestrconsts.dlgporesources 3359msgid "Resources" 3360msgstr "Kaynaklar" 3361 3362#: lazarusidestrconsts.dlgposaveicon 3363msgid "&Save Icon" 3364msgstr "&Simgeyi Kaydet" 3365 3366#: lazarusidestrconsts.dlgposavesession 3367msgid "Session" 3368msgstr "Oturum" 3369 3370#: lazarusidestrconsts.dlgpotitle 3371msgid "Title:" 3372msgstr "Başlık:" 3373 3374#: lazarusidestrconsts.dlgpouiaccess 3375msgid "UI Access (uiAccess)" 3376msgstr "Kullanıcı Arayüz Erişimi (uiAccess)" 3377 3378#: lazarusidestrconsts.dlgpouseappbundle 3379msgid "Use Application Bundle for running and debugging" 3380msgstr "Çalıştırma ve hata ayıklama için Uygulama Paketini kullanın" 3381 3382#: lazarusidestrconsts.dlgpouselclscaling 3383msgid "Use LCL scaling (Hi-DPI)" 3384msgstr "LCL ölçeklendirmesi kullan (Hi-DPI)" 3385 3386#: lazarusidestrconsts.dlgpousemanifest 3387msgid "Use manifest resource (and enable themes)" 3388msgstr "Temaları etkinleştirmek için manifest dosyasını kullanın" 3389 3390#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick 3391msgid "Prefer double-click over single-click" 3392msgstr "Tek tıklamayla çift tıklamayı tercih et" 3393 3394#: lazarusidestrconsts.dlgpriorities 3395msgid "Priorities" 3396msgstr "Öncelikler" 3397 3398#: lazarusidestrconsts.dlgproject 3399msgctxt "lazarusidestrconsts.dlgproject" 3400msgid "Project" 3401msgstr "Proje" 3402 3403#: lazarusidestrconsts.dlgprojectoptions 3404msgid "Project Options" 3405msgstr "Proje Seçenekleri" 3406 3407#: lazarusidestrconsts.dlgprojectoptionsfor 3408#, object-pascal-format 3409msgid "Options for Project: %s" 3410msgstr "Proje Seçenekleri: %s" 3411 3412#: lazarusidestrconsts.dlgprojecttoopenorcreate 3413msgid "Project to Open or Create" 3414msgstr "" 3415 3416#: lazarusidestrconsts.dlgprojfiles 3417msgid "Project Files" 3418msgstr "Proje Dosyaları" 3419 3420#: lazarusidestrconsts.dlgpromptonreplace 3421msgid "&Prompt on replace" 3422msgstr "&Yeniden sor" 3423 3424#: lazarusidestrconsts.dlgpropertycompletion 3425msgid "Property completion" 3426msgstr "Mülk tamamlanması" 3427 3428#: lazarusidestrconsts.dlgpropnamecolor 3429msgid "Property Name" 3430msgstr "Mülkiyet adı" 3431 3432#: lazarusidestrconsts.dlgqopenlastprj 3433msgid "Open last project and packages at start" 3434msgstr "Başlangıçta son proje ve paketleri aç" 3435 3436#: lazarusidestrconsts.dlgqshowborderspacing 3437msgid "Show border spacing" 3438msgstr "Kenar boşluğunu göster" 3439 3440#: lazarusidestrconsts.dlgqshowgrid 3441msgid "Show grid" 3442msgstr "Izgarayı göster" 3443 3444#: lazarusidestrconsts.dlgqsnaptogrid 3445msgid "Snap to grid" 3446msgstr "Izgaraya yapış" 3447 3448#: lazarusidestrconsts.dlgreallydeletedesktop 3449#, object-pascal-format 3450msgid "Really delete desktop \"%s\"?" 3451msgstr "Masaüstünü gerçekten silmek istiyormusunuz \"%s\"?" 3452 3453#: lazarusidestrconsts.dlgreferencecolor 3454msgid "Reference" 3455msgstr "Referans" 3456 3457#: lazarusidestrconsts.dlgregularexpressions 3458msgid "Regular e&xpressions" 3459msgstr "Düzenli ifadeler" 3460 3461#: lazarusidestrconsts.dlgrenamedesktop 3462msgid "Rename desktop" 3463msgstr "Masaüstünü yeniden adlandır" 3464 3465#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption 3466msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption" 3467msgid "Rename" 3468msgstr "Yeniden Adlandır" 3469 3470#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint 3471msgid "Rename selected desktop" 3472msgstr "Seçili masaüstünü yeniden adlandır" 3473 3474#: lazarusidestrconsts.dlgreplaceall 3475msgid "Replace &All" 3476msgstr "&Hepsini değiştir" 3477 3478#: lazarusidestrconsts.dlgreplacewith 3479msgid "Replace wit&h" 3480msgstr "&İle değiştirin" 3481 3482#: lazarusidestrconsts.dlgreport 3483msgid "Report" 3484msgstr "Rapor" 3485 3486#: lazarusidestrconsts.dlgreset 3487msgctxt "lazarusidestrconsts.dlgreset" 3488msgid "Reset" 3489msgstr "Sıfırla" 3490 3491#: lazarusidestrconsts.dlgresetall 3492msgid "Reset all" 3493msgstr "Tümünü sıfırla" 3494 3495#: lazarusidestrconsts.dlgrightbottomclr 3496msgid "Guide lines Right,Bottom" 3497msgstr "Kılavuz çizgiler sağ, alt" 3498 3499#: lazarusidestrconsts.dlgrightclickselects 3500msgid "Right click selects" 3501msgstr "Sağ tıklama" 3502 3503#: lazarusidestrconsts.dlgrightmargin 3504msgid "Right margin" 3505msgstr "Sağ kenar" 3506 3507#: lazarusidestrconsts.dlgroworkingdirectory 3508msgid "Working directory" 3509msgstr "Çalışma dizini" 3510 3511#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren 3512msgid "Select grandchildren" 3513msgstr "Torunları seç" 3514 3515#: lazarusidestrconsts.dlgruberbandcreationcolor 3516msgid "Rubberband Creation" 3517msgstr "Kauçuk Bant Yaratma" 3518 3519#: lazarusidestrconsts.dlgruberbandselectioncolor 3520msgid "Rubberband Selection" 3521msgstr "Kauçuk bant seçimi" 3522 3523#: lazarusidestrconsts.dlgrunninginstancemodalerror 3524#, object-pascal-format 3525msgid "" 3526"The running Lazarus instance cannot accept any files.\n" 3527"Do you want to open them in a new IDE instance?\n" 3528"\n" 3529"%s" 3530msgstr "" 3531"Çalışmakta olan Lazarus da bu dosya açılamaz.\n" 3532"Yeni bir Larzarus da dosya açılsın mı?\n" 3533"\n" 3534"%s" 3535 3536#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror 3537msgid "Lazarus instance is running but not responding." 3538msgstr "Lazarus örneği çalışıyor ancak yanıt vermiyor." 3539 3540#: lazarusidestrconsts.dlgrunodisplay 3541msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" 3542msgstr "Görüntüleme (win32 için değil, ör. 198.112.45.11:0, x.org:1, hydra: 0.1)" 3543 3544#: lazarusidestrconsts.dlgrunoenvironment 3545msgctxt "lazarusidestrconsts.dlgrunoenvironment" 3546msgid "Environment" 3547msgstr "Çevre" 3548 3549#: lazarusidestrconsts.dlgrunolocal 3550msgid "Local" 3551msgstr "Yerel" 3552 3553#: lazarusidestrconsts.dlgrunosystemvariables 3554msgid "System variables" 3555msgstr "Sistem değişkenleri" 3556 3557#: lazarusidestrconsts.dlgrunousedisplay 3558msgid "Use display" 3559msgstr "Görüntüyü kullan" 3560 3561#: lazarusidestrconsts.dlgrunouseroverrides 3562msgid "User overrides" 3563msgstr "Kullanıcı geçersiz kılma" 3564 3565#: lazarusidestrconsts.dlgrunparameters 3566msgid "Run Parameters" 3567msgstr "Parametreleri Çalıştır" 3568 3569#: lazarusidestrconsts.dlgsavecurrentdesktop 3570msgid "Save current desktop" 3571msgstr "Geçerli masaüstünü kaydet" 3572 3573#: lazarusidestrconsts.dlgsavecurrentdesktopas 3574msgid "Save current desktop as" 3575msgstr "Geçerli masaüstünü şu şekilde kaydet" 3576 3577#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption 3578msgid "Save active desktop as ..." 3579msgstr "Aktif masaüstünü farklı kaydet.." 3580 3581#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint 3582msgid "Save active desktop as" 3583msgstr "Aktif masaüstünü farklı kaydet" 3584 3585#: lazarusidestrconsts.dlgsavedlinecolor 3586msgid "Saved line" 3587msgstr "Kaydedilen satır" 3588 3589#: lazarusidestrconsts.dlgsaveeditorinfo 3590msgid "Save editor info for closed files" 3591msgstr "Kapatılan dosyalar için editör bilgisini kaydet" 3592 3593#: lazarusidestrconsts.dlgsaveeditorinfohint 3594msgid "The files are available in the \"Open Recent\" history list." 3595msgstr "Dosyalar \"Son Açılanlar\" geçmiş listesinde bulunur." 3596 3597#: lazarusidestrconsts.dlgsaveeditorinfoproject 3598msgid "Save editor info only for project files" 3599msgstr "Editör bilgilerini yalnızca proje dosyaları için kaydet" 3600 3601#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint 3602msgid "Only files that belong to this project." 3603msgstr "Sadece bu projeye ait dosyalar." 3604 3605#: lazarusidestrconsts.dlgsavein 3606msgid "Save in" 3607msgstr "Kaydet" 3608 3609#: lazarusidestrconsts.dlgscrollbyoneless 3610msgid "Scroll by one less" 3611msgstr "Bir daha kaydırın" 3612 3613#: lazarusidestrconsts.dlgscrollgroupoptions 3614msgid "Scrolling" 3615msgstr "Kaydırma" 3616 3617#: lazarusidestrconsts.dlgscrollhint 3618msgctxt "lazarusidestrconsts.dlgscrollhint" 3619msgid "Show scroll hint" 3620msgstr "Kaydırma ipucunu göster" 3621 3622#: lazarusidestrconsts.dlgscrollpastendfile 3623msgid "Scroll past end of file" 3624msgstr "Dosyanın sonuna kaydır" 3625 3626#: lazarusidestrconsts.dlgscrollpastendline 3627msgid "Allow caret to move past end of line" 3628msgstr "Düzeltme çizgisini çizginin sonundan geçmesine izin ver" 3629 3630#: lazarusidestrconsts.dlgseachdirectorynotfound 3631#, object-pascal-format 3632msgid "Search directory \"%s\" not found." 3633msgstr "Arama dizini \"%s\" bulunamadı." 3634 3635#: lazarusidestrconsts.dlgsearchabort 3636msgid "Search terminated by user." 3637msgstr "Arama kullanıcı tarafından sonlandırıldı." 3638 3639#: lazarusidestrconsts.dlgsearchcaption 3640msgid "Searching ..." 3641msgstr "Arama ..." 3642 3643#: lazarusidestrconsts.dlgsearchpaths 3644msgid "Paths" 3645msgstr "Yollar" 3646 3647#: lazarusidestrconsts.dlgsearchscope 3648msgid "Search scope" 3649msgstr "Arama kapsamı" 3650 3651#: lazarusidestrconsts.dlgselectallchildcontrols 3652msgid "Select all child controls together with their parent." 3653msgstr "Tüm çocuk kontrollerini ebeveynleriyle birlikte seçin." 3654 3655#: lazarusidestrconsts.dlgselectallnoscroll 3656msgid "Do not scroll on Select-All / Paragraph or To-Brace" 3657msgstr "Tümünü Seç / Paragraf veya Küme Ayracı'na kaydırmayın" 3658 3659#: lazarusidestrconsts.dlgselectedtext 3660msgid "&Selected text" 3661msgstr "&Seçili metin" 3662 3663#: lazarusidestrconsts.dlgsetactivedesktopbtncaption 3664msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption" 3665msgid "Set active" 3666msgstr "Aktif et" 3667 3668#: lazarusidestrconsts.dlgsetactivedesktopbtnhint 3669msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint" 3670msgid "Set active" 3671msgstr "Aktif et" 3672 3673#: lazarusidestrconsts.dlgsetallelementdefault 3674msgid "Set all elements to default" 3675msgstr "Tüm öğeleri varsayılana ayarla" 3676 3677#: lazarusidestrconsts.dlgsetelementdefault 3678msgid "Set element to default" 3679msgstr "Öğe değerini varsayılana ayarla" 3680 3681#: lazarusidestrconsts.dlgsetpropertyvariable 3682msgid "Set property Variable" 3683msgstr "Set property Variable" 3684 3685#: lazarusidestrconsts.dlgsetpropertyvariablehint 3686msgid "The parameter name for the default setter procedure." 3687msgstr "Varsayılan ayarlayıcı yordamın parametre adı." 3688 3689#: lazarusidestrconsts.dlgsetpropertyvariableisprefix 3690msgid "is prefix" 3691msgstr "öneki" 3692 3693#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint 3694msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name." 3695msgstr "İşaretliyse, \"Set property Variable\" bir önek. Aksi takdirde sabit bir isimdir." 3696 3697#: lazarusidestrconsts.dlgsetpropertyvariableuseconst 3698msgid "use const" 3699msgstr "const kullan" 3700 3701#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint 3702msgid "If checked, the setter parameter is marked with \"const\"." 3703msgstr "İşaretlenirse, setter parametresi \"const\" ile işaretlenmiştir." 3704 3705#: lazarusidestrconsts.dlgshowallunits 3706msgid "Show all units" 3707msgstr "Tüm birimleri göster" 3708 3709#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals 3710msgid "Show captions of nonvisual components" 3711msgstr "Görsel olmayan bileşenlerin başlıklarını göster" 3712 3713#: lazarusidestrconsts.dlgshowcompiledprocedures 3714msgid "Show compiled procedures" 3715msgstr "Derlenmiş işlemleri göster" 3716 3717#: lazarusidestrconsts.dlgshowcompilinglinenumbers 3718msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" 3719msgid "Show line numbers" 3720msgstr "Satır numaralarını göster" 3721 3722#: lazarusidestrconsts.dlgshowconditionals 3723msgid "Show conditionals" 3724msgstr "Şartları göster" 3725 3726#: lazarusidestrconsts.dlgshowdebuginfo 3727msgid "Show debug info" 3728msgstr "Hata ayıklama bilgilerini göster" 3729 3730#: lazarusidestrconsts.dlgshowdesignerhints 3731msgid "Show designer hints" 3732msgstr "Tasarımcı ipuçlarını göster" 3733 3734#: lazarusidestrconsts.dlgshowdesignerhintshint 3735msgid "Hint shows control's position or size while moving or resizing it." 3736msgstr "İpucu, taşınırken veya yeniden boyutlandırırken kontrolün konumunu veya boyutunu gösterir." 3737 3738#: lazarusidestrconsts.dlgshoweverything 3739msgid "Show everything" 3740msgstr "Her şeyi göster" 3741 3742#: lazarusidestrconsts.dlgshowexecutableinfo 3743msgid "Show executable info (Win32 only)" 3744msgstr "Çalıştırılabilir bilgileri göster (yalnızca Win32)" 3745 3746#: lazarusidestrconsts.dlgshowfilenameincaption 3747msgid "Show file name in caption" 3748msgstr "Dosya adını başlıkta göster" 3749 3750#: lazarusidestrconsts.dlgshowgeneralinfo 3751msgid "Show general info" 3752msgstr "Genel bilgiyi göster" 3753 3754#: lazarusidestrconsts.dlgshowgutterhints 3755msgid "Show gutter hints" 3756msgstr "Kanal ipuçlarını göster" 3757 3758#: lazarusidestrconsts.dlgshowhint 3759msgctxt "lazarusidestrconsts.dlgshowhint" 3760msgid "Show hints" 3761msgstr "İpuçlarını göster" 3762 3763#: lazarusidestrconsts.dlgshowingwindows 3764msgid "Showing Windows" 3765msgstr "Gösterilen Pencereler" 3766 3767#: lazarusidestrconsts.dlgshowlinenumbers 3768msgctxt "lazarusidestrconsts.dlgshowlinenumbers" 3769msgid "Show line numbers" 3770msgstr "Satır numaralarını göster" 3771 3772#: lazarusidestrconsts.dlgshowmessagesicons 3773msgid "Show Messages Icons" 3774msgstr "Mesajlar Simgelerini Göster" 3775 3776#: lazarusidestrconsts.dlgshownotes 3777msgid "Show notes" 3778msgstr "Notları göster" 3779 3780#: lazarusidestrconsts.dlgshowsummary 3781msgid "Show summary" 3782msgstr "Özet göster" 3783 3784#: lazarusidestrconsts.dlgshowtriedfiles 3785msgid "Show tried files" 3786msgstr "Çalıştırılan dosyaları göster" 3787 3788#: lazarusidestrconsts.dlgshowusedfiles 3789msgid "Show used files" 3790msgstr "Kullanılmış dosyaları göster" 3791 3792#: lazarusidestrconsts.dlgshowwarnings 3793msgid "Show warnings" 3794msgstr "Uyarıları göster" 3795 3796#: lazarusidestrconsts.dlgsingletaskbarbutton 3797msgid "Show single button in TaskBar" 3798msgstr "TaskBar'da tek düğmeyi göster" 3799 3800#: lazarusidestrconsts.dlgskipforwardclassdeclarations 3801msgid "Skip forward class declarations" 3802msgstr "İleri sınıf bildirimlerini atla" 3803 3804#: lazarusidestrconsts.dlgslashcommenttab 3805msgid "Slash //" 3806msgstr "Kesme //" 3807 3808#: lazarusidestrconsts.dlgsmarttabs 3809msgid "Smart tabs" 3810msgstr "Akıllı sekmeler" 3811 3812#: lazarusidestrconsts.dlgsmbbehind 3813msgid "Symbol behind (.pp~)" 3814msgstr "Arkasına Sembol ekle (.pp ~)" 3815 3816#: lazarusidestrconsts.dlgsmbcounter 3817msgid "Counter (.pp;1)" 3818msgstr "Sayaç (.pp; 1)" 3819 3820#: lazarusidestrconsts.dlgsmbfront 3821msgid "Symbol in front (.~pp)" 3822msgstr "Önüne sembol ekle (~ ~ pp)" 3823 3824#: lazarusidestrconsts.dlgsnapguidelines 3825msgid "Snap to Guide Lines" 3826msgstr "Kılavuz Çizgilere Yapış" 3827 3828#: lazarusidestrconsts.dlgsnapguidelineshint 3829msgid "When a control is close to being aligned with another control, it snaps to the aligned position." 3830msgstr "Bir denetim başka bir denetimle hizalanmaya çok yakın olduğunda, hizalı konuma oturur." 3831 3832#: lazarusidestrconsts.dlgsourceedittabmultiline 3833msgid "Multiline tabs" 3834msgstr "Çok Satırlı Sekmeler" 3835 3836#: lazarusidestrconsts.dlgspacenotcosmos 3837msgctxt "lazarusidestrconsts.dlgspacenotcosmos" 3838msgid "Space" 3839msgstr "Boşluk" 3840 3841#: lazarusidestrconsts.dlgspbhints 3842msgid "Hints for main speed buttons (open, save, ...)" 3843msgstr "Ana hızlı düğmeler için ipuçları (açık, kaydet ...)" 3844 3845#: lazarusidestrconsts.dlgsrcedit 3846msgctxt "lazarusidestrconsts.dlgsrcedit" 3847msgid "Source Editor" 3848msgstr "Kaynak Düzenleyici" 3849 3850#: lazarusidestrconsts.dlgsrorigin 3851msgid "Origin" 3852msgstr "Köken" 3853 3854#: lazarusidestrconsts.dlgstacksize 3855msgid "Stack size" 3856msgstr "Yığın boyutu" 3857 3858#: lazarusidestrconsts.dlgstatickeyword 3859msgid "Static keyword in objects" 3860msgstr "Nesnelerdeki statik anahtar kelime" 3861 3862#: lazarusidestrconsts.dlgstopafternrerr 3863msgid "Stop after number of errors:" 3864msgstr "Hata sayısından sonra dur:" 3865 3866#: lazarusidestrconsts.dlgstringautoappend 3867msgid "Append text to close string" 3868msgstr "Stringi kapatmak için metin ekle" 3869 3870#: lazarusidestrconsts.dlgstringautoprefix 3871msgid "Prefix string on new line" 3872msgstr "Yeni satıra önek dize" 3873 3874#: lazarusidestrconsts.dlgstringbreakindenttab 3875msgid "String ''" 3876msgstr "String ''" 3877 3878#: lazarusidestrconsts.dlgstringenableautocontinue 3879msgid "Extend strings on linebreak" 3880msgstr "Stringleri satırbaşında uzat" 3881 3882#: lazarusidestrconsts.dlgsubpropcolor 3883msgid "SubProperties" 3884msgstr "Alt özelliklerini" 3885 3886#: lazarusidestrconsts.dlgsyntaxoptions 3887msgid "Syntax options" 3888msgstr "Sözdizimi seçenekleri" 3889 3890#: lazarusidestrconsts.dlgtabindent 3891msgid "Tab indents blocks" 3892msgstr "Sekme girintileri engeller" 3893 3894#: lazarusidestrconsts.dlgtabnumbersnotebook 3895msgid "Show tab numbers in notebook" 3896msgstr "Sekme numaralarını deftere göster" 3897 3898#: lazarusidestrconsts.dlgtabstospaces 3899msgid "Tabs to spaces" 3900msgstr "Sekmeler boşluğu" 3901 3902#: lazarusidestrconsts.dlgtabwidths 3903msgid "Tab widths" 3904msgstr "Sekme genişlikleri" 3905 3906#: lazarusidestrconsts.dlgtargetcpufamily 3907msgid "Target CPU family" 3908msgstr "Hedef CPU ailesi" 3909 3910#: lazarusidestrconsts.dlgtargetos 3911msgctxt "lazarusidestrconsts.dlgtargetos" 3912msgid "Target OS" 3913msgstr "Hedeflenen İşletim Sistemi" 3914 3915#: lazarusidestrconsts.dlgtargetplatform 3916msgid "Target platform" 3917msgstr "Hedef platform" 3918 3919#: lazarusidestrconsts.dlgtargetproc 3920msgid "Target processor" 3921msgstr "Hedef işlemci" 3922 3923#: lazarusidestrconsts.dlgtargetspecificoptions 3924msgid "Target-specific options" 3925msgstr "Hedefe özel seçenekler" 3926 3927#: lazarusidestrconsts.dlgtestprjdir 3928msgid "Directory for building test projects" 3929msgstr "Test projeleri hazırlama klasörü" 3930 3931#: lazarusidestrconsts.dlgtextstyle 3932msgid "Text-Style" 3933msgstr "Yazı Stili" 3934 3935#: lazarusidestrconsts.dlgtexttofind 3936msgid "&Text to find" 3937msgstr "&Bulunacak metin" 3938 3939#: lazarusidestrconsts.dlgthiselementusescolor 3940msgid "The element uses (and edits) the schemes:" 3941msgstr "Öğe, şemaları kullanır (ve düzenler):" 3942 3943#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption 3944msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption" 3945msgid "Toggle as debug desktop" 3946msgstr "Masaüstünde hata ayıklama ayarı olarak değiştir" 3947 3948#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint 3949msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint" 3950msgid "Toggle as debug desktop" 3951msgstr "Masaüstünde hata ayıklama ayarı olarak değiştir" 3952 3953#: lazarusidestrconsts.dlgtopinfohint 3954msgid "Current Class/Proc Hint" 3955msgstr "Geçerli Sınıf / Proc İpucu" 3956 3957#: lazarusidestrconsts.dlgtrimspacetypecaption 3958msgid "Trim spaces style" 3959msgstr "Döşeme boşlukları stili" 3960 3961#: lazarusidestrconsts.dlgtrimspacetypecaretmove 3962msgid "Caret or Edit" 3963msgstr "Şapka işareti veya Düzenle" 3964 3965#: lazarusidestrconsts.dlgtrimspacetypeeditline 3966msgid "Line Edited" 3967msgstr "Satır Düzenlendi" 3968 3969#: lazarusidestrconsts.dlgtrimspacetypeleaveline 3970msgid "Leave line" 3971msgstr "Satır bırak" 3972 3973#: lazarusidestrconsts.dlgtrimspacetypeposonly 3974msgid "Position Only" 3975msgstr "Sadece Pozisyon" 3976 3977#: lazarusidestrconsts.dlgtrimtrailingspaces 3978msgid "Trim trailing spaces" 3979msgstr "Arka boşlukları süsleyin" 3980 3981#: lazarusidestrconsts.dlgundoaftersave 3982msgid "Undo after save" 3983msgstr "Kaydettikten sonra geri al" 3984 3985#: lazarusidestrconsts.dlgundogroupoptions 3986msgid "Undo / Redo" 3987msgstr "Geri Al/İleri al" 3988 3989#: lazarusidestrconsts.dlgundolimit 3990msgid "Undo limit" 3991msgstr "Sınırı geri al" 3992 3993#: lazarusidestrconsts.dlgunitdepcaption 3994msgctxt "lazarusidestrconsts.dlgunitdepcaption" 3995msgid "Unit Dependencies" 3996msgstr "Birim Bağımlılıkları" 3997 3998#: lazarusidestrconsts.dlgunitdeprefresh 3999msgid "Refresh" 4000msgstr "Yenile" 4001 4002#: lazarusidestrconsts.dlgunitoutp 4003msgid "Unit output directory (-FU):" 4004msgstr "Birim çıkış dizini (-FU):" 4005 4006#: lazarusidestrconsts.dlgunsavedlinecolor 4007msgid "Unsaved line" 4008msgstr "Kaydedilmemiş satır" 4009 4010#: lazarusidestrconsts.dlgusecodefolding 4011msgid "Code Folding" 4012msgstr "Kod Katlama" 4013 4014#: lazarusidestrconsts.dlgusecustomconfig 4015msgid "Use additional compiler config file" 4016msgstr "Ek derleyici yapılandırma dosyası kullanın" 4017 4018#: lazarusidestrconsts.dlgusedividerdraw 4019msgid "Divider Drawing" 4020msgstr "Bölücü Çizimi" 4021 4022#: lazarusidestrconsts.dlgusefpccfg 4023msgid "Use standard compiler config file (fpc.cfg)" 4024msgstr "Standart derleyici yapılandırma dosyasını (fpc.cfg) kullanın" 4025 4026#: lazarusidestrconsts.dlgusehighlight 4027msgid "Use Highlight" 4028msgstr "Vurgulamayı Kullan" 4029 4030#: lazarusidestrconsts.dlguseiconsincompletionbox 4031msgid "Icons in code completion box" 4032msgstr "Kod tamamlama kutusunda simgeler" 4033 4034#: lazarusidestrconsts.dlguselaunchingapp 4035msgid "Use launching application" 4036msgstr "Başlatma uygulaması kullan" 4037 4038#: lazarusidestrconsts.dlguseminimumime 4039msgid "IME handled by System" 4040msgstr "Sistem tarafından işlenen IME" 4041 4042#: lazarusidestrconsts.dlguserschemeerror 4043#, object-pascal-format 4044msgid "Failed to load user-scheme file %s" 4045msgstr "%s kullanıcı şeması dosyası yüklenemedi" 4046 4047#: lazarusidestrconsts.dlguseschemedefaults 4048msgid "- Scheme globals -" 4049msgstr "- Global Şema -" 4050 4051#: lazarusidestrconsts.dlguseschemelocal 4052msgid "selected language" 4053msgstr "dil seçin" 4054 4055#: lazarusidestrconsts.dlgusesyntaxhighlight 4056msgid "Use syntax highlight" 4057msgstr "Sözdizimi vurgulamayı kullan" 4058 4059#: lazarusidestrconsts.dlgusetabshistory 4060msgid "Use tab history when closing tabs" 4061msgstr "Sekmeleri kapatırken sekme geçmişi kullanın" 4062 4063#: lazarusidestrconsts.dlguseunitcaption 4064msgid "Add unit to Uses section" 4065msgstr "Uses alanına birim ekle" 4066 4067#: lazarusidestrconsts.dlgvaluecolor 4068msgctxt "lazarusidestrconsts.dlgvaluecolor" 4069msgid "Value" 4070msgstr "Değer" 4071 4072#: lazarusidestrconsts.dlgverbosity 4073msgid "Verbosity during compilation:" 4074msgstr "Derleme Sırasındaki Ayrıntılılık:" 4075 4076#: lazarusidestrconsts.dlgvisiblegutter 4077msgid "Visible gutter" 4078msgstr "Oluk görünsün" 4079 4080#: lazarusidestrconsts.dlgvisiblerightmargin 4081msgid "Visible right margin" 4082msgstr "Sağ kenar boşluğu görünsün" 4083 4084#: lazarusidestrconsts.dlgwholewordsonly 4085msgid "&Whole words only" 4086msgstr "&Sadece butun kelimeler" 4087 4088#: lazarusidestrconsts.dlgwidthpos 4089msgid "Width:" 4090msgstr "Genişlik:" 4091 4092#: lazarusidestrconsts.dlgwin32guiapp 4093msgid "Win32 gui application" 4094msgstr "Win32 gui uygulaması" 4095 4096#: lazarusidestrconsts.dlgwindow 4097msgctxt "lazarusidestrconsts.dlgwindow" 4098msgid "Window" 4099msgstr "Pencere" 4100 4101#: lazarusidestrconsts.dlgwordexceptions 4102msgid "Exceptions" 4103msgstr "İstisnalar" 4104 4105#: lazarusidestrconsts.dlgwordspolicies 4106msgctxt "lazarusidestrconsts.dlgwordspolicies" 4107msgid "Words" 4108msgstr "Kelimeler" 4109 4110#: lazarusidestrconsts.dlgwrdpreview 4111msgctxt "lazarusidestrconsts.dlgwrdpreview" 4112msgid "Preview" 4113msgstr "Önizleme" 4114 4115#: lazarusidestrconsts.dlgwritefpclogo 4116msgid "Write FPC logo" 4117msgstr "FPC logosu yaz" 4118 4119#: lazarusidestrconsts.fdinvalidmultiselectiontext 4120msgid "Multiselected components must be of a single form." 4121msgstr "Çok seçimli bileşenler tek bir formda olmalıdır." 4122 4123#: lazarusidestrconsts.fdmalignmenu 4124msgid "Align ..." 4125msgstr "Hizala ..." 4126 4127#: lazarusidestrconsts.fdmdeleteselection 4128msgid "Delete Selection" 4129msgstr "Seçimi Sil" 4130 4131#: lazarusidestrconsts.fdmmirrorhorizontal 4132msgid "Mirror Horizontal" 4133msgstr "Ayna Yatay" 4134 4135#: lazarusidestrconsts.fdmmirrorvertical 4136msgid "Mirror Vertical" 4137msgstr "Ayna Dikey" 4138 4139#: lazarusidestrconsts.fdmorderbackone 4140msgid "Back One" 4141msgstr "Geri Bir" 4142 4143#: lazarusidestrconsts.fdmorderforwardone 4144msgid "Forward One" 4145msgstr "Bir İleri" 4146 4147#: lazarusidestrconsts.fdmordermovetoback 4148msgid "Move to Back" 4149msgstr "Geri Taşı" 4150 4151#: lazarusidestrconsts.fdmordermovetofront 4152msgid "Move to Front" 4153msgstr "Öne Taşı" 4154 4155#: lazarusidestrconsts.fdmresetmenu 4156msgid "Reset ..." 4157msgstr "Sıfırla ..." 4158 4159#: lazarusidestrconsts.fdmsaveformasxml 4160msgid "Save Form as XML" 4161msgstr "Formu XML Olarak Kaydedin" 4162 4163#: lazarusidestrconsts.fdmscalemenu 4164msgid "Scale ..." 4165msgstr "Ölçek ..." 4166 4167#: lazarusidestrconsts.fdmscaleword 4168msgid "Scale" 4169msgstr "Ölçek" 4170 4171#: lazarusidestrconsts.fdmselectall 4172msgctxt "lazarusidestrconsts.fdmselectall" 4173msgid "Select All" 4174msgstr "Hepsini seç" 4175 4176#: lazarusidestrconsts.fdmsizemenu 4177msgid "Size ..." 4178msgstr "Boyut ..." 4179 4180#: lazarusidestrconsts.fdmsizeword 4181msgid "Size" 4182msgstr "Boyut" 4183 4184#: lazarusidestrconsts.fdmsnaptogridoption 4185msgid "Option: Snap to grid" 4186msgstr "Opsiyon: Izgaraya yapış" 4187 4188#: lazarusidestrconsts.fdmsnaptoguidelinesoption 4189msgid "Option: Snap to guide lines" 4190msgstr "Opsiyon: Kılavuz çizgilerine sabitler" 4191 4192#: lazarusidestrconsts.fdmzorder 4193msgid "Z-order" 4194msgstr "Z-sırası" 4195 4196#: lazarusidestrconsts.gldhighlightbothsidesofcursor 4197msgid "On Both Sides" 4198msgstr "İki tarafta da" 4199 4200#: lazarusidestrconsts.histdlgbtnclearhint 4201msgid "Clear all snapshots" 4202msgstr "Tüm görüntüleri temizle" 4203 4204#: lazarusidestrconsts.histdlgbtnenablehint 4205msgid "Toggle view snapshot or current" 4206msgstr "Görüntü anlık görüntüsünü veya güncelliğini değiştir" 4207 4208#: lazarusidestrconsts.histdlgbtnmakesnaphint 4209msgid "Take Snapshot" 4210msgstr "Ekran görüntüsü al" 4211 4212#: lazarusidestrconsts.histdlgbtnpowerhint 4213msgid "Switch on/off automatic snapshots" 4214msgstr "Otomatik anlık görüntüleri açma / kapatma" 4215 4216#: lazarusidestrconsts.histdlgbtnremovehint 4217msgid "Remove selected entry" 4218msgstr "Seçilen girdiyi kaldır" 4219 4220#: lazarusidestrconsts.histdlgbtnshowhisthint 4221msgid "View history" 4222msgstr "Geçmişi görüntüle" 4223 4224#: lazarusidestrconsts.histdlgbtnshowsnaphint 4225msgid "View Snapshots" 4226msgstr "Fotoğrafları Görüntüle" 4227 4228#: lazarusidestrconsts.histdlgcolumnloc 4229msgctxt "lazarusidestrconsts.histdlgcolumnloc" 4230msgid "Location" 4231msgstr "Yer" 4232 4233#: lazarusidestrconsts.histdlgcolumntime 4234msgid "Time" 4235msgstr "Zaman" 4236 4237#: lazarusidestrconsts.histdlgformname 4238msgctxt "lazarusidestrconsts.histdlgformname" 4239msgid "History" 4240msgstr "Geçmiş" 4241 4242#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi 4243msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." 4244msgstr "0 = hayır, 1 = sadece en üst seviye için ayırıcı çizgi çiz, 2 = ilk iki seviye için çizgi çiz, ..." 4245 4246#: lazarusidestrconsts.lisa2paddfiles 4247msgid "Add Files" 4248msgstr "Dosya Ekle" 4249 4250#: lazarusidestrconsts.lisa2pambiguousancestortype 4251msgid "Ambiguous Ancestor Type" 4252msgstr "Belirsiz ata Türü" 4253 4254#: lazarusidestrconsts.lisa2pambiguousclassname 4255msgid "Ambiguous Class Name" 4256msgstr "Belirsiz Sınıf Adı" 4257 4258#: lazarusidestrconsts.lisa2pambiguousunitname 4259msgid "Ambiguous Unit Name" 4260msgstr "Belirsiz Birim Adı" 4261 4262#: lazarusidestrconsts.lisa2pancestortype 4263msgid "Ancestor type" 4264msgstr "Ata türü" 4265 4266#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas 4267msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" 4268msgid "A Pascal unit must have the extension .pp or .pas" 4269msgstr "Bir Pascal biriminin uzantısı .pp veya .pas olmalıdır" 4270 4271#: lazarusidestrconsts.lisa2pbrokendependencies 4272msgid "Broken Dependencies" 4273msgstr "Kırık Bağımlılıklar" 4274 4275#: lazarusidestrconsts.lisa2pclassnamealreadyexists 4276msgid "Class Name already exists" 4277msgstr "Sınıf Adı Zaten Var" 4278 4279#: lazarusidestrconsts.lisa2pcreatenewcomp 4280msgid "Create New Component" 4281msgstr "Yeni Bileşen Oluştur" 4282 4283#: lazarusidestrconsts.lisa2pcreatenewfile 4284msgid "Create New File" 4285msgstr "Yeni Dosya Oluştur" 4286 4287#: lazarusidestrconsts.lisa2pcreatenewreq 4288msgid "Create New Requirement" 4289msgstr "Yeni Gereksinim Oluştur" 4290 4291#: lazarusidestrconsts.lisa2pdependency 4292msgid "Dependency" 4293msgstr "Bağımlılık" 4294 4295#: lazarusidestrconsts.lisa2pdirectoryforunitfile 4296msgid "Directory for unit file:" 4297msgstr "Birim dosyası için Dizin:" 4298 4299#: lazarusidestrconsts.lisa2pexistingfile2 4300#, object-pascal-format 4301msgid "Existing file: \"%s\"" 4302msgstr "Varolan dosya: \"%s\"" 4303 4304#: lazarusidestrconsts.lisa2pfilealreadyexists 4305msgid "File already exists" 4306msgstr "Dosya zaten mevcut" 4307 4308#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage 4309#, object-pascal-format 4310msgid "File \"%s\" already exists in the package." 4311msgstr "Pakette \"%s\" dosyası zaten var." 4312 4313#: lazarusidestrconsts.lisa2pfileisused 4314msgid "File is used" 4315msgstr "Dosya kullanılır" 4316 4317#: lazarusidestrconsts.lisa2pfilename2 4318msgid "Filename/URL" 4319msgstr "Dosya adı/URL" 4320 4321#: lazarusidestrconsts.lisa2pfilenotunit 4322msgid "File not unit" 4323msgstr "Dosya birim değil" 4324 4325#: lazarusidestrconsts.lisa2picon24x24 4326msgid "Icon 24x24:" 4327msgstr "Simge 24x24:" 4328 4329#: lazarusidestrconsts.lisa2picon36x36 4330msgid "Icon 36x36:" 4331msgstr "Simge 36x36:" 4332 4333#: lazarusidestrconsts.lisa2picon48x48 4334msgid "Icon 48x48:" 4335msgstr "Simge 48x48:" 4336 4337#: lazarusidestrconsts.lisa2pinvalidancestortype 4338msgid "Invalid Ancestor Type" 4339msgstr "Geçersiz Ata Türü" 4340 4341#: lazarusidestrconsts.lisa2pinvalidcirculardependency 4342msgid "Invalid Circular Dependency" 4343msgstr "Geçersiz Dairesel Bağımlılık" 4344 4345#: lazarusidestrconsts.lisa2pinvalidclassname 4346msgid "Invalid Class Name" 4347msgstr "Geçersiz Sınıf Adı" 4348 4349#: lazarusidestrconsts.lisa2pinvalidfile 4350msgid "Invalid file" 4351msgstr "Geçersiz dosya" 4352 4353#: lazarusidestrconsts.lisa2pinvalidfilename 4354msgid "Invalid filename" 4355msgstr "Geçersiz dosya adı" 4356 4357#: lazarusidestrconsts.lisa2pinvalidunitname 4358msgid "Invalid Unit Name" 4359msgstr "Geçersiz Ünite Adı" 4360 4361#: lazarusidestrconsts.lisa2pisnotavalidunitname 4362#, object-pascal-format 4363msgid "\"%s\" is not a valid unit name." 4364msgstr "\"%s\" geçerli bir birim adı değil." 4365 4366#: lazarusidestrconsts.lisa2pnewclassname 4367msgid "New class name:" 4368msgstr "Yeni sınıf adı:" 4369 4370#: lazarusidestrconsts.lisa2pnewfile 4371msgid "New File" 4372msgstr "Yeni dosya" 4373 4374#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting 4375#, object-pascal-format 4376msgid "No package found for dependency \"%s\".%sPlease choose an existing package." 4377msgstr "Bağımlılık \"%s\" için paket bulunamadı. %s Lütfen mevcut bir paketi seçin." 4378 4379#: lazarusidestrconsts.lisa2ppackageorproject 4380msgid "Package/Project" 4381msgstr "Paket/Proje" 4382 4383#: lazarusidestrconsts.lisa2ppagenametoolong 4384msgid "Page Name too long" 4385msgstr "Sayfa Adı çok uzun" 4386 4387#: lazarusidestrconsts.lisa2ppalettepage 4388msgid "Palette page:" 4389msgstr "Palet Sayfası:" 4390 4391#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas 4392msgid "Pascal units must have the extension .pp or .pas" 4393msgstr "Pascal birimlerinin uzantısı .pp veya .pas olmalıdır" 4394 4395#: lazarusidestrconsts.lisa2pshortenorexpandfilename 4396msgid "Shorten or expand filename" 4397msgstr "Dosya adını kısaltın veya genişletin" 4398 4399#: lazarusidestrconsts.lisa2pshowall 4400msgctxt "lazarusidestrconsts.lisa2pshowall" 4401msgid "Show all" 4402msgstr "Tümünü göster" 4403 4404#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit 4405#, object-pascal-format 4406msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." 4407msgstr "\"%s\" ata tipi,%s ile aynı ada sahip, \"%s\" birimi." 4408 4409#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier 4410#, object-pascal-format 4411msgid "The ancestor type \"%s\" is not a valid Pascal identifier." 4412msgstr "Ata türü \"%s\" geçerli bir Pascal tanımlayıcı değil." 4413 4414#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame 4415#, object-pascal-format 4416msgid "The class name \"%s\" and ancestor type \"%s\" are the same." 4417msgstr "Sınıf adı \"%s\" ve ata türü \"%s\" aynı." 4418 4419#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile 4420#, object-pascal-format 4421msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" 4422msgstr "Sınıf adı \"%s\" zaten %s içinde bulunuyor Paket %s%sDosya: \"%s\"\"" 4423 4424#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit 4425#, object-pascal-format 4426msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." 4427msgstr "Sınıf adı \"%s\", %s birim \"%s\" ile aynı adı taşıyor." 4428 4429#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier 4430#, object-pascal-format 4431msgid "The class name \"%s\" is not a valid Pascal identifier." 4432msgstr "Sınıf adı \"%s\" geçerli bir Pascal tanımlayıcı değil." 4433 4434#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea 4435#, object-pascal-format 4436msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." 4437msgstr "\"%s\" dosyası mevcut projenin bir parçası.%s Projeler ve paketler arasında dosya paylaşmak kötü bir fikir." 4438 4439#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename 4440#, object-pascal-format 4441msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path." 4442msgstr "\"%s\" dosya adı belirsizdir, çünkü paket henüz varsayılan bir dizine sahip değildir.%s Lütfen tam yolu olan bir dosya adı belirtin." 4443 4444#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor 4445#, object-pascal-format 4446msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" 4447msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4448msgstr "\"%s\" Maksimum Sürümü geçersiz.%s Lütfen major.minor.release.build%s biçimini kullanın. Örneğin: 1.0.20.10" 4449 4450#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion 4451msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" 4452msgid "The Maximum Version is lower than the Minimim Version." 4453msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür." 4454 4455#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor 4456#, object-pascal-format 4457msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" 4458msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4459msgstr "\"%s\" Minimum Sürümü geçersiz.%s Lütfen major.minor.release.build%s biçimini kullanın. Örneğin: 1.0.20.10" 4460 4461#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe 4462#, object-pascal-format 4463msgid "The package already has a dependency on the package \"%s\"." 4464msgstr "Paket zaten \"%s\" paketine bağımlı." 4465 4466#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars 4467#, object-pascal-format 4468msgid "The page name \"%s\" is too long (max 100 chars)." 4469msgstr "Sayfa adı \"%s\" çok uzun (en fazla 100 karakter)." 4470 4471#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage 4472#, object-pascal-format 4473msgid "The unitname \"%s\" already exists in the package:%s%s" 4474msgstr "\"%s\" birim adı zaten pakette mevcut: %s %s" 4475 4476#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage 4477#, object-pascal-format 4478msgid "The unitname \"%s\" already exists in this package." 4479msgstr "\"%s\" birim adı bu pakette zaten mevcut." 4480 4481#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer 4482#, object-pascal-format 4483msgid "The unit name \"%s\"%sand filename \"%s\" differ." 4484msgstr "Birim adı \"%s\"%s ve dosya adı \"%s\"farklı." 4485 4486#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent 4487#, object-pascal-format 4488msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." 4489msgstr "\"%s\" birim adı kayıtlı bir bileşen ile aynıdır.%sBunu kullanmak garip hataya neden olabilir." 4490 4491#: lazarusidestrconsts.lisa2punitname 4492msgid "Unit name:" 4493msgstr "Birim Adı:" 4494 4495#: lazarusidestrconsts.lisa2punitnamealreadyexists 4496msgid "Unitname already exists" 4497msgstr "Birim adı zaten var" 4498 4499#: lazarusidestrconsts.lisabandonchanges 4500msgid "Abandon changes?" 4501msgstr "Değişikliklerden vazgeçilsin mi?" 4502 4503#: lazarusidestrconsts.lisabort 4504msgctxt "lazarusidestrconsts.lisabort" 4505msgid "Abort" 4506msgstr "İptal" 4507 4508#: lazarusidestrconsts.lisabortall 4509msgid "Abort all" 4510msgstr "Hepsini iptal et" 4511 4512#: lazarusidestrconsts.lisabortallloading 4513msgid "Abort all loading" 4514msgstr "Tüm yüklemeyi iptal et" 4515 4516#: lazarusidestrconsts.lisaborted 4517msgid "Aborted" 4518msgstr "Yoksay" 4519 4520#: lazarusidestrconsts.lisabortloadingproject 4521msgid "Abort loading project" 4522msgstr "Yükleme projesini iptal et" 4523 4524#: lazarusidestrconsts.lisabortwholeloading 4525msgid "Abort whole loading" 4526msgstr "Tüm yüklemeyi iptal et" 4527 4528#: lazarusidestrconsts.lisabout 4529msgctxt "lazarusidestrconsts.lisabout" 4530msgid "About" 4531msgstr "Hakkında" 4532 4533#: lazarusidestrconsts.lisabout2 4534#, object-pascal-format 4535msgid "About %s" 4536msgstr "%s Hakkında" 4537 4538#: lazarusidestrconsts.lisaboutdocumentation 4539msgid "Documentation:" 4540msgstr "Belgeler:" 4541 4542#: lazarusidestrconsts.lisaboutide 4543msgid "About IDE" 4544msgstr "IDE Hakkında" 4545 4546#: lazarusidestrconsts.lisaboutlazarus 4547msgid "About Lazarus" 4548msgstr "Lazarus Hakkında" 4549 4550#: lazarusidestrconsts.lisaboutlazarusmsg 4551#, object-pascal-format, fuzzy 4552#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." 4553msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers." 4554msgstr "Lisans: GPL / LGPL. Lisans ayrıntıları için Lazarus ve Free Pascal kaynaklarına bakınız.%s Lazarus, Free Pascal ile grafiksel ve konsollu uygulamalar oluşturmak için bir IDE'dir. Free Pascal Windows, Linux, Mac OS X, FreeBSD ve daha fazlası üzerinde çalışan Pascal ve Object Pascal derleyicisidir.%s Lazarus, bir Delphi gibi yukarıdaki platformların tümü için programlar geliştirmenize izin verecek yapbozun eksik kısmıdır. ortamı. IDE, bir form tasarımcısı içeren bir RAD aracıdır.%s Lazarus büyüdükçe daha fazla geliştiriciye ihtiyacımız var." 4555 4556#: lazarusidestrconsts.lisaboutnocontributors 4557msgid "Cannot find contributors list." 4558msgstr "Katkıda bulunanların listesi bulunamadı." 4559 4560#: lazarusidestrconsts.lisaboutofficial 4561msgid "Official:" 4562msgstr "Resmi:" 4563 4564#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen 4565#, object-pascal-format 4566msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it." 4567msgstr "%s TControl'leri tutamıyor %sSadece görsel olmayan bileşenleri koyabilirsiniz." 4568 4569#: lazarusidestrconsts.lisacknowledgements 4570msgid "Acknowledgements" 4571msgstr "Teşekkür" 4572 4573#: lazarusidestrconsts.lisaction 4574msgid "Action:" 4575msgstr "Aksiyon:" 4576 4577#: lazarusidestrconsts.lisactions 4578msgid "Actions:" 4579msgstr "Eylemler:" 4580 4581#: lazarusidestrconsts.lisactivate 4582msgid "Activate" 4583msgstr "Etkinleştir" 4584 4585#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme 4586msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" 4587msgstr "Metin ve değiştirme için normal ifade sözdizimini etkinleştir (perl'e benzemektedir)" 4588 4589#: lazarusidestrconsts.lisactivateselected 4590msgid "Activate Selected" 4591msgstr "Seçiliyi Aktif et" 4592 4593#: lazarusidestrconsts.lisactive 4594msgid "Active" 4595msgstr "Aktif" 4596 4597#: lazarusidestrconsts.lisactivefilter 4598msgid "Active Filter" 4599msgstr "Aktif Filtre" 4600 4601#: lazarusidestrconsts.lisadd 4602msgctxt "lazarusidestrconsts.lisadd" 4603msgid "Add" 4604msgstr "Ekle" 4605 4606#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem 4607msgid "Add a new separator above selected item" 4608msgstr "Seçili öğenin üstüne yeni bir ayırıcı ekle" 4609 4610#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem 4611msgid "Add a new separator below selected item" 4612msgstr "Seçili öğenin altına yeni bir ayırıcı ekle" 4613 4614#: lazarusidestrconsts.lisadddelphidefine 4615msgid "Add defines simulating Delphi7" 4616msgstr "Delphi7'yi simüle eden tanımları ekleyin" 4617 4618#: lazarusidestrconsts.lisadddelphidefinehint 4619msgid "Useful when the code has checks for supported compiler versions" 4620msgstr "Kod, desteklenen derleyici sürümlerini denetlediğinde kullanışlıdır" 4621 4622#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource 4623#, object-pascal-format 4624msgid "Added missing object \"%s\" to pascal source." 4625msgstr "Pascal kaynağına eksik nesne \"%s\" eklendi." 4626 4627#: lazarusidestrconsts.lisaddedpropertysfors 4628#, object-pascal-format 4629msgid "Added property \"%s\" for %s." 4630msgstr "%s için \"%s\" özelliği eklendi." 4631 4632#: lazarusidestrconsts.lisaddfcutf8 4633msgid "Add -FcUTF8" 4634msgstr "Ekle -FcUTF8" 4635 4636#: lazarusidestrconsts.lisaddfcutf8hint 4637msgid "May be needed if source files have non-ansistring literals." 4638msgstr "Kaynak dosyalarda ansistring olmayan harfler varsa, gerekli olabilir." 4639 4640#: lazarusidestrconsts.lisaddfilter 4641msgid "Add Filter ..." 4642msgstr "Filtre Ekle ..." 4643 4644#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage 4645msgid "Addition does not fit the current message" 4646msgstr "Ekleme mevcut mesaja uymuyor" 4647 4648#: lazarusidestrconsts.lisadditionfitsthecurrentmessage 4649msgid "Addition fits the current message" 4650msgstr "Ekleme mevcut mesaja uyuyor" 4651 4652#: lazarusidestrconsts.lisadditions 4653msgid "Additions" 4654msgstr "Ekler" 4655 4656#: lazarusidestrconsts.lisaddkeyworddo 4657msgid "Add keyword \"do\"" 4658msgstr "Anahtar kelime ekle \"do\"" 4659 4660#: lazarusidestrconsts.lisaddmodifieroverload 4661msgid "Add modifier \"overload\"" 4662msgstr "\"Aşırı yük\" değiştiricisini ekle" 4663 4664#: lazarusidestrconsts.lisaddmodifieroverride 4665msgid "Add modifier \"override\"" 4666msgstr "\"Geçersiz kıl\" değiştiricisini ekle" 4667 4668#: lazarusidestrconsts.lisaddmodifierreintroduce 4669msgid "Add modifier \"reintroduce\"" 4670msgstr "\"Yeniden tanıt\" değiştiricisini ekle" 4671 4672#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom 4673#, object-pascal-format 4674msgid "Add new build mode, copying settings from \"%s\"" 4675msgstr "Ayarları \"%s\" den kopyalarken yeni yapı modu ekle" 4676 4677#: lazarusidestrconsts.lisaddnewmacro 4678msgid "Add new macro" 4679msgstr "Yeni makro ekle" 4680 4681#: lazarusidestrconsts.lisaddnewset 4682msgid "Add new set" 4683msgstr "Yeni küme ekle" 4684 4685#: lazarusidestrconsts.lisaddpackagerequirement 4686msgid "Add package requirement?" 4687msgstr "Paket gereksinimi eklensin mi?" 4688 4689#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui 4690msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)." 4691msgstr "yüklü paketlerin listesine paket (ler) ekleyin (IDE'yi yeniden oluşturmak için --build-ide ile birleştirin)." 4692 4693#: lazarusidestrconsts.lisaddpackagetoproject2 4694msgid "Add package to project" 4695msgstr "Paketi projeye ekle" 4696 4697#: lazarusidestrconsts.lisaddparameterbrackets 4698msgid "Add parameter brackets" 4699msgstr "Parametre parantezleri ekle" 4700 4701#: lazarusidestrconsts.lisaddress 4702msgid "Address:" 4703msgstr "Adres:" 4704 4705#: lazarusidestrconsts.lisaddressbreakpoint 4706msgctxt "lazarusidestrconsts.lisaddressbreakpoint" 4707msgid "&Address Breakpoint ..." 4708msgstr "&Adres kesme noktası ..." 4709 4710#: lazarusidestrconsts.lisaddtoincludesearchpath 4711msgid "Add to include search path?" 4712msgstr "Arama yolunu dahil etmek için ekle?" 4713 4714#: lazarusidestrconsts.lisaddtoproject 4715#, object-pascal-format 4716msgid "Add %s to project?" 4717msgstr "%s projeye ekle?" 4718 4719#: lazarusidestrconsts.lisaddtostartupcomponents 4720msgid "Add to startup components?" 4721msgstr "Başlangıç bileşenlerine ekle?" 4722 4723#: lazarusidestrconsts.lisaddtounitsearchpath 4724msgid "Add to unit search path?" 4725msgstr "Birim arama yoluna ekle?" 4726 4727#: lazarusidestrconsts.lisaddunitinterfaces 4728msgid "Add unit interfaces" 4729msgstr "Birim arabirimleri ekle" 4730 4731#: lazarusidestrconsts.lisaddunitnotrecommended 4732msgid "Add unit (not recommended)" 4733msgstr "Birim ekle (önerilmez)" 4734 4735#: lazarusidestrconsts.lisaddvaluetomacro 4736#, object-pascal-format 4737msgid "Add value to macro %s" 4738msgstr "Makro %s için değer ekle" 4739 4740#: lazarusidestrconsts.lisaf2paddfiletoapackage 4741msgid "Add File to Package" 4742msgstr "Dosyayı Pakete Ekle" 4743 4744#: lazarusidestrconsts.lisaf2pdestinationpackage 4745msgid "Destination package" 4746msgstr "Hedef paket" 4747 4748#: lazarusidestrconsts.lisaf2pfiletype 4749msgid "File type" 4750msgstr "Dosya tipi" 4751 4752#: lazarusidestrconsts.lisaf2pinvalidpackage 4753msgid "Invalid Package" 4754msgstr "Geçersiz Paket" 4755 4756#: lazarusidestrconsts.lisaf2pinvalidpackageid 4757#, object-pascal-format 4758msgid "Invalid package ID: \"%s\"" 4759msgstr "Geçersiz paket kimliği: \"%s\"" 4760 4761#: lazarusidestrconsts.lisaf2ppackageisreadonly 4762msgid "Package is read only" 4763msgstr "Paket salt okunur" 4764 4765#: lazarusidestrconsts.lisaf2ppackagenotfound 4766#, object-pascal-format 4767msgid "Package \"%s\" not found." 4768msgstr "Paket \"%s\" bulunamadı." 4769 4770#: lazarusidestrconsts.lisaf2pshowall 4771msgctxt "lazarusidestrconsts.lisaf2pshowall" 4772msgid "Show all" 4773msgstr "Tümünü göster" 4774 4775#: lazarusidestrconsts.lisaf2pthepackageisreadonly 4776#, object-pascal-format 4777msgid "The package %s is read only." 4778msgstr "%s paketi salt okunur." 4779 4780#: lazarusidestrconsts.lisafilealreadyexistsreplaceit 4781#, object-pascal-format 4782msgid "A file \"%s\" already exists.%sReplace it?" 4783msgstr "\"%s\" dosyası zaten var.%s Değiştirilsin mi?" 4784 4785#: lazarusidestrconsts.lisafilterwiththenamealreadyexists 4786#, object-pascal-format 4787msgid "A filter with the name \"%s\" already exists." 4788msgstr "\"%s\" adı olan bir filtre zaten var." 4789 4790#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean 4791msgid "After cleaning up (clean all or clean common files), switch to clean automatically" 4792msgstr "Temizledikten sonra (tümünü temizleyin veya ortak dosyaları temizleyin), otomatik olarak temizlemeye geçin" 4793 4794#: lazarusidestrconsts.lisalignment 4795msgid "Alignment" 4796msgstr "Uyum" 4797 4798#: lazarusidestrconsts.lisallblockslooksok 4799msgid "All blocks look ok." 4800msgstr "Bütün bloklar iyi görünüyor." 4801 4802#: lazarusidestrconsts.lisallbuildmodes 4803msgid "<All build modes>" 4804msgstr "<Bütün yapı modları>" 4805 4806#: lazarusidestrconsts.lisallinheritedoptions 4807msgid "All inherited options" 4808msgstr "Devralınan tüm seçenekler" 4809 4810#: lazarusidestrconsts.lisalloptions 4811msgid "All Options" 4812msgstr "Tüm Seçenekler" 4813 4814#: lazarusidestrconsts.lisallowfunctio 4815msgid "Allow Function Calls" 4816msgstr "Fonksiyon Çağrısına İzin Ver" 4817 4818#: lazarusidestrconsts.lisallowsearchingformultiplelines 4819msgid "Allow searching for multiple lines" 4820msgstr "Birden fazla satırı aramaya izin ver" 4821 4822#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall 4823msgid "All parameters of this function are already set at this call. Nothing to add." 4824msgstr "Bu işlevin tüm parametreleri zaten bu çağrıda ayarlanmış.Eklenecek bir şey yok." 4825 4826#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened 4827#, object-pascal-format 4828msgid "All your modifications to \"%s\"%swill be lost and the file reopened." 4829msgstr "\"%s\"%s yaptığınız tüm değişiklikler kaybolacak ve dosya yeniden açılacaktır." 4830 4831#: lazarusidestrconsts.lisalpha 4832msgid "Alpha" 4833msgstr "Alfa" 4834 4835#: lazarusidestrconsts.lisalternativekey 4836msgid "Alternative key" 4837msgstr "Alternatif tuş" 4838 4839#: lazarusidestrconsts.lisalternativekeyor2keysequence 4840msgid "Alternative key (or 2 key sequence)" 4841msgstr "Alternatif tuş (veya 2 tuş sıralı)" 4842 4843#: lazarusidestrconsts.lisalways 4844msgid "Always" 4845msgstr "Her zaman" 4846 4847#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase 4848msgid "Always convert suggested default file name to lowercase" 4849msgstr "Önerilen varsayılan dosya adını her zaman küçük harfe çevir" 4850 4851#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused 4852msgid "Always draw selected items focused" 4853msgstr "Seçili nesneleri daima odaklanmış olarak çiz" 4854 4855#: lazarusidestrconsts.lisalwaysignore 4856msgid "Always ignore" 4857msgstr "Her zaman yoksay" 4858 4859#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists 4860msgid "A macro with this name already exists." 4861msgstr "Bu ada sahip bir makro zaten var." 4862 4863#: lazarusidestrconsts.lisambiguousfilefound 4864msgid "Ambiguous file found" 4865msgstr "Belirsiz dosya bulundu" 4866 4867#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete 4868#, object-pascal-format 4869msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" 4870msgstr "Belirsiz dosya bulundu: \"%s\" %s Bu dosya \"%s\" ile yanlış yapılabilir %s Belirsiz dosyayı silsin mi?" 4871 4872#: lazarusidestrconsts.lisambiguousfilesfound 4873msgid "Ambiguous files found" 4874msgstr "Belirsiz dosyalar bulundu" 4875 4876#: lazarusidestrconsts.lisambiguousunitfound 4877msgid "Ambiguous unit found" 4878msgstr "Belirsiz birim bulundu" 4879 4880#: lazarusidestrconsts.lisanchorbottomtobottomside 4881msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 4882msgstr "Alt tarafı kardeşin alt tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." 4883 4884#: lazarusidestrconsts.lisanchorbottomtotopside 4885msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 4886msgstr "Alt tarafı kardeşin üst tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." 4887 4888#: lazarusidestrconsts.lisanchoreditornocontrolselected 4889msgid "Anchor Editor - no control selected" 4890msgstr "Çapa Düzenleyici - hiçbir kontrol seçilmedi" 4891 4892#: lazarusidestrconsts.lisanchorenabledhint 4893#, object-pascal-format 4894msgid "Enabled = Include %s in Anchors" 4895msgstr "Etkin = Çapa %s ekle" 4896 4897#: lazarusidestrconsts.lisanchorlefttoleftside 4898msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 4899msgstr "Sol taraftaki kardeşin sol tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." 4900 4901#: lazarusidestrconsts.lisanchorlefttorightside 4902msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 4903msgstr "Sol taraftaki kardeşin sağ tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." 4904 4905#: lazarusidestrconsts.lisanchorrighttoleftside 4906msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 4907msgstr "Kardeşin sağ tarafından sol tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." 4908 4909#: lazarusidestrconsts.lisanchorrighttorightside 4910msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 4911msgstr "Kardeşin sağ tarafından sağ tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." 4912 4913#: lazarusidestrconsts.lisanchorsof 4914#, object-pascal-format 4915msgid "Anchors of %s" 4916msgstr "%s çapa" 4917 4918#: lazarusidestrconsts.lisanchorsofselectedcontrols 4919msgid "Anchors of selected controls" 4920msgstr "Seçilen kontrollerin çapaları" 4921 4922#: lazarusidestrconsts.lisanchortoptobottomside 4923msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 4924msgstr "Kardeşin üst tarafını alt tarafına tutturun. Tutulan mesafe, bunun hem BorderSpacing özellikleri hem de kardeşleri tarafından tanımlanır." 4925 4926#: lazarusidestrconsts.lisanchortoptotopside 4927msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 4928msgstr "Üst tarafı kardeşin üst tarafına tutturun. Bir mesafe ayarlamak için BorderSpacing kullanın. Kardeşin bordürünün boşluğu yok sayılır." 4929 4930#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro 4931#, object-pascal-format 4932msgid "An error occurred at last startup while loading %s!%sLoad this project again?" 4933msgstr "%s yüklenirken son başlatılışta bir hata oluştu!%sBu projeyi tekrar yükle?" 4934 4935#: lazarusidestrconsts.lisappearance 4936msgid "Appearance" 4937msgstr "Görünüm" 4938 4939#: lazarusidestrconsts.lisapplicationclassname 4940msgid "&Application class name" 4941msgstr "&Uygulama sınıfı adı" 4942 4943#: lazarusidestrconsts.lisapplicationprogramdescriptor 4944msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI." 4945msgstr "Çapraz platform LCL kitaplığını GUI'si için kullanan grafiksel bir Free Pascal uygulaması." 4946 4947#: lazarusidestrconsts.lisapply 4948msgctxt "lazarusidestrconsts.lisapply" 4949msgid "Apply" 4950msgstr "Uygula" 4951 4952#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo 4953msgid "apply build flags (-B) to dependencies too" 4954msgstr "yapı bayraklarını (-B) bağımlılıklara çok uygulayın" 4955 4956#: lazarusidestrconsts.lisapplyconventions 4957msgid "Apply conventions" 4958msgstr "Sözleşmeleri uygulayın" 4959 4960#: lazarusidestrconsts.lisapplyconventionshint 4961msgid "Adjust name extension and character case for platform and file type." 4962msgstr "Platform ve dosya türü için ad uzantısını ve karakter kılıfını ayarlayın." 4963 4964#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects 4965msgid "A project unit can not be used by other packages/projects" 4966msgstr "Bir proje birimi diğer paketler / projeler tarafından kullanılamaz" 4967 4968#: lazarusidestrconsts.lisaroundborderspacehint 4969msgid "Borderspace around the control. The other four borderspaces are added to this value." 4970msgstr "Denetimin etrafındaki kenarlıklar. Diğer dört kenar boşlukları bu değere eklenir." 4971 4972#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext 4973msgid "Ask before replacing each found text" 4974msgstr "Bulunan her metni değiştirmeden önce sor" 4975 4976#: lazarusidestrconsts.lisaskbeforesavingprojectssession 4977msgid "Ask before saving project's session" 4978msgstr "Projenin oturumunu kaydetmeden önce sor" 4979 4980#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform 4981msgid "Ask for component name after putting it on a designer form." 4982msgstr "Tasarımcı formuna koyduktan sonra bileşen adını sor." 4983 4984#: lazarusidestrconsts.lisaskforfilenameonnewfile 4985msgid "Ask for file name on new file" 4986msgstr "Yeni dosyada dosya adı sor" 4987 4988#: lazarusidestrconsts.lisasknameoncreate 4989msgid "Ask name on create" 4990msgstr "Oluşturmada ad sor" 4991 4992#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin 4993msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe" 4994msgstr "Windows sistemlerinde yararlı bir ayar: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe" 4995 4996#: lazarusidestrconsts.lisautoadjustideheight 4997msgid "Automatically adjust IDE main window height" 4998msgstr "IDE ana pencere yüksekliğini otomatik olarak ayarla" 4999 5000#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette 5001msgid "Show complete component palette" 5002msgstr "Komple bileşen paletini göster" 5003 5004#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint 5005msgid "If component palette spans over more lines, show them all and not only one." 5006msgstr "Bileşen paleti daha fazla çizgiye yayılmışsa, hepsini göster, sadece bir tane değil." 5007 5008#: lazarusidestrconsts.lisautocompletionoff 5009msgid "Auto completion: off" 5010msgstr "Otomatik tamamlama: kapalı" 5011 5012#: lazarusidestrconsts.lisautocompletionon 5013msgid "Auto completion: on" 5014msgstr "Otomatik tamamlama: açık" 5015 5016#: lazarusidestrconsts.lisautocontinueafter 5017msgid "Auto continue after:" 5018msgstr "Sonradan otomatik devam et:" 5019 5020#: lazarusidestrconsts.lisautomarkup 5021msgid "Markup and Matches" 5022msgstr "İşaretleme ve Maçlar" 5023 5024#: lazarusidestrconsts.lisautomatic 5025msgctxt "lazarusidestrconsts.lisautomatic" 5026msgid "Automatic" 5027msgstr "Otomatik" 5028 5029#: lazarusidestrconsts.lisautomatically 5030msgid "Automatically" 5031msgstr "Otomatik olarak" 5032 5033#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs 5034msgid "Automatically convert .lfm files to .lrs resource files" 5035msgstr ".lfm dosyalarını .lrs kaynak dosyalarına otomatik olarak dönüştür" 5036 5037#: lazarusidestrconsts.lisautomaticallyignoreforselection 5038msgid "do not complete selection" 5039msgstr "seçimi tamamlama" 5040 5041#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint 5042msgid "Automatically invoke after point" 5043msgstr "Sonradan otomatik olarak çağır" 5044 5045#: lazarusidestrconsts.lisautomaticallyinvokeontype 5046msgid "Automatically invoke on typing" 5047msgstr "" 5048 5049#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength 5050msgid "Only complete if word is longer or equal" 5051msgstr "" 5052 5053#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend 5054msgid "Only complete when at end of word" 5055msgstr "" 5056 5057#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer 5058msgid "Use completion box delay" 5059msgstr "" 5060 5061#: lazarusidestrconsts.lisautomaticallyonlinebreak 5062msgid "line break" 5063msgstr "satır sonu" 5064 5065#: lazarusidestrconsts.lisautomaticallyonspace 5066msgid "space" 5067msgstr "boşluk" 5068 5069#: lazarusidestrconsts.lisautomaticallyontab 5070msgid "tab" 5071msgstr "sekme" 5072 5073#: lazarusidestrconsts.lisautomaticallyonwordend 5074msgid "word end" 5075msgstr "kelime sonu" 5076 5077#: lazarusidestrconsts.lisautomaticallyremovecharacter 5078msgid "do not add character" 5079msgstr "karakter eklenemedi" 5080 5081#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident 5082msgid "Automatically use single possible identifier" 5083msgstr "Otomatik olarak tek olası tanımlayıcı kullan" 5084 5085#: lazarusidestrconsts.lisautomaticfeatures 5086msgid "Completion and Hints" 5087msgstr "Tamamlama ve İpuçları" 5088 5089#: lazarusidestrconsts.lisautoshowobjectinspector 5090msgid "Auto show" 5091msgstr "Otomatik göster" 5092 5093#: lazarusidestrconsts.lisavailableforinstallation 5094msgid "Available for installation" 5095msgstr "Yükleme için kullanılabilir" 5096 5097#: lazarusidestrconsts.lisavailableprojectbuildmodes 5098msgid "Available project build modes:" 5099msgstr "Kullanılabilir proje oluşturma modları:" 5100 5101#: lazarusidestrconsts.lisbackupchangedfiles 5102msgid "Make backup of changed files" 5103msgstr "Değiştirilen dosyaların yedeklenmesi" 5104 5105#: lazarusidestrconsts.lisbackupfilefailed 5106msgid "Backup file failed" 5107msgstr "Yedek dosyası başarısız oldu" 5108 5109#: lazarusidestrconsts.lisbackuphint 5110msgid "Creates a Backup directory under project directory" 5111msgstr "Proje dizini altında bir yedek dizin oluşturur" 5112 5113#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies 5114#, object-pascal-format 5115msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." 5116msgstr "Paket adını veya sürümünü değiştirmek bağımlılıkları bozuyor. Bu bağımlılıklar da değişmeli mi?%s Listelenen tüm bağımlılıkları değiştirmek için Evet seçeneğini seçin.%s Bağımlılıkları kırmak ve devam etmek için Yoksay'ı seçin." 5117 5118#: lazarusidestrconsts.lisbegins 5119msgid "begins" 5120msgstr "başla(begins)" 5121 5122#: lazarusidestrconsts.lisbehindrelated 5123msgid "Behind related" 5124msgstr "İlişkinin arkasında" 5125 5126#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes 5127msgid "be less verbose, can be given multiple times" 5128msgstr "daha az ayrıntılı, birkaç kez verilebilir" 5129 5130#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes 5131msgid "be more verbose, can be given multiple times" 5132msgstr "daha ayrıntılı olmak, birden çok kez verilebilir" 5133 5134#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip 5135msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" 5136msgstr "En iyisi turbopoweriprodsgn gibi bir HTML denetimi yükleyerek görüldü" 5137 5138#: lazarusidestrconsts.lisbfalwaysbuildbeforerun 5139msgid "Always build before run" 5140msgstr "Çalıştırmadan önce her zaman oluştur" 5141 5142#: lazarusidestrconsts.lisbfbuildcommand 5143msgid "Build Command" 5144msgstr "Yapı Komutu" 5145 5146#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead 5147msgid "On build project execute the Build File command instead" 5148msgstr "Yapı projesinde bunun yerine Yapı Dosya komutunu yürütün" 5149 5150#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead 5151msgid "On run project execute the Run File command instead" 5152msgstr "Çalıştırma projesinde Çalıştır Dosya komut yerine" 5153 5154#: lazarusidestrconsts.lisbfruncommand 5155msgid "Run Command" 5156msgstr "Çalıştır Komutu" 5157 5158#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor 5159msgid "When this file is active in source editor" 5160msgstr "Bu dosya kaynak düzenleyicide etkin olduğunda" 5161 5162#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath 5163msgid "Working directory (leave empty for file path)" 5164msgstr "Çalışma dizini (dosya yolu için boş bırakın)" 5165 5166#: lazarusidestrconsts.lisbinary 5167msgctxt "lazarusidestrconsts.lisbinary" 5168msgid "Binary" 5169msgstr "İkili" 5170 5171#: lazarusidestrconsts.lisboldnondefaultobjectinspector 5172msgid "Bold non default values" 5173msgstr "Varsayılan olmayan kalın değerler" 5174 5175#: lazarusidestrconsts.lisborderspace 5176msgid "Border space" 5177msgstr "Kenar boşluğu" 5178 5179#: lazarusidestrconsts.lisbottom 5180msgctxt "lazarusidestrconsts.lisbottom" 5181msgid "Bottom" 5182msgstr "Alt" 5183 5184#: lazarusidestrconsts.lisbottomborderspacespinedithint 5185msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." 5186msgstr "Alt kenarlık alanı. Bu değer taban sınır alanına eklenir ve kontrolün altındaki boşluk için kullanılır." 5187 5188#: lazarusidestrconsts.lisbottomgroupboxcaption 5189msgid "Bottom anchoring" 5190msgstr "Alt çapa" 5191 5192#: lazarusidestrconsts.lisbottoms 5193msgid "Bottoms" 5194msgstr "Altlar" 5195 5196#: lazarusidestrconsts.lisbottomsiblingcomboboxhint 5197msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 5198msgstr "Bu, alt tarafın tutturulduğu kardeş kontrolüdür. Ankraj için Delphi stilinde tutturma için boş bırakın (BorderSpacing ve ReferenceSide önemli değil)." 5199 5200#: lazarusidestrconsts.lisbottomspaceequally 5201msgid "Bottom space equally" 5202msgstr "Alt alan eşit" 5203 5204#: lazarusidestrconsts.lisbpsdisabled 5205msgctxt "lazarusidestrconsts.lisbpsdisabled" 5206msgid "Disabled" 5207msgstr "Devre dışı" 5208 5209#: lazarusidestrconsts.lisbpsenabled 5210msgctxt "lazarusidestrconsts.lisbpsenabled" 5211msgid "Enabled" 5212msgstr "Etkin" 5213 5214#: lazarusidestrconsts.lisbreak 5215msgctxt "lazarusidestrconsts.lisbreak" 5216msgid "Break" 5217msgstr "Kırılma" 5218 5219#: lazarusidestrconsts.lisbreakpointproperties 5220msgid "Breakpoint Properties" 5221msgstr "Kesme Noktası Özellikleri" 5222 5223#: lazarusidestrconsts.lisbrowseandselectacompiler 5224msgid "Browse and select a compiler (e.g. ppcx64" 5225msgstr "Bir derleyiciye göz atın ve seçin (örneğin, ppcx64)" 5226 5227#: lazarusidestrconsts.lisbtnadd 5228msgctxt "lazarusidestrconsts.lisbtnadd" 5229msgid "&Add" 5230msgstr "&Ekle" 5231 5232#: lazarusidestrconsts.lisbtnclose 5233msgctxt "lazarusidestrconsts.lisbtnclose" 5234msgid "&Close" 5235msgstr "&Kapat" 5236 5237#: lazarusidestrconsts.lisbtndelete 5238msgctxt "lazarusidestrconsts.lisbtndelete" 5239msgid "&Delete" 5240msgstr "&Sil" 5241 5242#: lazarusidestrconsts.lisbtndlgadd 5243msgid "&Add ..." 5244msgstr "&Ekle ..." 5245 5246#: lazarusidestrconsts.lisbtndlgreplace 5247msgctxt "lazarusidestrconsts.lisbtndlgreplace" 5248msgid "&Replace ..." 5249msgstr "&Değiştir ..." 5250 5251#: lazarusidestrconsts.lisbtnenabled 5252msgctxt "lazarusidestrconsts.lisbtnenabled" 5253msgid "&Enabled" 5254msgstr "&Etkin" 5255 5256#: lazarusidestrconsts.lisbtnfind 5257msgid "&Find" 5258msgstr "&Ara" 5259 5260#: lazarusidestrconsts.lisbtnquit 5261msgctxt "lazarusidestrconsts.lisbtnquit" 5262msgid "&Quit" 5263msgstr "&Çıkış" 5264 5265#: lazarusidestrconsts.lisbtnremove 5266msgctxt "lazarusidestrconsts.lisbtnremove" 5267msgid "&Remove" 5268msgstr "&Kaldır" 5269 5270#: lazarusidestrconsts.lisbtnrename 5271msgid "&Rename" 5272msgstr "&Yeniden Adlandır" 5273 5274#: lazarusidestrconsts.lisbtnreplace 5275msgid "&Replace" 5276msgstr "&Değiştir" 5277 5278#: lazarusidestrconsts.lisbuild 5279msgctxt "lazarusidestrconsts.lisbuild" 5280msgid "Build" 5281msgstr "Derle" 5282 5283#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide 5284msgid "build all files of project/package/IDE" 5285msgstr "proje/paket/IDE'nin tüm dosyalarını oluşturun" 5286 5287#: lazarusidestrconsts.lisbuildcaption 5288msgctxt "lazarusidestrconsts.lisbuildcaption" 5289msgid "Build" 5290msgstr "Derle" 5291 5292#: lazarusidestrconsts.lisbuildide 5293msgid "Build IDE" 5294msgstr "IDE oluştur" 5295 5296#: lazarusidestrconsts.lisbuildidewithpackages 5297msgid "build IDE with packages" 5298msgstr "paketlerle IDE kur" 5299 5300#: lazarusidestrconsts.lisbuilding 5301msgid "Building" 5302msgstr "İnşa ediliyor" 5303 5304#: lazarusidestrconsts.lisbuildinglazarusfailed 5305msgid "Building Lazarus failed" 5306msgstr "Lazarus'u derlemek başarısız oldu" 5307 5308#: lazarusidestrconsts.lisbuildmode 5309#, object-pascal-format 5310msgid "Build Mode: %s" 5311msgstr "Yapı Modu: %s" 5312 5313#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes 5314msgid "Differences between build modes" 5315msgstr "Yapı modları arasındaki farklar" 5316 5317#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes 5318msgid "Differences from other build modes" 5319msgstr "Diğer oluşturma modlarından farklar" 5320 5321#: lazarusidestrconsts.lisbuildmodediffmode 5322msgid "Mode:" 5323msgstr "Mod:" 5324 5325#: lazarusidestrconsts.lisbuildmodeintitleinexample 5326msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus" 5327msgstr "Başlık çubuğunda adı göster, örneğin şunu gösterir: project1.lpi - Release - Lazarus" 5328 5329#: lazarusidestrconsts.lisbuildmodes 5330msgid "Build modes" 5331msgstr "Yapı modları" 5332 5333#: lazarusidestrconsts.lisbuildnewproject 5334msgid "Build new project" 5335msgstr "Yeni proje oluştur" 5336 5337#: lazarusidestrconsts.lisbuildnumber 5338msgid "Build number" 5339msgstr "Yapı numarası" 5340 5341#: lazarusidestrconsts.lisbuildstage 5342msgctxt "lazarusidestrconsts.lisbuildstage" 5343msgid "Build" 5344msgstr "Derle" 5345 5346#: lazarusidestrconsts.lisbusy 5347msgid "Busy" 5348msgstr "Meşgul" 5349 5350#: lazarusidestrconsts.lisbyte 5351#, object-pascal-format 5352msgid "%s byte" 5353msgstr "%s byte" 5354 5355#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed 5356#, object-pascal-format 5357msgid "Calling %s to create Makefile from %s failed." 5358msgstr "%s öğesinden Makefile oluşturmak için %s çağrısı başarısız oldu." 5359 5360#: lazarusidestrconsts.liscallstacknotevaluated 5361msgid "Stack not evaluated" 5362msgstr "Yığın değerlendirilmedi" 5363 5364#: lazarusidestrconsts.liscancel 5365msgctxt "lazarusidestrconsts.liscancel" 5366msgid "Cancel" 5367msgstr "İptal" 5368 5369#: lazarusidestrconsts.liscancelloadingthiscomponent 5370msgid "Cancel loading this component" 5371msgstr "Bu bileşen yüklenmeyi iptal et" 5372 5373#: lazarusidestrconsts.liscancelloadingunit 5374msgid "Cancel loading unit" 5375msgstr "Yükleme birimini iptal et" 5376 5377#: lazarusidestrconsts.liscancelrenaming 5378msgid "Cancel renaming" 5379msgstr "Yeniden adlandırmayı iptal et" 5380 5381#: lazarusidestrconsts.liscannotcompileproject 5382msgid "Cannot compile project" 5383msgstr "Projeyi derlenemiyor" 5384 5385#: lazarusidestrconsts.liscannotcopytoplevelcomponent 5386msgid "Cannot copy top level component." 5387msgstr "Üst düzey bileşeni kopyalanamıyor." 5388 5389#: lazarusidestrconsts.liscannotcreatefile 5390#, object-pascal-format 5391msgid "Cannot create file \"%s\"" 5392msgstr "Dosya \"%s\" oluşturulamıyor" 5393 5394#: lazarusidestrconsts.liscannotdeletelastmode 5395msgid "Cannot delete last mode." 5396msgstr "Son mod silinemiyor." 5397 5398#: lazarusidestrconsts.liscannotexecute 5399#, object-pascal-format 5400msgid "cannot execute \"%s\"" 5401msgstr "\"%s\" çalıştırılamıyor" 5402 5403#: lazarusidestrconsts.liscannotfind 5404#, object-pascal-format 5405msgid "Cannot find %s" 5406msgstr "%s bulunamadı" 5407 5408#: lazarusidestrconsts.liscannotfindexecutable 5409#, object-pascal-format 5410msgid "cannot find executable \"%s\"" 5411msgstr "\"%s\" çalıştırılabilir dosyası bulamıyor" 5412 5413#: lazarusidestrconsts.liscannotfindlazarusstarter 5414#, object-pascal-format 5415msgid "Cannot find Lazarus starter:%s%s" 5416msgstr "Lazarus başlatıcısı bulunamadı: %s %s" 5417 5418#: lazarusidestrconsts.liscannotfindunit 5419#, object-pascal-format 5420msgid "Cannot find unit %s" 5421msgstr "Birim %s bulunamadı" 5422 5423#: lazarusidestrconsts.liscannotopenform 5424#, object-pascal-format 5425msgid "Cannot open form \"%s\"." 5426msgstr "\"%s\" Form açılamadı." 5427 5428#: lazarusidestrconsts.liscannotsaveform 5429#, object-pascal-format 5430msgid "Cannot save form \"%s\"." 5431msgstr "\"%s\" From kaydedilemedi." 5432 5433#: lazarusidestrconsts.liscannotsubstitutemacros 5434#, object-pascal-format 5435msgid "Cannot substitute macro \"%s\"." 5436msgstr "\"%s\" Makro değiştirilemiyor." 5437 5438#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling 5439msgid "Cannot test the compiler while debugging or compiling." 5440msgstr "Hata ayıklama veya derleme yaparken derleyiciyi test edemiyor." 5441 5442#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents 5443msgid "Can only change the class of TComponents." 5444msgstr "Sadece TComponent sınıfını değiştirebilirsin." 5445 5446#: lazarusidestrconsts.liscantfindavalidppu 5447#, object-pascal-format 5448msgid "Can't find a valid %s.ppu" 5449msgstr "Geçerli bir %s.ppu bulunamadı" 5450 5451#: lazarusidestrconsts.liscaptioncomparefiles 5452msgid "Compare files (not for creating patches)" 5453msgstr "Dosyaları karşılaştır (yamalar oluşturmak için değil)" 5454 5455#: lazarusidestrconsts.liscbpfiles 5456#, object-pascal-format 5457msgid "%s (%s files)" 5458msgstr "%s ( %s dosyaları)" 5459 5460#: lazarusidestrconsts.liscbpreallydeletesourcefiles 5461#, object-pascal-format 5462msgid "Really delete %s source files%s%s" 5463msgstr "%s kaynak dosyaları gerçekten silinsin mi %s %s" 5464 5465#: lazarusidestrconsts.lisccdchangeclassof 5466#, object-pascal-format 5467msgid "Change Class of %s" 5468msgstr "%s sınıfını değiştir" 5469 5470#: lazarusidestrconsts.lisccdnoclass 5471msgid "no class" 5472msgstr "sınıf yok" 5473 5474#: lazarusidestrconsts.lisccoambiguouscompiler 5475msgid "Ambiguous compiler" 5476msgstr "Belirsiz derleyici" 5477 5478#: lazarusidestrconsts.lisccochecktestdir 5479#, object-pascal-format 5480msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" 5481msgstr "Lütfen %s Araçlar -> Seçenekler -> Dosyalar -> Yapı testi için Dizin altındaki Test dizini kontrol edin" 5482 5483#: lazarusidestrconsts.lisccocompilernotanexe 5484#, object-pascal-format 5485msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" 5486msgstr "\"%s\" derleyicisi çalıştırılabilir bir dosya değil.%s Ayrıntılar:%s" 5487 5488#: lazarusidestrconsts.lisccocontains 5489msgid "contains " 5490msgstr "içeriyor " 5491 5492#: lazarusidestrconsts.lisccocopyoutputtocliboard 5493msgid "Copy output to clipboard" 5494msgstr "Çıktıyı panoya kopyala" 5495 5496#: lazarusidestrconsts.lisccodatesdiffer 5497#, object-pascal-format 5498msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" 5499msgstr "FPC'nin .ppu dosyalarının tarihleri bir saatten fazla farklılık göstermektedir.%s Bu iki kurulumdan kaynaklanabilir.%sDosya1: %s%sDosya2: %s" 5500 5501#: lazarusidestrconsts.lisccoerrorcaption 5502msgctxt "lazarusidestrconsts.lisccoerrorcaption" 5503msgid "Error" 5504msgstr "Hata" 5505 5506#: lazarusidestrconsts.lisccoerrormsg 5507msgid "ERROR: " 5508msgstr "HATA: " 5509 5510#: lazarusidestrconsts.lisccofpcunitpathhassource 5511msgid "FPC unit path contains a source: " 5512msgstr "FPC birim yolu bir kaynak içeriyor: " 5513 5514#: lazarusidestrconsts.lisccohasnewline 5515msgid "new line symbols" 5516msgstr "yeni satır sembolleri" 5517 5518#: lazarusidestrconsts.lisccohintmsg 5519msgid "HINT: " 5520msgstr "İPUCU: " 5521 5522#: lazarusidestrconsts.lisccoinvalidcompiler 5523msgid "Invalid compiler" 5524msgstr "Geçersiz derleyici" 5525 5526#: lazarusidestrconsts.lisccoinvalidsearchpath 5527msgid "Invalid search path" 5528msgstr "Geçersiz arama yolu" 5529 5530#: lazarusidestrconsts.lisccoinvalidtestdir 5531msgid "Invalid Test Directory" 5532msgstr "Geçersiz Test Dizini" 5533 5534#: lazarusidestrconsts.lisccomissingunit 5535msgid "Missing unit" 5536msgstr "Eksik birim" 5537 5538#: lazarusidestrconsts.lisccomsgrtlunitnotfound 5539#, object-pascal-format 5540msgid "RTL unit not found: %s" 5541msgstr "%s RTL birimi bulunamadı" 5542 5543#: lazarusidestrconsts.lisccomultiplecfgfound 5544msgid "multiple compiler configs found: " 5545msgstr "birden fazla derleyici yapılandırması bulundu: " 5546 5547#: lazarusidestrconsts.liscconocfgfound 5548msgid "no fpc.cfg found" 5549msgstr "fpc.cfg bulunamadı" 5550 5551#: lazarusidestrconsts.lisccononascii 5552msgid "non ASCII" 5553msgstr "aSCII değl" 5554 5555#: lazarusidestrconsts.lisccoppuexiststwice 5556#, object-pascal-format 5557msgid "ppu exists twice: %s, %s" 5558msgstr "ppu iki kere var: %s, %s" 5559 5560#: lazarusidestrconsts.lisccoppuolderthancompiler 5561#, object-pascal-format 5562msgid "There is a .ppu file older than the compiler itself:%s%s" 5563msgstr "Derleyici kendinden daha eski bir .ppu dosyası var: %s %s" 5564 5565#: lazarusidestrconsts.lisccortlunitnotfounddetailed 5566#, object-pascal-format 5567msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken." 5568msgstr "%s RTL birimi bulunamadı.%s Bu tipik olarak %s cihazınızın yanlış birim yollarına sahip olduğu anlamına gelir. Veya kurulumunuz bozuldu." 5569 5570#: lazarusidestrconsts.lisccoseveralcompilers 5571#, object-pascal-format 5572msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" 5573msgstr "Yolunuzda birkaç tane Free Pascal Derleyicisi var.%s%s%sBelki eski bir derleyiciyi silmeyi unuttunuz?" 5574 5575#: lazarusidestrconsts.lisccoskip 5576msgid "Skip" 5577msgstr "Atla" 5578 5579#: lazarusidestrconsts.lisccospecialcharacters 5580msgid "special characters" 5581msgstr "özel karakterler" 5582 5583#: lazarusidestrconsts.lisccotestssuccess 5584msgid "All tests succeeded." 5585msgstr "Bütün testler başarıyla tamamlandı." 5586 5587#: lazarusidestrconsts.lisccounabletocreatetestfile 5588msgid "Unable to create Test File" 5589msgstr "Test Dosyası Oluşturulamadı" 5590 5591#: lazarusidestrconsts.lisccounabletocreatetestpascalfile 5592#, object-pascal-format 5593msgid "Unable to create Test Pascal file \"%s\"." 5594msgstr "Test Pascal dosyası \"%s\" oluşturulamadı." 5595 5596#: lazarusidestrconsts.lisccounusualchars 5597msgid "unusual characters" 5598msgstr "olağandışı karakterler" 5599 5600#: lazarusidestrconsts.lisccowarningcaption 5601msgctxt "lazarusidestrconsts.lisccowarningcaption" 5602msgid "Warning" 5603msgstr "Uyarı" 5604 5605#: lazarusidestrconsts.lisccowarningmsg 5606msgid "WARNING: " 5607msgstr "UYARI: " 5608 5609#: lazarusidestrconsts.lisccowrongpathdelimiter 5610msgid "wrong path delimiter" 5611msgstr "yanlış yol sınırlayıcı" 5612 5613#: lazarusidestrconsts.liscecategories 5614msgid "Categories" 5615msgstr "Kategoriler" 5616 5617#: lazarusidestrconsts.liscecomplexitygroup 5618msgid "Complexity" 5619msgstr "Karmaşıklık" 5620 5621#: lazarusidestrconsts.lisceconstants 5622msgid "Constants" 5623msgstr "Sabitler" 5624 5625#: lazarusidestrconsts.lisceemptyblocks 5626msgid "Empty blocks" 5627msgstr "Boş bloklar" 5628 5629#: lazarusidestrconsts.lisceemptyclasssections 5630msgid "Empty class sections" 5631msgstr "Boş sınıf bölümleri" 5632 5633#: lazarusidestrconsts.lisceemptygroup 5634msgid "Empty constructs" 5635msgstr "Boş yapılar" 5636 5637#: lazarusidestrconsts.lisceemptyprocedures 5638msgid "Empty procedures" 5639msgstr "Boş prosedürler" 5640 5641#: lazarusidestrconsts.liscefilter 5642msgid "(filter)" 5643msgstr "(Filtre)" 5644 5645#: lazarusidestrconsts.liscefollowcursor 5646msgid "Follow cursor" 5647msgstr "İmleci takip et" 5648 5649#: lazarusidestrconsts.liscein 5650#, object-pascal-format 5651msgctxt "lazarusidestrconsts.liscein" 5652msgid "%s in %s" 5653msgstr "%s içinde %s" 5654 5655#: lazarusidestrconsts.lisceisarootcontrol 5656msgid "Is a root control" 5657msgstr "Kök kontrol" 5658 5659#: lazarusidestrconsts.liscelongparamlistcount 5660msgid "Parameters count treated as \"many\"" 5661msgstr "Parametre sayısı \"çok\" olarak kabul edilen" 5662 5663#: lazarusidestrconsts.liscelongprocedures 5664msgid "Long procedures" 5665msgstr "Uzun prosedürler" 5666 5667#: lazarusidestrconsts.liscelongproclinecount 5668msgid "Line count of procedure treated as \"long\"" 5669msgstr "\"Uzun\" olarak kabul edilen işlemin satır sayısı" 5670 5671#: lazarusidestrconsts.liscemanynestedprocedures 5672msgid "Many nested procedures" 5673msgstr "Birçok yuvalanmış prosedür" 5674 5675#: lazarusidestrconsts.liscemanyparameters 5676msgid "Many parameters" 5677msgstr "Birçok parametre" 5678 5679#: lazarusidestrconsts.liscemodeshowcategories 5680msgid "Show Categories" 5681msgstr "Kategorileri Göster" 5682 5683#: lazarusidestrconsts.liscemodeshowsourcenodes 5684msgid "Show Source Nodes" 5685msgstr "Kaynak düğümleri göster" 5686 5687#: lazarusidestrconsts.liscenestedproccount 5688msgid "Nested procedures count treated as \"many\"" 5689msgstr "Çok fazla İç içe geçmiş prosedürler" 5690 5691#: lazarusidestrconsts.liscenteralostwindow 5692msgid "Center a lost window" 5693msgstr "Kayıp bir pencere" 5694 5695#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling 5696msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored." 5697msgstr "Verilen kardeşe göre yatay olarak merkez kontrolü .BorderSpacing göz ardı edilir." 5698 5699#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling 5700msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored." 5701msgstr "Verilen kardeşe göre dikey olarak merkez kontrolü .BorderSpacing göz ardı edilir." 5702 5703#: lazarusidestrconsts.liscenterform 5704msgid "Center Form" 5705msgstr "Formu ortala" 5706 5707#: lazarusidestrconsts.liscenterinwindow 5708msgid "Center in window" 5709msgstr "Pencerede ortala" 5710 5711#: lazarusidestrconsts.liscenters 5712msgid "Centers" 5713msgstr "Merkezi" 5714 5715#: lazarusidestrconsts.lisceomode 5716msgid "Preferred exhibition mode" 5717msgstr "Tercih edilen sergileme modu" 5718 5719#: lazarusidestrconsts.lisceomodecategory 5720msgctxt "lazarusidestrconsts.lisceomodecategory" 5721msgid "Category" 5722msgstr "Kategori" 5723 5724#: lazarusidestrconsts.lisceomodesource 5725msgctxt "lazarusidestrconsts.lisceomodesource" 5726msgid "Source" 5727msgstr "Kaynak" 5728 5729#: lazarusidestrconsts.lisceoneveronlymanually 5730msgid "Never, only manually" 5731msgstr "Asla, yalnızca manuel" 5732 5733#: lazarusidestrconsts.lisceonlyusedincategorymode 5734msgid "Only used in category mode" 5735msgstr "Sadece kategori modunda kullanılır" 5736 5737#: lazarusidestrconsts.lisceoonidle 5738msgid "On idle" 5739msgstr "Boşta" 5740 5741#: lazarusidestrconsts.lisceorefreshautomatically 5742msgid "Refresh automatically" 5743msgstr "Otomatik olarak yenile" 5744 5745#: lazarusidestrconsts.lisceothergroup 5746msgctxt "lazarusidestrconsts.lisceothergroup" 5747msgid "Other" 5748msgstr "Diğer" 5749 5750#: lazarusidestrconsts.lisceoupdate 5751msgid "Update" 5752msgstr "Güncelleştir" 5753 5754#: lazarusidestrconsts.lisceowhenswitchingfile 5755msgid "When switching file in source editor" 5756msgstr "Kaynak editörde dosya değiştirirken" 5757 5758#: lazarusidestrconsts.lisceprocedures 5759msgid "Procedures" 5760msgstr "Prosedürler" 5761 5762#: lazarusidestrconsts.lisceproperties 5763msgctxt "lazarusidestrconsts.lisceproperties" 5764msgid "Properties" 5765msgstr "Özellikler" 5766 5767#: lazarusidestrconsts.liscepublishedpropertywithoutdefault 5768msgid "Published properties without default" 5769msgstr "Varsayılan olmadan yayınlanmış özellikler" 5770 5771#: lazarusidestrconsts.lisceshowcodeobserver 5772msgid "Show observations about" 5773msgstr "Gözlemleri göster" 5774 5775#: lazarusidestrconsts.liscestylegroup 5776msgctxt "lazarusidestrconsts.liscestylegroup" 5777msgid "Style" 5778msgstr "Stil" 5779 5780#: lazarusidestrconsts.liscesurrounding 5781msgid "Surrounding" 5782msgstr "Çevreleyen" 5783 5784#: lazarusidestrconsts.liscetodos 5785msgid "ToDos" 5786msgstr "Yapılacaklar" 5787 5788#: lazarusidestrconsts.liscetypes 5789msgid "Types" 5790msgstr "Tipler(Types)" 5791 5792#: lazarusidestrconsts.lisceunnamedconstants 5793msgid "Unnamed constants" 5794msgstr "İsimsiz sabitler" 5795 5796#: lazarusidestrconsts.lisceunsortedmembers 5797msgid "Unsorted members" 5798msgstr "Sıralanmamış üyeler" 5799 5800#: lazarusidestrconsts.lisceunsortedvisibility 5801msgid "Unsorted visibility" 5802msgstr "Sıralanmamış görüntü" 5803 5804#: lazarusidestrconsts.lisceuses 5805msgctxt "lazarusidestrconsts.lisceuses" 5806msgid "Uses" 5807msgstr "Uses" 5808 5809#: lazarusidestrconsts.liscevariables 5810msgid "Variables" 5811msgstr "Değişkenler" 5812 5813#: lazarusidestrconsts.liscewrongindentation 5814msgid "Wrong indentation" 5815msgstr "Yanlış girinti" 5816 5817#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof 5818#, object-pascal-format 5819msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s" 5820msgstr "%s\"%s:%s\"%s%s öğesinin silinmesi sırasında bir istisna oluştu" 5821 5822#: lazarusidestrconsts.liscfecancelloadingthisresource 5823msgid "Cancel loading this resource" 5824msgstr "Bu kaynağı yüklemeyi iptal et" 5825 5826#: lazarusidestrconsts.liscfeclassnotfound 5827#, object-pascal-format 5828msgid "%s%sClass \"%s\" not found." 5829msgstr "%s%ssınıf \"%s\"bulunamadı." 5830 5831#: lazarusidestrconsts.liscfecomponent 5832#, object-pascal-format 5833msgid "%s%sComponent: %s:%s" 5834msgstr "%s%s Bileşeni: %s: %s" 5835 5836#: lazarusidestrconsts.liscfecomponentclass 5837#, object-pascal-format 5838msgid "%s%sComponent Class: %s" 5839msgstr "%s%sBileşen Sınıfı: %s" 5840 5841#: lazarusidestrconsts.liscfecontinueloading 5842msgid "Continue loading" 5843msgstr "Yüklemeye devam et" 5844 5845#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection 5846msgid "Do not know how to copy this form editing selection" 5847msgstr "Bu form düzenleme seçimini nasıl kopyalayacağımı bilmiyorum" 5848 5849#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection 5850msgid "Do not know how to cut this form editing selection" 5851msgstr "Bu form düzenleme seçimini kesme yöntemini bilmiyorum" 5852 5853#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection 5854msgid "Do not know how to delete this form editing selection" 5855msgstr "Bu form düzenleme seçimini nasıl sileceğimi bilmiyorum" 5856 5857#: lazarusidestrconsts.liscfeerrorcreatingcomponent 5858msgid "Error creating component" 5859msgstr "Bileşen oluşturulurken hata oluştu" 5860 5861#: lazarusidestrconsts.liscfeerrorcreatingcomponent2 5862#, object-pascal-format 5863msgid "Error creating component: %s%s%s" 5864msgstr "Bileşen oluşturulurken hata oluştu: %s %s %s" 5865 5866#: lazarusidestrconsts.liscfeerrordestroyingcomponent 5867msgid "Error destroying component" 5868msgstr "Bileşeni yok ederken hata oluştu" 5869 5870#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit 5871#, object-pascal-format 5872msgid "Error destroying component of type %s of unit %s:%s%s" 5873msgstr "%s: %s %s biriminin %s türü bileşenini yok ederken hata oluştu" 5874 5875#: lazarusidestrconsts.liscfeerrordestroyingmediator 5876msgid "Error destroying mediator" 5877msgstr "Aracı yok edilirken hata oluştu" 5878 5879#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit 5880#, object-pascal-format 5881msgid "Error destroying mediator %s of unit %s:%s%s" 5882msgstr "Birim %s için aracı %s yok edildi: %s %s" 5883 5884#: lazarusidestrconsts.liscfeerrorreading 5885#, object-pascal-format 5886msgid "Error reading %s" 5887msgstr "%s okunurken hata oluştu" 5888 5889#: lazarusidestrconsts.liscfeinfile 5890#, object-pascal-format 5891msgid "In file %s" 5892msgstr "%s dosyasında" 5893 5894#: lazarusidestrconsts.liscfeinvalidcomponentowner 5895msgid "Invalid component owner" 5896msgstr "Geçersiz bileşen sahibi" 5897 5898#: lazarusidestrconsts.liscferoot 5899#, object-pascal-format 5900msgid "%sRoot=%s:%s" 5901msgstr "%s kök = %s: %s" 5902 5903#: lazarusidestrconsts.liscfestopallloading 5904msgid "Stop all loading" 5905msgstr "Tüm yüklemeyi durdur" 5906 5907#: lazarusidestrconsts.liscfestream 5908#, object-pascal-format 5909msgid "%sStream=%s" 5910msgstr "%s akış = %s" 5911 5912#: lazarusidestrconsts.liscfestreamposition 5913#, object-pascal-format 5914msgid "%s%sStream position: %s" 5915msgstr "%s%s akış konumu: %s" 5916 5917#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists 5918msgid "TCustomFormEditor.CreateNonFormForm already exists" 5919msgstr "TCustomFormEditor.CreateNonFormForm zaten var" 5920 5921#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype 5922#, object-pascal-format 5923msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" 5924msgstr "TCustomFormEditor.CreateNonFormForm Bilinmeyen tür %s" 5925 5926#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn 5927#, object-pascal-format 5928msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" 5929msgstr "TCustomFormEditor.DeleteComponent TCustomNonFormDesignerForm nerde? %s" 5930 5931#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre 5932#, object-pascal-format 5933msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" 5934msgstr "TCustomFormEditor.RegisterDesignerMeditor zaten kayıtlı: %s" 5935 5936#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror 5937#, object-pascal-format 5938msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" 5939msgstr "\"%s\" sınıfının bileşen editörü şu hatayı oluşturdu: %s\"%s\"" 5940 5941#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto 5942#, object-pascal-format 5943msgid "The component of type %s failed to set its owner to %s:%s" 5944msgstr "%s türü bileşeni, sahibi %s:%s olarak ayarlanamadı" 5945 5946#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection 5947#, object-pascal-format 5948msgid "Unable to clear the form editing selection%s%s" 5949msgstr "%s %s form seçimi düzenleme temizlenemiyor" 5950 5951#: lazarusidestrconsts.lischange 5952msgctxt "lazarusidestrconsts.lischange" 5953msgid "Change" 5954msgstr "Değiştir" 5955 5956#: lazarusidestrconsts.lischangebuildmode 5957msgid "Change build mode" 5958msgstr "Yapı modunu değiştir" 5959 5960#: lazarusidestrconsts.lischangeclass 5961msgid "Change Class" 5962msgstr "Sınıfı Değiştir" 5963 5964#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides 5965#, object-pascal-format 5966msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." 5967msgstr "%s, %s \"%d\" den \"%d\" ye %s içindeki koordinatını değiştirildi." 5968 5969#: lazarusidestrconsts.lischangeencoding 5970msgid "Change Encoding" 5971msgstr "Kodlamayı Değiştir" 5972 5973#: lazarusidestrconsts.lischangefile 5974msgid "Change file" 5975msgstr "Dosyayı değiştir" 5976 5977#: lazarusidestrconsts.lischangeparent 5978msgid "Change Parent" 5979msgstr "Ebeveyn Değiştir" 5980 5981#: lazarusidestrconsts.lischangeswerenotsaved 5982msgid "Changes were not saved" 5983msgstr "Değişiklikler kaydedilmedi" 5984 5985#: lazarusidestrconsts.lischangetounix 5986msgid "Change to Unix /" 5987msgstr "Unix e göre değiştir /" 5988 5989#: lazarusidestrconsts.lischangetowindows 5990msgid "Change to Windows \\" 5991msgstr "Windows a göre değiştir \\" 5992 5993#: lazarusidestrconsts.lischaracter 5994msgid "Character" 5995msgstr "Karakter" 5996 5997#: lazarusidestrconsts.lischaractermap 5998msgid "Character Map" 5999msgstr "Karakter haritası" 6000 6001#: lazarusidestrconsts.lischeckall 6002msgid "Check All" 6003msgstr "Hepsini Kontrol Edin" 6004 6005#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent 6006msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent" 6007msgid "Check for disk file changes via content rather than timestamp" 6008msgstr "Disk dosyası değişikliklerini zaman damgası yerine içerik aracılığıyla kontrol edin" 6009 6010#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil 6011#, object-pascal-format 6012msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source." 6013msgstr ". %s paketinin %s.ppu dosyasının oluşturup oluşturmadığını kontrol edin, ve dosyayı silmediğinizden emin olun. ve iki paketin birim kaynağına erişimi olmadığını kontrol edin." 6014 6015#: lazarusidestrconsts.lischeckifpackageisinthedependencies 6016#, object-pascal-format 6017msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies" 6018msgid ". Check if package %s is in the dependencies" 6019msgstr "%s paketinin bağımlılıklarda olup olmadığını kontrol edin" 6020 6021#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl 6022msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"." 6023msgstr "Kaynaktaki bir sonraki belirtecin \"end\" olup olmadığını ve \"LineEnding + end; + LineEnding \" döndürülmemesini sağlayın." 6024 6025#: lazarusidestrconsts.lischeckoptions 6026msgid "Check options" 6027msgstr "Seçenekleri kontrol et" 6028 6029#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme 6030#, object-pascal-format 6031msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections." 6032msgstr ". %s paketinin arama yolunu kontrol edin, temiz bir yeniden oluşturma deneyin, uygulama kullanım bölümlerini kontrol edin." 6033 6034#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded 6035msgid "Check the next token in source and add a semicolon if needed." 6036msgstr "Kaynaktaki bir sonraki jetonu kontrol edin ve gerekirse noktalı virgül ekleyin." 6037 6038#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco 6039#, object-pascal-format 6040msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme" 6041msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." 6042msgstr "%s Hedefi kontrol edin (OS, CPU, LCL widget türü). Belki de bu hedef için paketi yeniden derlemeniz veya proje için başka bir hedef belirlemeniz gerekir." 6043 6044#: lazarusidestrconsts.lischeckuncheckall 6045msgid "Check/uncheck all" 6046msgstr "Hepsini kontrol / iptal et" 6047 6048#: lazarusidestrconsts.lischooseadifferentname 6049msgid "Choose a different name" 6050msgstr "Farklı bir ad seçin" 6051 6052#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates 6053msgid "Choose a file with CodeTools templates" 6054msgstr "CodeTools şablonlarıyla bir dosya seçin" 6055 6056#: lazarusidestrconsts.lischooseafpdoclink 6057msgid "Choose a FPDoc link" 6058msgstr "Bir FPDoc bağlantısı seçin" 6059 6060#: lazarusidestrconsts.lischooseakey 6061msgid "Choose a key ..." 6062msgstr "Bir tuş seç ..." 6063 6064#: lazarusidestrconsts.lischooseanameforthecomponent 6065msgid "Choose a name for the component" 6066msgstr "Bileşen için bir ad seçin" 6067 6068#: lazarusidestrconsts.lischooseanexamplefile 6069msgid "Choose an example file" 6070msgstr "Örnek bir dosya seçin" 6071 6072#: lazarusidestrconsts.lischooseanfpcmessagefile 6073msgid "Choose an FPC message file" 6074msgstr "Bir FPC mesaj dosyası seçin" 6075 6076#: lazarusidestrconsts.lischooseapascalfileforindentationexamples 6077msgid "Choose a Pascal file for indentation examples" 6078msgstr "Girinti örnekleri için bir Pascal dosyası seçin" 6079 6080#: lazarusidestrconsts.lischoosecompilerexecutable 6081#, object-pascal-format 6082msgid "Choose compiler executable (%s)" 6083msgstr "Derleyici yürütülebilir dosyayı seçin ( %s)" 6084 6085#: lazarusidestrconsts.lischoosecompilermessages 6086msgid "Choose compiler messages file" 6087msgstr "Derleyici iletileri dosyasını seçin" 6088 6089#: lazarusidestrconsts.lischoosedebuggerexecutable 6090msgid "Choose debugger executable" 6091msgstr "Çalıştırılabilir hata ayıklayıcıyı seçin" 6092 6093#: lazarusidestrconsts.lischoosedelphipackage 6094msgid "Choose Delphi package (*.dpk)" 6095msgstr "Delphi paketini seçin (* .dpk)" 6096 6097#: lazarusidestrconsts.lischoosedelphiproject 6098msgid "Choose Delphi project (*.dpr)" 6099msgstr "Delphi proje seç (* .dpr)" 6100 6101#: lazarusidestrconsts.lischoosedelphiunit 6102msgid "Choose Delphi unit (*.pas)" 6103msgstr "Delphi birimini seçin (* .pas)" 6104 6105#: lazarusidestrconsts.lischoosedirectory 6106msgid "Choose directory" 6107msgstr "Dizini seçin" 6108 6109#: lazarusidestrconsts.lischooseexecutable 6110msgid "Choose an executable" 6111msgstr "Çalıştırılabilir bir dosya seçin" 6112 6113#: lazarusidestrconsts.lischoosefpcsourcedir 6114msgid "Choose FPC source directory" 6115msgstr "FPC kaynak dizinini seçin" 6116 6117#: lazarusidestrconsts.lischooselazarussourcedirectory 6118msgid "Choose Lazarus Directory" 6119msgstr "Lazarus Dizini Seçin" 6120 6121#: lazarusidestrconsts.lischoosemakeexecutable 6122msgid "Choose \"make\" executable" 6123msgstr "Çalıştırılabilir \"make\" i seçin" 6124 6125#: lazarusidestrconsts.lischoosenameandtext 6126msgid "Choose name and text" 6127msgstr "İsim ve metin seç" 6128 6129#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile 6130msgid "Choose one of these items to create a new File" 6131msgstr "Yeni bir dosya oluşturmak için bu öğelerden birini seçin" 6132 6133#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage 6134msgid "Choose one of these items to create a new Package" 6135msgstr "Yeni bir paket oluşturmak için bu maddelerden birini seçin" 6136 6137#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject 6138msgid "Choose one of these items to create a new Project" 6139msgstr "Yeni bir proje oluşturmak için bu maddelerden birini seçin" 6140 6141#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone 6142msgid "Choose one of these items to inherit from an existing one" 6143msgstr "Mevcut öğelerden miras almak için bu öğelerden birini seçin" 6144 6145#: lazarusidestrconsts.lischooseprogramsourcepppaslpr 6146msgid "Choose program source (*.pp,*.pas,*.lpr)" 6147msgstr "Program kaynağını seçin (* .pp, *. Pas, *. Lpr)" 6148 6149#: lazarusidestrconsts.lischoosestructuretoencloseselection 6150msgid "Choose structure to enclose selection" 6151msgstr "Seçimi içine almak için yapı seçin" 6152 6153#: lazarusidestrconsts.lischoosetestbuilddir 6154msgid "Choose the directory for tests" 6155msgstr "Test dizini seç" 6156 6157#: lazarusidestrconsts.liscirculardependencydetected 6158msgid "Circular dependency detected" 6159msgstr "Dairesel bağımlılık tespit edildi" 6160 6161#: lazarusidestrconsts.lisclass 6162msgid "&Class" 6163msgstr "&Sınıf" 6164 6165#: lazarusidestrconsts.lisclasscompletion 6166msgid "Class Completion" 6167msgstr "Sınıf Tamamlama" 6168 6169#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked 6170msgid "Classes and properties exist. Values were not checked." 6171msgstr "Sınıflar ve özellikler var, değerler kontrol edilmedi." 6172 6173#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste 6174#, object-pascal-format 6175msgid "Class \"%s\" is not a registered component class.%sUnable to paste." 6176msgstr "Class \"%s\" kayıtlı bir bileşen sınıfı değil %s yapıştırılamıyor." 6177 6178#: lazarusidestrconsts.lisclassnotfound 6179msgid "Class not found" 6180msgstr "Sınıf bulunamadı" 6181 6182#: lazarusidestrconsts.lisclassnotfoundat 6183#, object-pascal-format 6184msgid "Class %s not found at %s(%s,%s)" 6185msgstr "Sınıf %s %s ( %s, %s) bulunamadı" 6186 6187#: lazarusidestrconsts.lisclassofmethodnotfound 6188#, object-pascal-format 6189msgid "Class \"%s\" of method \"%s\" not found." 6190msgstr "\"%s\" sınıfı \"%s\" yönteminde bulunamadı." 6191 6192#: lazarusidestrconsts.liscldirclean 6193msgid "Clean" 6194msgstr "Temizle" 6195 6196#: lazarusidestrconsts.liscldircleandirectory 6197msgid "Clean Directory" 6198msgstr "Dizini Temizle" 6199 6200#: lazarusidestrconsts.liscldircleansubdirectories 6201msgid "Clean sub directories" 6202msgstr "Alt dizinleri temizle" 6203 6204#: lazarusidestrconsts.liscldirkeepalltextfiles 6205msgid "Keep all text files" 6206msgstr "Tüm metin dosyalarını sakla" 6207 6208#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter 6209msgid "Keep files matching filter" 6210msgstr "Dosyaları eşleşen dosyaları filtreleyin" 6211 6212#: lazarusidestrconsts.liscldirremovefilesmatchingfilter 6213msgid "Remove files matching filter" 6214msgstr "Filtreye uyan dosyaları kaldır" 6215 6216#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof 6217msgid "Simple Syntax (e.g. * instead of .*)" 6218msgstr "Basit Sözdizimi (ör. *. * Yerine)" 6219 6220#: lazarusidestrconsts.liscleanall 6221msgid "Clean all" 6222msgstr "Hepsini temizle" 6223 6224#: lazarusidestrconsts.liscleancommonfiles 6225msgid "Clean common files" 6226msgstr "Ortak dosyaları temizle" 6227 6228#: lazarusidestrconsts.liscleanlazarussource 6229msgid "Clean Lazarus Source" 6230msgstr "Lazarus Kaynağını Temizle" 6231 6232#: lazarusidestrconsts.liscleanonlyonce 6233msgid "Switch after building to automatically" 6234msgstr "Otomatik olarak derledikten sonra geçiş yapın" 6235 6236#: lazarusidestrconsts.liscleanup 6237msgid "Clean up" 6238msgstr "Temizle" 6239 6240#: lazarusidestrconsts.liscleanupandbuild 6241msgctxt "lazarusidestrconsts.liscleanupandbuild" 6242msgid "Clean up and build" 6243msgstr "Temizle ve derle" 6244 6245#: lazarusidestrconsts.liscleanupandbuildproject 6246msgid "Clean up and build project" 6247msgstr "Temizle ve projeyi derle" 6248 6249#: lazarusidestrconsts.liscleanuppackage 6250#, object-pascal-format 6251msgid "Clean up package \"%s\"." 6252msgstr "\"%s\" Paketini temizle ." 6253 6254#: lazarusidestrconsts.liscleanupunitpath 6255msgid "Clean up unit path?" 6256msgstr "Birim yolunu temizle?" 6257 6258#: lazarusidestrconsts.lisclear 6259msgctxt "lazarusidestrconsts.lisclear" 6260msgid "Clear" 6261msgstr "Temizle" 6262 6263#: lazarusidestrconsts.liscleardirectory 6264msgid "Clear Directory?" 6265msgstr "Dizini Temizle?" 6266 6267#: lazarusidestrconsts.lisclearthefilterforoptions 6268msgid "Clear the filter for options" 6269msgstr "Seçenekler için filtreyi temizle" 6270 6271#: lazarusidestrconsts.lisclickheretobrowsethefilehint 6272msgid "Click here to browse the file" 6273msgstr "Dosyaya gözatmak için burayı tıklayın" 6274 6275#: lazarusidestrconsts.lisclicktoseethechoices 6276msgid "Click to see the choices" 6277msgstr "Seçenekleri görmek için tıklayın" 6278 6279#: lazarusidestrconsts.lisclicktoselectpalettepage 6280msgid "Click to Select Palette Page" 6281msgstr "Palet Sayfasını Seçmek İçin Tıklayın" 6282 6283#: lazarusidestrconsts.lisclone 6284msgid "Clone" 6285msgstr "Klon" 6286 6287#: lazarusidestrconsts.lisclose 6288msgctxt "lazarusidestrconsts.lisclose" 6289msgid "Close" 6290msgstr "Kapat" 6291 6292#: lazarusidestrconsts.liscloseall 6293msgctxt "lazarusidestrconsts.liscloseall" 6294msgid "Close All" 6295msgstr "Hepsini kapat" 6296 6297#: lazarusidestrconsts.liscloseallchecked 6298msgid "Close All Checked" 6299msgstr "Seçilenleri Kapat" 6300 6301#: lazarusidestrconsts.lisclosealltabsclose 6302msgid "Close files" 6303msgstr "Dosyaları kapat" 6304 6305#: lazarusidestrconsts.lisclosealltabshide 6306msgctxt "lazarusidestrconsts.lisclosealltabshide" 6307msgid "Hide window" 6308msgstr "Pencereyi gizle" 6309 6310#: lazarusidestrconsts.lisclosealltabsquestion 6311msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" 6312msgstr "Kaynak Düzenleyici Penceresini Kapatma. Tüm dosyaları kapatmak mı yoksa pencereyi mi gizlemek istiyorsunuz?" 6313 6314#: lazarusidestrconsts.lisclosealltabstitle 6315msgid "Close Source Editor Window" 6316msgstr "Kaynak Düzenleyici Penceresini Kapat" 6317 6318#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions 6319msgid "LCL Interface specific options:" 6320msgstr "LCL Arayüze özel seçenekler:" 6321 6322#: lazarusidestrconsts.liscmparameter 6323msgid "Parameter" 6324msgstr "Parametre" 6325 6326#: lazarusidestrconsts.liscmplstcomponents 6327msgctxt "lazarusidestrconsts.liscmplstcomponents" 6328msgid "Components" 6329msgstr "Bileşenler" 6330 6331#: lazarusidestrconsts.liscmplstinheritance 6332msgid "Inheritance" 6333msgstr "Kalıtım" 6334 6335#: lazarusidestrconsts.liscmplstlist 6336msgid "List" 6337msgstr "Liste" 6338 6339#: lazarusidestrconsts.liscmplstpalette 6340msgid "Palette" 6341msgstr "Palet" 6342 6343#: lazarusidestrconsts.liscmppages 6344msgid "Pages" 6345msgstr "Sayfalar" 6346 6347#: lazarusidestrconsts.liscmppalettevisible 6348msgid "Palette is &visible" 6349msgstr "Palet &görünsün" 6350 6351#: lazarusidestrconsts.liscmprestoredefaults 6352msgid "&Restore defaults" 6353msgstr "&Varsayılanları geri yükle" 6354 6355#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile 6356msgid "Ambiguous additional compiler config file" 6357msgstr "Belirsiz ek derleyici yapılandırma dosyası" 6358 6359#: lazarusidestrconsts.liscocallon 6360msgid "Call on:" 6361msgstr "Çağrı:" 6362 6363#: lazarusidestrconsts.liscoclickokifaresuretodothat 6364#, object-pascal-format 6365msgid "%s%sClick OK if you definitely want to do that." 6366msgstr "%s%s Tamamen yapmak isterseniz Tamam'ı tıklayın." 6367 6368#: lazarusidestrconsts.liscocommand 6369msgctxt "lazarusidestrconsts.liscocommand" 6370msgid "Command:" 6371msgstr "Komut:" 6372 6373#: lazarusidestrconsts.liscode 6374msgid "Code" 6375msgstr "Kod" 6376 6377#: lazarusidestrconsts.liscodebrowser 6378msgctxt "lazarusidestrconsts.liscodebrowser" 6379msgid "Code Browser" 6380msgstr "Kod Tarayıcı" 6381 6382#: lazarusidestrconsts.liscodecreationdialogcaption 6383msgid "Code creation options" 6384msgstr "Kod oluşturma seçenekleri" 6385 6386#: lazarusidestrconsts.liscodecreationdialogclasssection 6387msgid "Class section" 6388msgstr "Sınıf bölümü" 6389 6390#: lazarusidestrconsts.liscodecreationdialoglocation 6391msgctxt "lazarusidestrconsts.liscodecreationdialoglocation" 6392msgid "Location" 6393msgstr "Yer" 6394 6395#: lazarusidestrconsts.liscodegenerationoptions 6396msgid "Code generation options" 6397msgstr "Kod oluşturma seçenekleri" 6398 6399#: lazarusidestrconsts.liscodehelpaddpathbutton 6400msgid "Add path" 6401msgstr "Yol ekle" 6402 6403#: lazarusidestrconsts.liscodehelpbrowseexamplebutton 6404msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" 6405msgid "Browse" 6406msgstr "Gözat" 6407 6408#: lazarusidestrconsts.liscodehelpconfirmreplace 6409msgid "Confirm replace" 6410msgstr "Değiştirmeyi onayla" 6411 6412#: lazarusidestrconsts.liscodehelpcreatebutton 6413msgid "Create help item" 6414msgstr "Yardım öğesi oluştur" 6415 6416#: lazarusidestrconsts.liscodehelpdeletepathbutton 6417msgid "Remove path" 6418msgstr "Yolu kaldır" 6419 6420#: lazarusidestrconsts.liscodehelpdescrtag 6421msgctxt "lazarusidestrconsts.liscodehelpdescrtag" 6422msgid "Description" 6423msgstr "Açıklama" 6424 6425#: lazarusidestrconsts.liscodehelperrorstag 6426msgctxt "lazarusidestrconsts.liscodehelperrorstag" 6427msgid "Errors" 6428msgstr "Hatalar" 6429 6430#: lazarusidestrconsts.liscodehelpexampletag 6431msgid "Example" 6432msgstr "Örnek" 6433 6434#: lazarusidestrconsts.liscodehelpgroupbox 6435msgid "FPDoc settings" 6436msgstr "FPDoc ayarları" 6437 6438#: lazarusidestrconsts.liscodehelphintboldformat 6439msgid "Insert bold formatting tag" 6440msgstr "Kalın biçimlendirme etiketi ekle" 6441 6442#: lazarusidestrconsts.liscodehelphintinsertcodetag 6443msgid "Insert code formatting tag" 6444msgstr "Kod biçimlendirme etiketi ekle" 6445 6446#: lazarusidestrconsts.liscodehelphintitalicformat 6447msgid "Insert italic formatting tag" 6448msgstr "Eğik biçimlendirme etiketi ekle" 6449 6450#: lazarusidestrconsts.liscodehelphintremarktag 6451msgid "Insert remark formatting tag" 6452msgstr "Açıklama biçimlendirme etiketi ekle" 6453 6454#: lazarusidestrconsts.liscodehelphintunderlineformat 6455msgid "Insert underline formatting tag" 6456msgstr "Alt çizgi biçimlendirme etiketi ekle" 6457 6458#: lazarusidestrconsts.liscodehelphintvartag 6459msgid "Insert var formatting tag" 6460msgstr "Var biçimlendirme etiketini ekle" 6461 6462#: lazarusidestrconsts.liscodehelpinherited 6463msgctxt "lazarusidestrconsts.liscodehelpinherited" 6464msgid "Inherited" 6465msgstr "Inherited" 6466 6467#: lazarusidestrconsts.liscodehelpinsertalink 6468msgid "Insert a link ..." 6469msgstr "Bir bağlantı ekle ..." 6470 6471#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag 6472msgid "Insert paragraph formatting tag" 6473msgstr "Paragraf biçimlendirme etiketi ekleme" 6474 6475#: lazarusidestrconsts.liscodehelpmainformcaption 6476msgctxt "lazarusidestrconsts.liscodehelpmainformcaption" 6477msgid "FPDoc Editor" 6478msgstr "FPDoc Editör" 6479 6480#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound 6481msgid "(no inherited description found)" 6482msgstr "(Devralınan açıklama bulunamadı)" 6483 6484#: lazarusidestrconsts.liscodehelpnotagcaption 6485msgid "<NONE>" 6486msgstr "<YOK>" 6487 6488#: lazarusidestrconsts.liscodehelpseealsotag 6489msgid "See also" 6490msgstr "Ayrıca bakınız" 6491 6492#: lazarusidestrconsts.liscodehelpshortdescriptionof 6493msgid "Short description of" 6494msgstr "Kısa açıklama" 6495 6496#: lazarusidestrconsts.liscodehelpshorttag 6497msgid "Short" 6498msgstr "Kısa" 6499 6500#: lazarusidestrconsts.liscodeobignoreconstinfuncs 6501msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" 6502msgid "Ignore constants in next functions" 6503msgstr "Bir sonraki işleve ait sabitler yoksayılanlar" 6504 6505#: lazarusidestrconsts.liscodeobscharconst 6506msgctxt "lazarusidestrconsts.liscodeobscharconst" 6507msgid "Search for unnamed char constants" 6508msgstr "İsimlendirilmemiş karakter sabitlerinde arama" 6509 6510#: lazarusidestrconsts.liscodeobserver 6511msgid "Code Observer" 6512msgstr "Kod Gözlemci" 6513 6514#: lazarusidestrconsts.liscodeobsignoreeconstants 6515msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" 6516msgid "Ignore next unnamed constants" 6517msgstr "Sonraki adsız sabitleri yoksay" 6518 6519#: lazarusidestrconsts.liscodetempladd 6520msgctxt "lazarusidestrconsts.liscodetempladd" 6521msgid "Add template" 6522msgstr "Şablon ekle" 6523 6524#: lazarusidestrconsts.liscodetempladdcodetemplate 6525msgid "Add code template" 6526msgstr "Kod şablonu ekle" 6527 6528#: lazarusidestrconsts.liscodetemplatokenalreadyexists 6529#, object-pascal-format 6530msgid " A token \"%s\" already exists! " 6531msgstr " \"%s\" simgesi zaten var! " 6532 6533#: lazarusidestrconsts.liscodetemplautocompleteon 6534msgid "Auto complete on" 6535msgstr "Otomatik Tamamlama" 6536 6537#: lazarusidestrconsts.liscodetemplchange 6538msgctxt "lazarusidestrconsts.liscodetemplchange" 6539msgid "Change" 6540msgstr "Değiştir" 6541 6542#: lazarusidestrconsts.liscodetemplcomment 6543msgid "Comment:" 6544msgstr "Açıklama:" 6545 6546#: lazarusidestrconsts.liscodetempleditcodetemplate 6547msgid "Edit code template" 6548msgstr "Kod şablonunu düzenle" 6549 6550#: lazarusidestrconsts.liscodetemplerror 6551msgctxt "lazarusidestrconsts.liscodetemplerror" 6552msgid "Error" 6553msgstr "Hata" 6554 6555#: lazarusidestrconsts.liscodetempltoken 6556msgid "Token:" 6557msgstr "Jeton:" 6558 6559#: lazarusidestrconsts.liscodetoolsdefsaction 6560#, object-pascal-format 6561msgid "Action: %s" 6562msgstr "Eylem: %s" 6563 6564#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly 6565#, object-pascal-format 6566msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes." 6567msgstr "Otomatik oluşturulmuş düğümler düzenlenemez, %snor otomatik oluşturulmamış alt düğümlere sahip olabilirler." 6568 6569#: lazarusidestrconsts.liscodetoolsdefsautogenerated 6570#, object-pascal-format 6571msgid "%s, auto generated" 6572msgstr "%s, otomatik oluşturuldu" 6573 6574#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited 6575msgid "Auto generated nodes cannot be edited." 6576msgstr "Otomatik oluşturulmuş düğümler düzenlenemez." 6577 6578#: lazarusidestrconsts.liscodetoolsdefsblock 6579msgid "Block" 6580msgstr "Blok" 6581 6582#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor 6583msgid "CodeTools Defines Editor" 6584msgstr "Kod Araçları Editörü Tanımları" 6585 6586#: lazarusidestrconsts.liscodetoolsdefscompilerpath 6587msgid "Compiler path" 6588msgstr "Derleyici yolu" 6589 6590#: lazarusidestrconsts.liscodetoolsdefsconvertnode 6591msgid "Convert node" 6592msgstr "Düğümü dönüştür" 6593 6594#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory 6595#, object-pascal-format 6596msgid "Create Defines for %s Directory" 6597msgstr "%s Dizini için Tanımlar Oluştur" 6598 6599#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler 6600msgid "Create Defines for Free Pascal Compiler" 6601msgstr "Free Pascal Derleyici için Tanımlar Oluştur" 6602 6603#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources 6604#, fuzzy 6605#| msgid "Create Defines for Free Pascal SVN Sources" 6606msgid "Create Defines for Free Pascal Git Sources" 6607msgstr "Free Pascal SVN Kaynakları için Tanımlar Oluştur" 6608 6609#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject 6610#, object-pascal-format 6611msgid "Create Defines for %s Project" 6612msgstr "%s Projesi için Tanımlar Oluştur" 6613 6614#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory 6615msgid "Create FPC Macros and paths for a fpc project directory" 6616msgstr "Bir fpc proje dizini için FPC Makroları ve yolları oluşturma" 6617 6618#: lazarusidestrconsts.liscodetoolsdefsdefine 6619msgid "Define" 6620msgstr "Tanımla" 6621 6622#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse 6623msgid "Define Recurse" 6624msgstr "Recurse Tanımla" 6625 6626#: lazarusidestrconsts.liscodetoolsdefsdeletenode 6627msgid "Delete node" 6628msgstr "Düğümü sil" 6629 6630#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc 6631#, object-pascal-format 6632msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" 6633msgstr "%s ana dizini,%s, Borland'ın tüm%s kaynaklarını yüklediği yer.%s Örneğin: C:/Program/Borland/Delphi%s" 6634 6635#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject 6636#, object-pascal-format 6637msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" 6638msgstr "%s ana dizini,%s borland'ın tüm s kaynağını yüklediği%s,%s bu%s projesi tarafından kullanılıyor.%s Örneğin: C:/Program/Borland/Delphi%s" 6639 6640#: lazarusidestrconsts.liscodetoolsdefsdescription 6641msgid "Description:" 6642msgstr "Açıklama:" 6643 6644#: lazarusidestrconsts.liscodetoolsdefsdirectory 6645#, object-pascal-format 6646msgid "%s directory" 6647msgstr "%s dizini" 6648 6649#: lazarusidestrconsts.liscodetoolsdefselse 6650msgid "Else" 6651msgstr "Else" 6652 6653#: lazarusidestrconsts.liscodetoolsdefselseif 6654msgid "ElseIf" 6655msgstr "ElseIf" 6656 6657#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave 6658msgid "Exit without Save" 6659msgstr "Kaydetmeden Çık" 6660 6661#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory 6662#, fuzzy 6663#| msgid "FPC SVN source directory" 6664msgid "FPC Git source directory" 6665msgstr "FPC SVN kaynak dizini" 6666 6667#: lazarusidestrconsts.liscodetoolsdefsif 6668msgid "If" 6669msgstr "If" 6670 6671#: lazarusidestrconsts.liscodetoolsdefsifdef 6672msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef" 6673msgid "IfDef" 6674msgstr "Ifdef" 6675 6676#: lazarusidestrconsts.liscodetoolsdefsifndef 6677msgid "IfNDef" 6678msgstr "IfNDef" 6679 6680#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory 6681msgid "Directory" 6682msgstr "Dizin" 6683 6684#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp 6685msgid "Insert Delphi 5 Compiler Template" 6686msgstr "Delphi 5 Derleyici Şablonunu Ekle" 6687 6688#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem 6689msgid "Insert Delphi 5 Directory Template" 6690msgstr "Delphi 5 Dizin Şablonunu Ekle" 6691 6692#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl 6693msgid "Insert Delphi 5 Project Template" 6694msgstr "Delphi 5 Proje Şablonunu Ekle" 6695 6696#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp 6697msgid "Insert Delphi 6 Compiler Template" 6698msgstr "Delphi 6 Derleyici Şablonunu Ekle" 6699 6700#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem 6701msgid "Insert Delphi 6 Directory Template" 6702msgstr "Delphi 6 Dizin Şablonunu Ekle" 6703 6704#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl 6705msgid "Insert Delphi 6 Project Template" 6706msgstr "Delphi 6 Proje Şablonunu Ekle" 6707 6708#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp 6709msgid "Insert Delphi 7 Compiler Template" 6710msgstr "Delphi 7 Derleyici Şablonunu Ekle" 6711 6712#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem 6713msgid "Insert Delphi 7 Directory Template" 6714msgstr "Delphi 7 Dizin Şablonunu Ekle" 6715 6716#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl 6717msgid "Insert Delphi 7 Project Template" 6718msgstr "Delphi 7 Proje Şablonunu Ekle" 6719 6720#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert 6721msgid "Insert Free Pascal Compiler Template" 6722msgstr "Free Pascal Derleyici Şablonu Ekle" 6723 6724#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte 6725msgid "Insert Free Pascal Project Template" 6726msgstr "Free Pascal Proje Şablonunu Ekle" 6727 6728#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource 6729#, fuzzy 6730#| msgid "Insert Free Pascal SVN Source Template" 6731msgid "Insert Free Pascal Git Source Template" 6732msgstr "Free Pascal SVN Kaynak Şablonu Ekle" 6733 6734#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp 6735msgid "Insert Kylix 3 Compiler Template" 6736msgstr "Kylix 3 Derleyici Şablonunu Ekle" 6737 6738#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem 6739msgid "Insert Kylix 3 Directory Template" 6740msgstr "Kylix 3 Dizin Şablonunu Ekle" 6741 6742#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl 6743msgid "Insert Kylix 3 Project Template" 6744msgstr "Kylix 3 Proje Şablonunu Ekle" 6745 6746#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild 6747msgid "Insert node as child" 6748msgstr "Düğümü çocuk olarak yerleştir" 6749 6750#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow 6751msgid "Insert node below" 6752msgstr "Aşağıdaki düğümü ekleyin" 6753 6754#: lazarusidestrconsts.liscodetoolsdefsinserttemplate 6755msgid "Insert Template" 6756msgstr "Şablon Ekle" 6757 6758#: lazarusidestrconsts.liscodetoolsdefsinvalidparent 6759msgid "Invalid parent" 6760msgstr "Geçersiz ebeveyn" 6761 6762#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode 6763msgid "Invalid parent node" 6764msgstr "Geçersiz üst düğüm" 6765 6766#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode 6767msgid "Invalid previous node" 6768msgstr "Geçersiz önceki düğüm" 6769 6770#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc 6771#, object-pascal-format 6772msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" 6773msgstr "%s ana dizini,%s Borland, tüm %s kaynaklarını yükledi.%sÖrneğin:/home/user/kylix%s" 6774 6775#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject 6776#, object-pascal-format 6777msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" 6778msgstr "%s ana dizini,%s burada Borland'ın tüm%s kaynaklarını yüklediği,%s bu%s projesi tarafından kullanılıyor.%s Örneğin:/home/user/kylix%s" 6779 6780#: lazarusidestrconsts.liscodetoolsdefsmovenodedown 6781msgid "Move node down" 6782msgstr "Düğümü aşağıya taşı" 6783 6784#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown 6785msgid "Move node one level down" 6786msgstr "Düğümü Bir seviye aşağıya taşı" 6787 6788#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup 6789msgid "Move node one level up" 6790msgstr "Düğümü Bir seviye yukarı taşı" 6791 6792#: lazarusidestrconsts.liscodetoolsdefsmovenodeup 6793msgid "Move node up" 6794msgstr "Düğümü yukarıya taşı" 6795 6796#: lazarusidestrconsts.liscodetoolsdefsname 6797msgctxt "lazarusidestrconsts.liscodetoolsdefsname" 6798msgid "Name:" 6799msgstr "Ad:" 6800 6801#: lazarusidestrconsts.liscodetoolsdefsnewnode 6802msgid "NewNode" 6803msgstr "NewNode" 6804 6805#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly 6806msgid "Node is readonly" 6807msgstr "Düğüm salt okunur" 6808 6809#: lazarusidestrconsts.liscodetoolsdefsnoneselected 6810msgid "none selected" 6811msgstr "hiçbiri seçilmedi" 6812 6813#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch 6814msgid "Parent node cannot contain child nodes." 6815msgstr "Üst düğüm alt düğümleri içeremez." 6816 6817#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes 6818msgid "Previous node can not contain child nodes." 6819msgstr "Önceki düğüm alt düğümleri içeremez." 6820 6821#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory 6822msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" 6823msgid "Project directory" 6824msgstr "Proje dizini" 6825 6826#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 6827#, object-pascal-format 6828msgid "%s project directory" 6829msgstr "%s proje dizini" 6830 6831#: lazarusidestrconsts.liscodetoolsdefsreaderror 6832msgid "Read error" 6833msgstr "Okuma hatası" 6834 6835#: lazarusidestrconsts.liscodetoolsdefssaveandexit 6836msgid "Save and Exit" 6837msgstr "Kaydet ve çık" 6838 6839#: lazarusidestrconsts.liscodetoolsdefsselectednode 6840msgid "Selected Node:" 6841msgstr "Seçili Düğüm:" 6842 6843#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory 6844#, fuzzy 6845#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging." 6846msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging." 6847msgstr "Free Pascal SVN kaynak dizini. Gerekli değil. Bu, bulma bildirimini ve hata ayıklamayı iyileştirecektir." 6848 6849#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory 6850msgid "The Free Pascal project directory." 6851msgstr "Free Pascal proje dizini." 6852 6853#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir 6854#, fuzzy 6855#| msgid "The Free Pascal SVN source directory." 6856msgid "The Free Pascal Git source directory." 6857msgstr "Serbest Pascal SVN kaynak dizini." 6858 6859#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample 6860#, object-pascal-format 6861msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 6862msgstr "Serbest Pascal derleyici yolu %s Örneğin %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 6863 6864#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject 6865#, fuzzy 6866#| msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." 6867msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros." 6868msgstr "Ekstra Hile Geçişi Bu proje için Ücretsiz Pascal derleyicisine giden yol. Sadece aşağıdaki FPC SVN kaynağını ayarlarsanız gereklidir. Makroları otomatik olarak oluşturmak için kullanılır." 6869 6870#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa 6871#, object-pascal-format 6872msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." 6873msgstr "Bu kaynak için Free Pascal derleyicisinin yolu %s makroları otomatikleştirmek için kullanıldı." 6874 6875#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory 6876#, object-pascal-format 6877msgid "The %s project directory,%swhich contains the .dpr, dpk file." 6878msgstr "%s proje dizini, .dpr, dpk dosyasını içeren%s." 6879 6880#: lazarusidestrconsts.liscodetoolsdefsundefine 6881msgid "Undefine" 6882msgstr "Tanımsız" 6883 6884#: lazarusidestrconsts.liscodetoolsdefsundefineall 6885msgid "Undefine All" 6886msgstr "Hepsini tanımla" 6887 6888#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse 6889msgid "Undefine Recurse" 6890msgstr "Recurse'u tanımlayın" 6891 6892#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths 6893msgid "Value as File Paths" 6894msgstr "Dosya Yolları Olarak Değer" 6895 6896#: lazarusidestrconsts.liscodetoolsdefsvalueastext 6897msgid "Value as Text" 6898msgstr "Metin Olarak Değer" 6899 6900#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid 6901#, object-pascal-format 6902msgid "%s:%svalue \"%s\" is invalid." 6903msgstr "%s: %sdeğer \"%s\" geçersiz." 6904 6905#: lazarusidestrconsts.liscodetoolsdefsvariable 6906msgid "Variable:" 6907msgstr "Değişken:" 6908 6909#: lazarusidestrconsts.liscodetoolsdefswriteerror 6910msgid "Write error" 6911msgstr "Yazma hatası" 6912 6913#: lazarusidestrconsts.liscodetoolsoptsat 6914msgid "At" 6915msgstr "At" 6916 6917#: lazarusidestrconsts.liscodetoolsoptsbracket 6918msgid "Bracket" 6919msgstr "Parantez" 6920 6921#: lazarusidestrconsts.liscodetoolsoptscaret 6922msgid "Caret (^)" 6923msgstr "Şapka işareti (^)" 6924 6925#: lazarusidestrconsts.liscodetoolsoptscolon 6926msgid "Colon" 6927msgstr "Kolon" 6928 6929#: lazarusidestrconsts.liscodetoolsoptscomma 6930msgid "Comma" 6931msgstr "Virgül" 6932 6933#: lazarusidestrconsts.liscodetoolsoptsidentifier 6934msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" 6935msgid "Identifier" 6936msgstr "Tanımlayıcı" 6937 6938#: lazarusidestrconsts.liscodetoolsoptskeyword 6939msgid "Keyword" 6940msgstr "Anahtar kelime" 6941 6942#: lazarusidestrconsts.liscodetoolsoptsnewline 6943msgid "Newline" 6944msgstr "Yenisatır" 6945 6946#: lazarusidestrconsts.liscodetoolsoptsnone 6947msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" 6948msgid "None" 6949msgstr "Yok" 6950 6951#: lazarusidestrconsts.liscodetoolsoptsnumber 6952msgid "Number" 6953msgstr "Numara" 6954 6955#: lazarusidestrconsts.liscodetoolsoptspoint 6956msgid "Point" 6957msgstr "Nokta" 6958 6959#: lazarusidestrconsts.liscodetoolsoptssemicolon 6960msgid "Semicolon" 6961msgstr "Noktalı virgül" 6962 6963#: lazarusidestrconsts.liscodetoolsoptsspace 6964msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" 6965msgid "Space" 6966msgstr "Boşluk" 6967 6968#: lazarusidestrconsts.liscodetoolsoptsstringconst 6969msgid "String constant" 6970msgstr "Sabit sitring" 6971 6972#: lazarusidestrconsts.liscodetoolsoptssymbol 6973msgid "Symbol" 6974msgstr "Sembol" 6975 6976#: lazarusidestrconsts.liscoexecuteafter 6977msgid "Execute after" 6978msgstr "Sonra çalıştır" 6979 6980#: lazarusidestrconsts.liscoexecutebefore 6981msgid "Execute before" 6982msgstr "Önce çalıştır" 6983 6984#: lazarusidestrconsts.liscoladdress 6985msgid "Address" 6986msgstr "Adres" 6987 6988#: lazarusidestrconsts.liscolclass 6989msgid "Class" 6990msgstr "Sınıf" 6991 6992#: lazarusidestrconsts.liscollapseall 6993msgid "Collapse All (/)" 6994msgstr "Tümünü daralt (/)" 6995 6996#: lazarusidestrconsts.liscollapseallclasses 6997msgid "Collapse all classes" 6998msgstr "Tüm sınıfları daralt" 6999 7000#: lazarusidestrconsts.liscollapseallpackages 7001msgid "Collapse all packages" 7002msgstr "Tüm paketleri daralt" 7003 7004#: lazarusidestrconsts.liscollapseallunits 7005msgid "Collapse all units" 7006msgstr "Tüm birimleri daralt" 7007 7008#: lazarusidestrconsts.liscolreturns 7009msgid "Returns" 7010msgstr "Dönüş" 7011 7012#: lazarusidestrconsts.liscolvisibility 7013msgid "Visibility" 7014msgstr "Görünürlük" 7015 7016#: lazarusidestrconsts.liscomboboxes 7017msgid "Combo Boxes" 7018msgstr "Açılır liste" 7019 7020#: lazarusidestrconsts.liscommandlineparameters 7021msgctxt "lazarusidestrconsts.liscommandlineparameters" 7022msgid "Command line parameters" 7023msgstr "Komut satırı parametreleri" 7024 7025#: lazarusidestrconsts.liscommandlineparamsofprogram 7026msgid "Command line parameters of program" 7027msgstr "Programın komut satırı parametreleri" 7028 7029#: lazarusidestrconsts.liscompile 7030msgctxt "lazarusidestrconsts.liscompile" 7031msgid "Compile" 7032msgstr "Derle" 7033 7034#: lazarusidestrconsts.liscompileanddonotaskagain 7035msgid "Compile and do not ask again" 7036msgstr "Derle ve tekrar sorma" 7037 7038#: lazarusidestrconsts.liscompilefollowingmodes 7039msgid "Compile the following modes" 7040msgstr "Aşağıdaki modları derleyin" 7041 7042#: lazarusidestrconsts.liscompileproject 7043msgid "Compile Project" 7044msgstr "Projeyi Derle" 7045 7046#: lazarusidestrconsts.liscompiler 7047msgid "Compiler" 7048msgstr "Derleyici" 7049 7050#: lazarusidestrconsts.liscompilercfgismissing 7051#, object-pascal-format 7052msgid "%s is missing." 7053msgstr "%s kayıp." 7054 7055#: lazarusidestrconsts.liscompilerdoesnotsupporttarget 7056#, object-pascal-format 7057msgid "Compiler \"%s\" does not support target %s-%s" 7058msgstr "Derleyici \"%s\" hedef %s- %s'yi desteklemez" 7059 7060#: lazarusidestrconsts.liscompilererrorinvalidcompiler 7061#, object-pascal-format 7062msgid "Error: invalid compiler: %s" 7063msgstr "Hata: geçersiz derleyici: %s" 7064 7065#: lazarusidestrconsts.liscompilerfilename 7066msgid "Compiler filename" 7067msgstr "Derleyici dosya adı" 7068 7069#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath 7070msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" 7071msgstr "İpucu: Araçlar -> Seçenekler -> Dosyalar -> Derleyici Yolu'nda derleyici yolunu ayarlayabilirsiniz" 7072 7073#: lazarusidestrconsts.liscompilermessagesfilenotfound 7074#, object-pascal-format 7075msgid "Compiler messages file not found:%s%s" 7076msgstr "Derleyici iletileri dosyası bulunamadı: %s %s" 7077 7078#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults 7079msgid "NOTE: codetools config file not found - using defaults" 7080msgstr "NOT: codetools yapılandırma dosyası bulunamadı - varsayılanları kullanarak" 7081 7082#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile 7083msgid "NOTE: loading old codetools options file: " 7084msgstr "NOT: eski codetools seçenek dosyaları yükleniyor: " 7085 7086#: lazarusidestrconsts.liscompilestage 7087msgctxt "lazarusidestrconsts.liscompilestage" 7088msgid "Compile" 7089msgstr "Derle" 7090 7091#: lazarusidestrconsts.liscompilewithprojectsettings 7092msgid "Compile with project settings" 7093msgstr "Proje ayarlarıyla derle" 7094 7095#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates 7096msgid "Compile with -vd for more details. Check for duplicates." 7097msgstr "Daha fazla ayrıntı için -vd ile derleyin.Yinelenenleri kontrol edin." 7098 7099#: lazarusidestrconsts.liscompiling 7100#, object-pascal-format 7101msgid "%s (compiling ...)" 7102msgstr "%s (derleniyor ...)" 7103 7104#: lazarusidestrconsts.liscompletionlonglinehinttype 7105msgid "Show long line hints" 7106msgstr "Uzun satır ipuçlarını göster" 7107 7108#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft 7109msgid "Extend far left" 7110msgstr "En sola doğru uzatın" 7111 7112#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft 7113msgid "Extend some left" 7114msgstr "Biraz uzat" 7115 7116#: lazarusidestrconsts.liscompletionlonglinehinttypenone 7117msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" 7118msgid "Never" 7119msgstr "Asla" 7120 7121#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly 7122msgid "Extend right only" 7123msgstr "Yalnızca genişlet" 7124 7125#: lazarusidestrconsts.liscomponentnameisapascalkeyword 7126#, object-pascal-format 7127msgid "Component name \"%s\" is a Pascal keyword." 7128msgstr "Bileşen adı \"%s\" Pascal bir anahtar kelimedir." 7129 7130#: lazarusidestrconsts.liscomponentnameiskeyword 7131#, object-pascal-format 7132msgid "Component name \"%s\" is keyword" 7133msgstr "Bileşen adı \"%s\" anahtar kelime" 7134 7135#: lazarusidestrconsts.liscomponentnameisnotavalididentifier 7136#, object-pascal-format 7137msgid "Component name \"%s\" is not a valid identifier" 7138msgstr "Bileşen adı \"%s\" geçerli bir tanımlayıcı değil" 7139 7140#: lazarusidestrconsts.liscomppalcomponentlist 7141msgid "View All" 7142msgstr "Hepsini gör" 7143 7144#: lazarusidestrconsts.liscomppalopenpackage 7145msgid "Open package" 7146msgstr "Paketi aç" 7147 7148#: lazarusidestrconsts.liscomppalopenunit 7149msgid "Open unit" 7150msgstr "Birimi Aç" 7151 7152#: lazarusidestrconsts.liscompress 7153msgid "Compress" 7154msgstr "Sıkıştır" 7155 7156#: lazarusidestrconsts.liscompresshint 7157msgid "The resulting directory will be compressed into a ZIP file." 7158msgstr "Çıkan dizin bir ZIP dosyasına sıkıştırılacaktır." 7159 7160#: lazarusidestrconsts.liscomptest 7161msgctxt "lazarusidestrconsts.liscomptest" 7162msgid "&Test" 7163msgstr "&Test" 7164 7165#: lazarusidestrconsts.liscondition 7166msgid "Condition" 7167msgstr "Şart" 7168 7169#: lazarusidestrconsts.lisconditionals 7170msgctxt "lazarusidestrconsts.lisconditionals" 7171msgid "Conditionals" 7172msgstr "Şartlılar" 7173 7174#: lazarusidestrconsts.lisconfigdirectory 7175msgid "Lazarus config directory" 7176msgstr "Lazarus yapılandırma dizini" 7177 7178#: lazarusidestrconsts.lisconfigfileofadditions 7179msgid "Config file of additions:" 7180msgstr "Eklemelerin yapılandırma dosyası:" 7181 7182#: lazarusidestrconsts.lisconfigurebuild 7183#, object-pascal-format 7184msgid "Configure Build %s" 7185msgstr "%s Derlemeyi Yapılandır" 7186 7187#: lazarusidestrconsts.lisconfigurebuildlazarus 7188msgid "Configure \"Build Lazarus\"" 7189msgstr "\"Lazarus Oluştur\" u yapılandır" 7190 7191#: lazarusidestrconsts.lisconfigureeditortoolbar 7192msgid "Configure Toolbar" 7193msgstr "Araç Çubuğunu Yapılandır" 7194 7195#: lazarusidestrconsts.lisconfigurelazaruside 7196msgid "Configure Lazarus IDE" 7197msgstr "Lazarus IDE yi Yapılandır" 7198 7199#: lazarusidestrconsts.lisconfirm 7200msgid "Confirm" 7201msgstr "Onayla" 7202 7203#: lazarusidestrconsts.lisconfirmation 7204msgid "Confirmation" 7205msgstr "Onayla" 7206 7207#: lazarusidestrconsts.lisconfirmbuildallprofiles 7208#, object-pascal-format 7209msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" 7210msgstr "Lazarus aşağıdaki profillerle tekrar oluşturulacaktır: %sDevam edilsin mi?" 7211 7212#: lazarusidestrconsts.lisconfirmchanges 7213msgid "Confirm changes" 7214msgstr "Değişiklikleri onayla" 7215 7216#: lazarusidestrconsts.lisconfirmdelete 7217msgid "Confirm delete" 7218msgstr "Silmeyi onayla" 7219 7220#: lazarusidestrconsts.lisconfirmlazarusrebuild 7221#, object-pascal-format 7222msgid "Do you want to rebuild Lazarus with profile: %s?" 7223msgstr "Lazarus'u profil ile yeniden oluşturmak ister misiniz: %s?" 7224 7225#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide 7226msgid "Confirm new package set for the IDE" 7227msgstr "IDE için yeni paket setini onaylayın" 7228 7229#: lazarusidestrconsts.lisconfirmpackageaction 7230msgctxt "lazarusidestrconsts.lisconfirmpackageaction" 7231msgid "Action" 7232msgstr "Aksiyon" 7233 7234#: lazarusidestrconsts.lisconfirmpackagenewpackageset 7235msgid "New package set" 7236msgstr "Yeni paket seti" 7237 7238#: lazarusidestrconsts.lisconfirmpackageoldpackageset 7239msgid "Old package set" 7240msgstr "Eski paket seti" 7241 7242#: lazarusidestrconsts.lisconflict 7243msgid "Conflict" 7244msgstr "Çakışma" 7245 7246#: lazarusidestrconsts.lisconflictdetected 7247msgid "Conflict detected" 7248msgstr "Çakışma algılandı" 7249 7250#: lazarusidestrconsts.lisconsoleapplication 7251msgid "Console application" 7252msgstr "Konsol uygulaması" 7253 7254#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor 7255msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc." 7256msgstr "Komut satırı seçeneklerini kolayca kontrol etmek için TCustomApplication kullanarak bir Free Pascal komut satırı programı." 7257 7258#: lazarusidestrconsts.lisconstructorcode 7259msgid "Constructor code" 7260msgstr "Yapıcı kodu" 7261 7262#: lazarusidestrconsts.liscontains 7263msgid "contains" 7264msgstr "içerir" 7265 7266#: lazarusidestrconsts.liscontents 7267msgctxt "lazarusidestrconsts.liscontents" 7268msgid "Contents" 7269msgstr "İçerik" 7270 7271#: lazarusidestrconsts.liscontextsensitive 7272msgid "Context sensitive" 7273msgstr "İçeriğe duyarlı" 7274 7275#: lazarusidestrconsts.liscontinue 7276msgctxt "lazarusidestrconsts.liscontinue" 7277msgid "Continue" 7278msgstr "Devam et" 7279 7280#: lazarusidestrconsts.liscontinueanddonotaskagain 7281msgid "Continue and do not ask again" 7282msgstr "Devam et ve tekrar sorma" 7283 7284#: lazarusidestrconsts.liscontinuebuilding 7285msgid "Continue building" 7286msgstr "Yapılandırmaya devam et" 7287 7288#: lazarusidestrconsts.liscontinuewithoutloadingform 7289msgid "Continue without loading form" 7290msgstr "Formu yüklemeden devam et" 7291 7292#: lazarusidestrconsts.liscontributors 7293msgid "Contributors" 7294msgstr "Katkıda Bulunanlar" 7295 7296#: lazarusidestrconsts.liscontrolneedsparent 7297msgid "Control needs parent" 7298msgstr "Kontrolün ebeveynlere ihtiyacı var" 7299 7300#: lazarusidestrconsts.lisconvaddcommentafterreplacement 7301msgid "Add comment after replacement" 7302msgstr "Değiştirmeden sonra yorum ekle" 7303 7304#: lazarusidestrconsts.lisconvaddedmodedelphimodifier 7305msgid "Added MODE Delphi syntax modifier after unit name." 7306msgstr "Birim adından sonra MODE Delphi sözdizimi değiştiricisi eklendi." 7307 7308#: lazarusidestrconsts.lisconvaddingflagforregister 7309#, object-pascal-format 7310msgid "Adding flag for \"Register\" procedure in unit %s." 7311msgstr "%s biriminde \"Register\" işlemi için bayrak eklenmesi." 7312 7313#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc 7314#, object-pascal-format 7315msgid "\")\" is missing from replacement function: %s" 7316msgstr "Değiştirme fonksiyonunda \")\" eksik: %s" 7317 7318#: lazarusidestrconsts.lisconvbracketnotfound 7319msgid "Bracket not found" 7320msgstr "Parantez bulunamadı" 7321 7322#: lazarusidestrconsts.lisconvconvertedfrom 7323#, object-pascal-format 7324msgid " { *Converted from %s* }" 7325msgstr " {*%s dan çevirildi *}" 7326 7327#: lazarusidestrconsts.lisconvcoordhint 7328msgid "An offset is added to Top coordinate of controls inside visual containers" 7329msgstr "Görsel kaplardaki denetimlerin üst koordinatına bir ofset eklenir" 7330 7331#: lazarusidestrconsts.lisconvcoordoffs 7332msgid "Coordinate offsets" 7333msgstr "Koordinat ofsetleri" 7334 7335#: lazarusidestrconsts.lisconvdeletedfile 7336#, object-pascal-format 7337msgid "Deleted file %s" 7338msgstr "%s dosyası silindi" 7339 7340#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines 7341#, object-pascal-format 7342msgid "Added defines %s in custom options" 7343msgstr "Eklenen %s, özel seçenekler" 7344 7345#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency 7346#, object-pascal-format 7347msgid "Added Package %s as a dependency." 7348msgstr "%s paketi bağımlılık olarak eklendi." 7349 7350#: lazarusidestrconsts.lisconvdelphiaddedunittousessection 7351#, object-pascal-format 7352msgid "Added unit \"%s\" to uses section." 7353msgstr "USES bölümüne \"%s\" birimi eklendi." 7354 7355#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned 7356msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" 7357msgid "All sub-directories will be scanned for unit files" 7358msgstr "Tüm alt dizinler birim dosyalar için taranacak" 7359 7360#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed 7361msgid "BeginCodeTools failed!" 7362msgstr "BeginCodeTools başarısız oldu!" 7363 7364#: lazarusidestrconsts.lisconvdelphicategories 7365msgid "Categories:" 7366msgstr "Kategoriler:" 7367 7368#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 7369#, object-pascal-format 7370msgid "Changed encoding from %s to UTF-8" 7371msgstr "%s 'den UTF-8'e kodlama değiştirildi" 7372 7373#: lazarusidestrconsts.lisconvdelphiconversionaborted 7374msgid "Conversion Aborted." 7375msgstr "Dönüşüm Durduruldu." 7376 7377#: lazarusidestrconsts.lisconvdelphiconversionready 7378msgid "Conversion Ready." 7379msgstr "Dönüşüm Hazır." 7380 7381#: lazarusidestrconsts.lisconvdelphiconversiontook 7382#, object-pascal-format 7383msgid "Conversion took: %s" 7384msgstr "Dönüşüm alındı: %s" 7385 7386#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage 7387msgid "Convert Delphi package" 7388msgstr "Delphi paketini dönüştür" 7389 7390#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject 7391msgid "Convert Delphi project" 7392msgstr "Delphi projesini dönüştür" 7393 7394#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit 7395msgid "Convert Delphi unit" 7396msgstr "Delphi birimini dönüştür" 7397 7398#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits 7399msgid "*** Converting unit files found during conversion ***" 7400msgstr "*** Dönüştürme sırasında bulunan birim dosyalarını dönüştürme ***" 7401 7402#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits 7403msgid "*** Converting unit files belonging to project/package ***" 7404msgstr "*** Proje/pakete ait birim dosyalarının dönüştürülmesi ***" 7405 7406#: lazarusidestrconsts.lisconvdelphierror 7407#, object-pascal-format 7408msgid "Error=\"%s\"" 7409msgstr "Hata = \"%s\"" 7410 7411#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion 7412msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." 7413msgstr "Birim dönüştürme sırasında istisna oldu. Dönüştürülmüş haldeki birimlerin form dosyalarına devam edilmesi..." 7414 7415#: lazarusidestrconsts.lisconvdelphifailedconvertingunit 7416msgid "Failed converting unit" 7417msgstr "Birim dönüştürme başarısız oldu" 7418 7419#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit 7420#, object-pascal-format 7421msgid "Failed to convert unit \"%s\"" 7422msgstr "Birimi dönüştürme başarısız \"%s\"" 7423 7424#: lazarusidestrconsts.lisconvdelphifixedunitcase 7425#, object-pascal-format 7426msgid "Fixed character case of unit \"%s\" to \"%s\"." 7427msgstr "Birmin sabit karakter durumu \"%s\" den \"%s\"." 7428 7429#: lazarusidestrconsts.lisconvdelphifoundallunitfiles 7430msgid "Found all unit files" 7431msgstr "Bulunan tüm birim dosyalar" 7432 7433#: lazarusidestrconsts.lisconvdelphifunc 7434msgid "Delphi Function" 7435msgstr "Delphi Fonksiyonu" 7436 7437#: lazarusidestrconsts.lisconvdelphimissingincludefile 7438#, object-pascal-format 7439msgid "%s(%s,%s) missing include file" 7440msgstr "%s(%s,%s) eksik dosya içeriyor" 7441 7442#: lazarusidestrconsts.lisconvdelphiname 7443msgid "Delphi Name" 7444msgstr "Delphi Adı" 7445 7446#: lazarusidestrconsts.lisconvdelphipackagenameexists 7447msgid "Package name exists" 7448msgstr "Paket adı zaten var" 7449 7450#: lazarusidestrconsts.lisconvdelphipackagerequired 7451#, object-pascal-format 7452msgid "Package %s is required but not installed in Lazarus! Install it later." 7453msgstr "%s paketi gerekli ancak Lazarus'ta yüklü değil! Daha sonra kurun." 7454 7455#: lazarusidestrconsts.lisconvdelphiprojomittedunit 7456#, object-pascal-format 7457msgid "Omitted unit %s from project" 7458msgstr "Projeden %s birimi çıkarıldı" 7459 7460#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection 7461#, object-pascal-format 7462msgid "Removed unit \"%s\" from uses section." 7463msgstr "USES bölümünden \"%s\" birimi kaldırıldı." 7464 7465#: lazarusidestrconsts.lisconvdelphirepairingformfiles 7466msgid "*** Fixing used units and Repairing form files ***" 7467msgstr "*** Kullanılmış birimleri düzeltme ve form dosyalarını onarma ***" 7468 7469#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection 7470#, object-pascal-format 7471msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" 7472msgid "Replaced unit \"%s\" with \"%s\" in uses section." 7473msgstr "Uses bölümünde \"%s\" birimi \"%s\" ile değiştirildi." 7474 7475#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa 7476#, object-pascal-format 7477msgid "There is already a package with the name \"%s\"%sPlease close this package first." 7478msgstr "\"%s\" adında bir paket zaten var %s İlk önce bu paketi kapatın." 7479 7480#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl 7481msgid "Unitname exists in LCL" 7482msgstr "Birimadı LCL'de var" 7483 7484#: lazarusidestrconsts.lisconvdelphiunitstoreplacein 7485#, object-pascal-format 7486msgid "Units to replace in %s" 7487msgstr "%s içinde değiştirilecek birimler" 7488 7489#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl 7490#, object-pascal-format 7491msgid "LCL already has a unit with name %s. Delete local file %s?" 7492msgstr "LCL zaten %s ismine sahip bir birime sahip. Yerel dosya %s silinsin mi?" 7493 7494#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet 7495msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages." 7496msgstr ".dproj dosyası henüz desteklenmiyor. Dosya Delphi 2007 ve daha yeni tarafından kullanılır. Lütfen projeler için bir .dpr dosyası veya paketler için .dpk dosyasını seçin." 7497 7498#: lazarusidestrconsts.lisconversionerror 7499msgid "Conversion error" 7500msgstr "Dönüşüm hatası" 7501 7502#: lazarusidestrconsts.lisconvert 7503msgid "Convert" 7504msgstr "Dönüştür" 7505 7506#: lazarusidestrconsts.lisconvertencoding 7507msgid "Convert Encoding" 7508msgstr "Kodlamayı Dönüştür" 7509 7510#: lazarusidestrconsts.lisconvertencodingofprojectspackages 7511msgid "Convert encoding of projects/packages" 7512msgstr "Projelerin/paketlerin kodlamasını dönüştür" 7513 7514#: lazarusidestrconsts.lisconvertotherhint 7515msgid "Other options affecting the conversion" 7516msgstr "Dönüşümü etkileyen diğer seçenekler" 7517 7518#: lazarusidestrconsts.lisconvertprojectorpackage 7519msgid "Convert project or package" 7520msgstr "Proje veya paketi dönüştür" 7521 7522#: lazarusidestrconsts.lisconverttarget 7523msgid "Target" 7524msgstr "Hedef" 7525 7526#: lazarusidestrconsts.lisconverttargetcrossplatform 7527msgid "Cross-platform" 7528msgstr "Çapraz platform" 7529 7530#: lazarusidestrconsts.lisconverttargetcrossplatformhint 7531msgid "Cross-platform versus Windows-only" 7532msgstr "Yalnızca Windows'a karşı çapraz platform" 7533 7534#: lazarusidestrconsts.lisconverttargethint 7535msgid "Converter adds conditional compilation to support different targets" 7536msgstr "Dönüştürücü, farklı hedefleri desteklemek için koşullu derleme ekler" 7537 7538#: lazarusidestrconsts.lisconverttargetsamedfmfile 7539msgid "Use the same DFM form file" 7540msgstr "Aynı DFM form dosyasını kullan" 7541 7542#: lazarusidestrconsts.lisconverttargetsamedfmfilehint 7543msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" 7544msgstr "LFM'ye kopyalamak yerine Lazarus ve Delphi için aynı DFM dosyası" 7545 7546#: lazarusidestrconsts.lisconverttargetsupportdelphi 7547msgid "Support Delphi" 7548msgstr "Delphi desteği" 7549 7550#: lazarusidestrconsts.lisconverttargetsupportdelphihint 7551msgid "Use conditional compilation to support Delphi" 7552msgstr "Delphi'yi desteklemek için koşullu derleme kullanın" 7553 7554#: lazarusidestrconsts.lisconvfixedunitname 7555#, object-pascal-format 7556msgid "Fixed unit name from %s to %s." 7557msgstr "%s ile %s arasındaki sabit birim adı." 7558 7559#: lazarusidestrconsts.lisconvfuncreplacements 7560msgid "Function Replacements" 7561msgstr "Fonksiyon Değişiklikleri" 7562 7563#: lazarusidestrconsts.lisconvfuncreplhint 7564msgctxt "lazarusidestrconsts.lisconvfuncreplhint" 7565msgid "Some Delphi functions can be replaced with LCL function" 7566msgstr "Bazı Delphi fonksiyonları LCL fonksiyonuyla değiştirilebilir" 7567 7568#: lazarusidestrconsts.lisconvfuncstoreplace 7569msgid "Functions / procedures to replace" 7570msgstr "Değiştirilecek fonksiyonlar/prosedürler" 7571 7572#: lazarusidestrconsts.lisconvleftoff 7573msgid "Left offset" 7574msgstr "Sol ofset" 7575 7576#: lazarusidestrconsts.lisconvnewname 7577msgid "New Name" 7578msgstr "Yeni isim" 7579 7580#: lazarusidestrconsts.lisconvparentcontainer 7581msgid "Parent Container" 7582msgstr "Ebeveyn Konteyner" 7583 7584#: lazarusidestrconsts.lisconvproblemsfindingallunits 7585#, object-pascal-format 7586msgid "Problems when trying to find all units from project file %s" 7587msgstr "%s proje dosyasındaki tüm birimleri bulmaya çalışırken karşılaşılan sorunlar" 7588 7589#: lazarusidestrconsts.lisconvproblemsfixingincludefile 7590#, object-pascal-format 7591msgid "Problems when fixing include files in file %s" 7592msgstr "%s dosyasındaki dosyaları saptarken karşılaşılan sorunlar" 7593 7594#: lazarusidestrconsts.lisconvproblemsrepairingformfile 7595#, object-pascal-format 7596msgid "Problems when repairing form file %s" 7597msgstr "%s form dosyasını onarırken oluşan sorunlar" 7598 7599#: lazarusidestrconsts.lisconvrepairingincludefiles 7600msgid "Repairing include files : " 7601msgstr "Dahil edilen dosyaları tamir et: " 7602 7603#: lazarusidestrconsts.lisconvreplacedcall 7604#, object-pascal-format 7605msgid "Replaced call %s with %s" 7606msgstr "%s çağrısı %s ile değiştirildi" 7607 7608#: lazarusidestrconsts.lisconvreplfuncparameternum 7609#, object-pascal-format 7610msgid "Replacement function parameter number should be >= 1: %s" 7611msgstr "Değiştirme fonksiyonu parametre numarası > = 1 olmalıdır: %s" 7612 7613#: lazarusidestrconsts.lisconvshouldbefollowedbynumber 7614#, object-pascal-format 7615msgid "\"$\" should be followed by a number: %s" 7616msgstr "\"$\" Bir sayı ile takip edilmelidir: %s" 7617 7618#: lazarusidestrconsts.lisconvstoppedbecausethereispackage 7619msgid "Stopped because there already is a package with the same name" 7620msgstr "Durduruldu, çünkü aynı ada sahip bir paket zaten var" 7621 7622#: lazarusidestrconsts.lisconvthislogwassaved 7623#, object-pascal-format 7624msgid "This log was saved to %s" 7625msgstr "Bu günlük %s dosyasına kaydedildi" 7626 7627#: lazarusidestrconsts.lisconvtopoff 7628msgid "Top offset" 7629msgstr "Üst ofset" 7630 7631#: lazarusidestrconsts.lisconvtypereplacements 7632msgid "Type Replacements" 7633msgstr "Tip Değişiklikleri" 7634 7635#: lazarusidestrconsts.lisconvtypereplhint 7636msgid "Unknown types in form file (DFM/LFM)" 7637msgstr "Form dosyasında bilinmeyen türler (DFM / LFM)" 7638 7639#: lazarusidestrconsts.lisconvtypestoreplace 7640msgid "Types to replace" 7641msgstr "Değiştirilecek türler" 7642 7643#: lazarusidestrconsts.lisconvunitreplacements 7644msgid "Unit Replacements" 7645msgstr "Birim Değiştirme" 7646 7647#: lazarusidestrconsts.lisconvunitreplhint 7648msgid "Unit names in uses section of a source unit" 7649msgstr "Bir kaynak biriminin kullandığı bölümdeki birim adları" 7650 7651#: lazarusidestrconsts.lisconvunitstoreplace 7652msgid "Units to replace" 7653msgstr "Değiştirilecek birimler" 7654 7655#: lazarusidestrconsts.lisconvunknownprops 7656msgid "Unknown properties" 7657msgstr "Bilinmeyen özellikler" 7658 7659#: lazarusidestrconsts.lisconvuserselectedtoendconversion 7660#, object-pascal-format 7661msgid "User selected to end conversion with file %s" 7662msgstr "Kullanıcı, %s dosyası ile dönüşüm işlemini sonlandırmak için seçildi" 7663 7664#: lazarusidestrconsts.liscoolbaraddconfigdelete 7665msgid "Add/Config/Delete Toolbar(s)" 7666msgstr "Araç Çubuğu Ekle/Düzenle/Sil" 7667 7668#: lazarusidestrconsts.liscoolbaradddivider 7669msgid "Add Divider" 7670msgstr "Bölücü Ekle" 7671 7672#: lazarusidestrconsts.liscoolbaraddselected 7673msgid "Add selected item to toolbar" 7674msgstr "Seçilen öğeyi araç çubuğuna ekle" 7675 7676#: lazarusidestrconsts.liscoolbaravailablecommands 7677msgid "Available commands" 7678msgstr "Kullanılabilir komutlar" 7679 7680#: lazarusidestrconsts.liscoolbarborderstyle 7681msgid "Toolbars border style" 7682msgstr "Araç çubukları kenarlık stili" 7683 7684#: lazarusidestrconsts.liscoolbarborderstyleitem0 7685msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0" 7686msgid "None" 7687msgstr "Yok" 7688 7689#: lazarusidestrconsts.liscoolbarborderstyleitem1 7690msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1" 7691msgid "Single" 7692msgstr "Tek" 7693 7694#: lazarusidestrconsts.liscoolbarcodeexplorer 7695msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer" 7696msgid "Code Explorer" 7697msgstr "Kod Explorer" 7698 7699#: lazarusidestrconsts.liscoolbarcodetemplates 7700msgctxt "lazarusidestrconsts.liscoolbarcodetemplates" 7701msgid "Code Templates" 7702msgstr "Kod Şablonları" 7703 7704#: lazarusidestrconsts.liscoolbarconfigure 7705msgid "&Configure" 7706msgstr "&Yapılandır" 7707 7708#: lazarusidestrconsts.liscoolbardeletetoolbar 7709msgid "Are you sure you want to delete the selected toolbar?" 7710msgstr "Seçili araç çubuğunu silmek istediğinizden emin misiniz?" 7711 7712#: lazarusidestrconsts.liscoolbardeletewarning 7713msgid "There must be at least one toolbar!" 7714msgstr "En az bir araç çubuğu olmalıdır!" 7715 7716#: lazarusidestrconsts.liscoolbardesigner 7717msgid "Designer" 7718msgstr "Tasarım" 7719 7720#: lazarusidestrconsts.liscoolbargeneralsettings 7721msgid "General Coolbar Settings" 7722msgstr "Genel Coolbar Ayarları" 7723 7724#: lazarusidestrconsts.liscoolbargrabstyle 7725msgid "Toolbars grab style" 7726msgstr "Araç çubukları stili yakala" 7727 7728#: lazarusidestrconsts.liscoolbargrabstyleitem0 7729msgid "Simple" 7730msgstr "Basit" 7731 7732#: lazarusidestrconsts.liscoolbargrabstyleitem1 7733msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1" 7734msgid "Double" 7735msgstr "Çift" 7736 7737#: lazarusidestrconsts.liscoolbargrabstyleitem2 7738msgid "HorLines" 7739msgstr "Yatay çizgiler" 7740 7741#: lazarusidestrconsts.liscoolbargrabstyleitem3 7742msgid "VerLines" 7743msgstr "Dikey çizgiler" 7744 7745#: lazarusidestrconsts.liscoolbargrabstyleitem4 7746msgid "Gripper" 7747msgstr "Tutucu" 7748 7749#: lazarusidestrconsts.liscoolbargrabstyleitem5 7750msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5" 7751msgid "Button" 7752msgstr "Buton" 7753 7754#: lazarusidestrconsts.liscoolbargrabwidth 7755msgid "Grab width" 7756msgstr "Genişliği tut" 7757 7758#: lazarusidestrconsts.liscoolbaridemainmenu 7759msgid "IDE Main Menu" 7760msgstr "IDE Ana Menüsü" 7761 7762#: lazarusidestrconsts.liscoolbarmessages 7763msgctxt "lazarusidestrconsts.liscoolbarmessages" 7764msgid "Messages" 7765msgstr "Mesajlar" 7766 7767#: lazarusidestrconsts.liscoolbarmoveselecteddown 7768msgid "Move selected toolbar item down" 7769msgstr "Seçilen araç çubuğu öğesini aşağı taşı" 7770 7771#: lazarusidestrconsts.liscoolbarmoveselectedup 7772msgid "Move selected toolbar item up" 7773msgstr "Seçilen araç çubuğu öğesini yukarı taşı" 7774 7775#: lazarusidestrconsts.liscoolbaroptions 7776msgid "IDE CoolBar" 7777msgstr "IDE Araç çubuğu" 7778 7779#: lazarusidestrconsts.liscoolbarpackageeditor 7780msgid "Package Editor" 7781msgstr "Paket Düzenleyici" 7782 7783#: lazarusidestrconsts.liscoolbarpackageeditorfiles 7784msgid "Package Editor Files" 7785msgstr "Paket Düzenleyici Dosyaları" 7786 7787#: lazarusidestrconsts.liscoolbarremoveselected 7788msgid "Remove selected item from toolbar" 7789msgstr "Seçilen öğeyi araç çubuğundan kaldır" 7790 7791#: lazarusidestrconsts.liscoolbarrestoredefaults 7792msgid "Restore defaults" 7793msgstr "Varsayılanları geri yükle" 7794 7795#: lazarusidestrconsts.liscoolbarselecttoolbar 7796msgid "Please select a toolbar first!" 7797msgstr "Lütfen öncelikle bir araç çubuğu seçin!" 7798 7799#: lazarusidestrconsts.liscoolbarsourceeditor 7800msgctxt "lazarusidestrconsts.liscoolbarsourceeditor" 7801msgid "Source Editor" 7802msgstr "Kaynak Düzenleyici" 7803 7804#: lazarusidestrconsts.liscoolbarsourcetab 7805msgid "Source Tab" 7806msgstr "Kaynak Sekmesi" 7807 7808#: lazarusidestrconsts.liscoolbartoolbarcommands 7809msgid "Toolbar commands" 7810msgstr "Araç çubuğu komutları" 7811 7812#: lazarusidestrconsts.liscoolbarvisible 7813msgid "Coolbar is &visible" 7814msgstr "Araç çubuğu görünsün" 7815 7816#: lazarusidestrconsts.liscoolbarwidth 7817msgid "Coolbar width" 7818msgstr "Araç çubuğu genişliği" 7819 7820#: lazarusidestrconsts.liscopy 7821msgctxt "lazarusidestrconsts.liscopy" 7822msgid "Copy" 7823msgstr "Kopyala" 7824 7825#: lazarusidestrconsts.liscopyall 7826msgid "Copy All" 7827msgstr "Tümünü Kopyala" 7828 7829#: lazarusidestrconsts.liscopyallitemstoclipboard 7830msgid "Copy All Items to Clipboard" 7831msgstr "Tüm Öğeleri Panoya Kopyala" 7832 7833#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard 7834msgid "Copy All/Original Messages to Clipboard" 7835msgstr "Tümünü Kopyala/Orijinal Mesajları Panoya Kopyala" 7836 7837#: lazarusidestrconsts.liscopyalloutputclipboard 7838msgid "Copy all output to clipboard" 7839msgstr "Tüm çıktıları panoya kopyala" 7840 7841#: lazarusidestrconsts.liscopyallshownmessagestoclipboard 7842msgid "Copy All Shown Messages to Clipboard" 7843msgstr "Gösterilen tüm mesajları Pano'ya Kopyala" 7844 7845#: lazarusidestrconsts.liscopydescription 7846msgid "Copy description to clipboard" 7847msgstr "Açıklamayı panoya kopyala" 7848 7849#: lazarusidestrconsts.liscopyerror 7850msgid "Copy Error" 7851msgstr "Kopyalama Hatası" 7852 7853#: lazarusidestrconsts.liscopyerror2 7854msgid "Copy error" 7855msgstr "Kopyalama hatası" 7856 7857#: lazarusidestrconsts.liscopyfilename 7858#, object-pascal-format 7859msgid "Copy Filename %s" 7860msgstr "Dosya adını %s kopyala" 7861 7862#: lazarusidestrconsts.liscopyfilenametoclipboard 7863msgid "Copy File Name to Clipboard" 7864msgstr "Dosya Adını Panoya Kopyala" 7865 7866#: lazarusidestrconsts.liscopyfilesfailed 7867msgid "Copying files failed." 7868msgstr "Kopyalama başarısız oldu." 7869 7870#: lazarusidestrconsts.liscopyidentifier 7871#, object-pascal-format 7872msgid "Copy \"%s\" to clipboard" 7873msgstr "\"%s\" panoya kopyala" 7874 7875#: lazarusidestrconsts.liscopyingawholeformisnotimplemented 7876msgid "Copying a whole form is not implemented." 7877msgstr "Bütün bir formun kopyalanması uygulanmıyor." 7878 7879#: lazarusidestrconsts.liscopyitemtoclipboard 7880msgid "Copy Item to Clipboard" 7881msgstr "Öğe Pano'ya Kopyala" 7882 7883#: lazarusidestrconsts.liscopymovefiletodirectory 7884msgid "Copy/Move File to Directory" 7885msgstr "Dosyayı Dizine Kopyala / Taşı" 7886 7887#: lazarusidestrconsts.liscopyselecteditemtoclipboard 7888msgid "Copy Selected Items to Clipboard" 7889msgstr "Seçili Öğeleri Panoya Kopyala" 7890 7891#: lazarusidestrconsts.liscopyselectedmessagestoclipboard 7892msgid "Copy Selected Messages to Clipboard" 7893msgstr "Seçili İletileri Panoya Kopyala" 7894 7895#: lazarusidestrconsts.liscoscanforfpcmessages 7896msgid "Scan for FPC messages" 7897msgstr "FPC mesajları tara" 7898 7899#: lazarusidestrconsts.liscoscanformakemessages 7900msgid "Scan for Make messages" 7901msgstr "Make Mesajları için tara" 7902 7903#: lazarusidestrconsts.liscoscanformessages 7904msgid "Scan for messages:" 7905msgstr "Mesajları tara:" 7906 7907#: lazarusidestrconsts.liscoskipcallingcompiler 7908msgid "Skip calling compiler" 7909msgstr "Çağıran derleyiciyi atla" 7910 7911#: lazarusidestrconsts.liscouldnotadditomainsource 7912#, object-pascal-format 7913msgid "Could not add \"{$I %s}\" to main source!" 7914msgstr "Ana kaynağa \"{$I %s}\" eklenemedi!" 7915 7916#: lazarusidestrconsts.liscouldnotaddrtomainsource 7917#, object-pascal-format 7918msgid "Could not add \"{$R %s}\" to main source!" 7919msgstr "\"{$R %s}\" ana kaynağa eklenemedi!" 7920 7921#: lazarusidestrconsts.liscouldnotaddtomainsource 7922#, object-pascal-format 7923msgid "Could not add \"%s\" to main source!" 7924msgstr "Ana kaynak \"%s\" eklenemedi!" 7925 7926#: lazarusidestrconsts.liscouldnotremovefrommainsource 7927#, object-pascal-format 7928msgid "Could not remove \"%s\" from main source!" 7929msgstr "Ana kaynaktan \"%s\" kaldırılamadı!" 7930 7931#: lazarusidestrconsts.liscouldnotremoveifrommainsource 7932#, object-pascal-format 7933msgid "Could not remove \"{$I %s}\" from main source!" 7934msgstr "Ana kaynaktan \"{$I %s}\" kaldırılamadı!" 7935 7936#: lazarusidestrconsts.liscouldnotremoverfrommainsource 7937#, object-pascal-format 7938msgid "Could not remove \"{$R %s}\" from main source!" 7939msgstr "Ana kaynaktan \"{$R %s}\" kaldırılamadı!" 7940 7941#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena 7942msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." 7943msgstr "Uyarı: Ek derleyici yapılandırma dosyası, Free Pascal derleyicisinin aradığı standart yapılandırma dosya adlarından biriyle aynı ada sahiptir. Bu SADECE ek yapılandırma ayrıştırma ve standart yapılandırma atlayarak neden olabilir." 7944 7945#: lazarusidestrconsts.liscpopenpackage 7946#, object-pascal-format 7947msgid "Open Package %s" 7948msgstr "Paketi aç %s" 7949 7950#: lazarusidestrconsts.liscpopenunit 7951#, object-pascal-format 7952msgid "Open Unit %s" 7953msgstr "Birimi aç %s" 7954 7955#: lazarusidestrconsts.liscpu 7956#, object-pascal-format 7957msgid ", CPU: %s" 7958msgstr ", CPU: %s" 7959 7960#: lazarusidestrconsts.liscreateaprojectfirst 7961msgid "Create a project first!" 7962msgstr "Önce bir proje oluştur!" 7963 7964#: lazarusidestrconsts.liscreatedebugandreleasemodes 7965msgid "Create Debug and Release modes" 7966msgstr "Hata ayıklama ve çıkış modları oluştur" 7967 7968#: lazarusidestrconsts.liscreatedirectory 7969msgid "Create directory?" 7970msgstr "Dizin oluşturulsun mu?" 7971 7972#: lazarusidestrconsts.liscreatefilter 7973msgid "Create Filter" 7974msgstr "Filtre Oluştur" 7975 7976#: lazarusidestrconsts.liscreatefppkgconfig 7977msgid "Restore Fppkg configuration" 7978msgstr "Fppkg yapılandırmasını geri yükle" 7979 7980#: lazarusidestrconsts.liscreatefunction 7981msgid "Create function" 7982msgstr "Fonksiyon oluştur" 7983 7984#: lazarusidestrconsts.liscreatehelpnode 7985msgid "Create Help node" 7986msgstr "Yardım oluştur düğüm" 7987 7988#: lazarusidestrconsts.liscreateit 7989msgid "Create it" 7990msgstr "Oluştur" 7991 7992#: lazarusidestrconsts.liscreatelocalvariable 7993#, object-pascal-format 7994msgid "Create local variable \"%s\"" 7995msgstr "Yerel değişken \"%s\" oluştur" 7996 7997#: lazarusidestrconsts.liscreatenewaddition 7998msgid "Create new addition" 7999msgstr "Yeni ek oluştur" 8000 8001#: lazarusidestrconsts.liscreatenewpackage 8002msgid "(Create new package)" 8003msgstr "(Yeni paket oluştur)" 8004 8005#: lazarusidestrconsts.liscreatenewpackagecomponent 8006msgid "Create new package component" 8007msgstr "Yeni paket bileşeni oluştur" 8008 8009#: lazarusidestrconsts.liscreateproject 8010msgid "Create project" 8011msgstr "Proje oluştur" 8012 8013#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile 8014msgid "Create/update .po file when saving a lfm file" 8015msgstr "Bir lfm dosyası kaydederken .po dosyası oluştur/güncelle" 8016 8017#: lazarusidestrconsts.liscreatingfileindexoffpcsources 8018#, object-pascal-format 8019msgid "Creating file index of FPC sources %s ..." 8020msgstr "FPC kaynaklarının dosya dizini oluşturuluyor %s ..." 8021 8022#: lazarusidestrconsts.liscsbottom 8023msgctxt "lazarusidestrconsts.liscsbottom" 8024msgid "Bottom" 8025msgstr "Alt" 8026 8027#: lazarusidestrconsts.liscstop 8028msgctxt "lazarusidestrconsts.liscstop" 8029msgid "Top" 8030msgstr "Üst" 8031 8032#: lazarusidestrconsts.lisctdefchoosedirectory 8033msgid "Choose Directory" 8034msgstr "Dizin Seç" 8035 8036#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues 8037msgid "CodeTools Directory Values" 8038msgstr "Kod Araçları Dizin Değerleri" 8039 8040#: lazarusidestrconsts.lisctdefdefinetemplates 8041msgid "Define templates" 8042msgstr "Şablonları tanımla" 8043 8044#: lazarusidestrconsts.lisctdefnovariableselected 8045msgid "<no variable selected>" 8046msgstr "<seçilen değişken yok>" 8047 8048#: lazarusidestrconsts.lisctdefsopenpreview 8049msgid "Open Preview" 8050msgstr "Önizlemeyi Aç" 8051 8052#: lazarusidestrconsts.lisctdefstools 8053msgid "Tools" 8054msgstr "Araçlar" 8055 8056#: lazarusidestrconsts.lisctdefvariable 8057#, object-pascal-format 8058msgid "Variable: %s" 8059msgstr "Değişken: %s" 8060 8061#: lazarusidestrconsts.lisctdefvariablename 8062msgid "Variable Name" 8063msgstr "Değişken Adı" 8064 8065#: lazarusidestrconsts.lisctdtemplates 8066msgid "Templates" 8067msgstr "Şablonlar" 8068 8069#: lazarusidestrconsts.lisctoupdateallmethodsignatures 8070msgid "Update all method signatures" 8071msgstr "Tüm yöntem imzalarını güncelle" 8072 8073#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures 8074msgid "Update multiple procedure signatures" 8075msgstr "Birden çok prosedür imzasını güncelle" 8076 8077#: lazarusidestrconsts.lisctpleaseselectamacro 8078msgid "please select a macro" 8079msgstr "lütfen bir makro seçin" 8080 8081#: lazarusidestrconsts.lisctselectcodemacro 8082msgid "Select Code Macro" 8083msgstr "Kod Makrosu Seç" 8084 8085#: lazarusidestrconsts.liscurrent 8086msgctxt "lazarusidestrconsts.liscurrent" 8087msgid "Current" 8088msgstr "Geçerli" 8089 8090#: lazarusidestrconsts.liscurrentlclwidgetset 8091#, object-pascal-format 8092msgid "Current LCL widgetset: \"%s\"" 8093msgstr "Geçerli LCL widget'ları: \"%s\"" 8094 8095#: lazarusidestrconsts.liscurrentstate 8096msgid "Current state: " 8097msgstr "Mevcut durum: " 8098 8099#: lazarusidestrconsts.liscursorcolumnincurrenteditor 8100msgid "Cursor column in current editor" 8101msgstr "Geçerli düzenleyicideki imleç sütunu" 8102 8103#: lazarusidestrconsts.liscursorrowincurrenteditor 8104msgid "Cursor row in current editor" 8105msgstr "Geçerli düzenleyicideki imleç satırı" 8106 8107#: lazarusidestrconsts.liscustomopthint 8108msgid "These options are passed to the compiler after macros are replaced." 8109msgstr "Bu seçenekler makrolar değiştirildikten sonra derleyiciye aktarılır." 8110 8111#: lazarusidestrconsts.liscustomoptions 8112msgid "custom options" 8113msgstr "özel seçenekler" 8114 8115#: lazarusidestrconsts.liscustomoptions2 8116msgid "Custom options" 8117msgstr "Özel seçenekler" 8118 8119#: lazarusidestrconsts.liscustomoptions3 8120msgid "Custom Options" 8121msgstr "Özel Seçenekler" 8122 8123#: lazarusidestrconsts.liscustomprogram 8124msgid "Custom Program" 8125msgstr "Özel Program" 8126 8127#: lazarusidestrconsts.liscustomprogramprogramdescriptor 8128msgid "A Custom Free Pascal program." 8129msgstr "Özel Free Pascal programı." 8130 8131#: lazarusidestrconsts.liscut 8132msgctxt "lazarusidestrconsts.liscut" 8133msgid "Cut" 8134msgstr "Kes" 8135 8136#: lazarusidestrconsts.lisdadattach 8137msgid "Attach" 8138msgstr "Ekle" 8139 8140#: lazarusidestrconsts.lisdadimagename 8141msgid "Image Name" 8142msgstr "Resim Adı" 8143 8144#: lazarusidestrconsts.lisdadpid 8145msgid "PID" 8146msgstr "PID" 8147 8148#: lazarusidestrconsts.lisdadrunningprocesses 8149msgid "Running Processes" 8150msgstr "Çalışan İşlemler" 8151 8152#: lazarusidestrconsts.lisdatamodule 8153msgid "Data Module" 8154msgstr "Veri modülü" 8155 8156#: lazarusidestrconsts.lisdate 8157msgid "Date" 8158msgstr "Tarih" 8159 8160#: lazarusidestrconsts.lisdbgallitemdelete 8161msgctxt "lazarusidestrconsts.lisdbgallitemdelete" 8162msgid "Delete all" 8163msgstr "Hepsini sil" 8164 8165#: lazarusidestrconsts.lisdbgallitemdeletehint 8166msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint" 8167msgid "Delete all" 8168msgstr "Hepsini sil" 8169 8170#: lazarusidestrconsts.lisdbgallitemdisable 8171msgctxt "lazarusidestrconsts.lisdbgallitemdisable" 8172msgid "Disable all" 8173msgstr "Tümünü devre dışı bırak" 8174 8175#: lazarusidestrconsts.lisdbgallitemdisablehint 8176msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" 8177msgid "Disable all" 8178msgstr "Tümünü devre dışı bırak" 8179 8180#: lazarusidestrconsts.lisdbgallitemenable 8181msgctxt "lazarusidestrconsts.lisdbgallitemenable" 8182msgid "Enable all" 8183msgstr "Hepsini etkinleştir" 8184 8185#: lazarusidestrconsts.lisdbgallitemenablehint 8186msgctxt "lazarusidestrconsts.lisdbgallitemenablehint" 8187msgid "Enable all" 8188msgstr "Hepsini etkinleştir" 8189 8190#: lazarusidestrconsts.lisdbgasmcopytoclipboard 8191msgid "Copy to Clipboard" 8192msgstr "Panoya kopyala" 8193 8194#: lazarusidestrconsts.lisdbgbreakpointpropertieshint 8195msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint" 8196msgid "Breakpoint Properties ..." 8197msgstr "Kesme Noktası Özellikleri ..." 8198 8199#: lazarusidestrconsts.lisdbgemexpression 8200msgid "&Expression:" 8201msgstr "&İfade:" 8202 8203#: lazarusidestrconsts.lisdbgemnewvalue 8204msgid "&New value:" 8205msgstr "&Yeni değer:" 8206 8207#: lazarusidestrconsts.lisdbgemresult 8208msgid "&Result:" 8209msgstr "&Sonuç:" 8210 8211#: lazarusidestrconsts.lisdbgenbreakpointevaluation 8212msgid "Breakpoint Evaluation" 8213msgstr "Kesme noktası değerlendirmesi" 8214 8215#: lazarusidestrconsts.lisdbgenbreakpointhit 8216msgid "Breakpoint Hit" 8217msgstr "Kesme Noktası Vuruşu" 8218 8219#: lazarusidestrconsts.lisdbgenbreakpointmessage 8220msgid "Breakpoint Message" 8221msgstr "Kesme Mesaj" 8222 8223#: lazarusidestrconsts.lisdbgenbreakpointstackdump 8224msgid "Breakpoint Stack Dump" 8225msgstr "Kesme Noktası Yığın Dökümü" 8226 8227#: lazarusidestrconsts.lisdbgendefaultcolor 8228msgid "Default Color" 8229msgstr "Varsayılan Renk" 8230 8231#: lazarusidestrconsts.lisdbgenexceptionraised 8232msgid "Exception Raised" 8233msgstr "İstisna Yükseltildi" 8234 8235#: lazarusidestrconsts.lisdbgenmoduleload 8236msgid "Module Load" 8237msgstr "Modül Yükle" 8238 8239#: lazarusidestrconsts.lisdbgenmoduleunload 8240msgid "Module Unload" 8241msgstr "Modül Kaldır" 8242 8243#: lazarusidestrconsts.lisdbgenoutputdebugstring 8244msgid "Output Debug String" 8245msgstr "Hata Ayıklama String Çıktısı" 8246 8247#: lazarusidestrconsts.lisdbgenprocessexit 8248msgid "Process Exit" 8249msgstr "İşlem Çık" 8250 8251#: lazarusidestrconsts.lisdbgenprocessstart 8252msgid "Process Start" 8253msgstr "Süreç Başlat" 8254 8255#: lazarusidestrconsts.lisdbgenthreadexit 8256msgid "Thread Exit" 8257msgstr "Konu Çık" 8258 8259#: lazarusidestrconsts.lisdbgenthreadstart 8260msgid "Thread Start" 8261msgstr "Konu Başlat" 8262 8263#: lazarusidestrconsts.lisdbgenwindowsmessageposted 8264msgid "Windows Message Posted" 8265msgstr "Windows İleti Gönderildi" 8266 8267#: lazarusidestrconsts.lisdbgenwindowsmessagesent 8268msgid "Windows Message Sent" 8269msgstr "Gönderilen Windows İletisi" 8270 8271#: lazarusidestrconsts.lisdbgitemdeletehint 8272msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" 8273msgid "Delete" 8274msgstr "Sil" 8275 8276#: lazarusidestrconsts.lisdbgitemdisable 8277msgctxt "lazarusidestrconsts.lisdbgitemdisable" 8278msgid "Disable" 8279msgstr "Devre Dışı" 8280 8281#: lazarusidestrconsts.lisdbgitemdisablehint 8282msgctxt "lazarusidestrconsts.lisdbgitemdisablehint" 8283msgid "Disable" 8284msgstr "Devre Dışı" 8285 8286#: lazarusidestrconsts.lisdbgitemenable 8287msgctxt "lazarusidestrconsts.lisdbgitemenable" 8288msgid "Enable" 8289msgstr "Etkin" 8290 8291#: lazarusidestrconsts.lisdbgitemenablehint 8292msgctxt "lazarusidestrconsts.lisdbgitemenablehint" 8293msgid "Enable" 8294msgstr "Etkin" 8295 8296#: lazarusidestrconsts.lisdbgmangnodebuggerspecified 8297msgid "No debugger specified" 8298msgstr "Belirtilen hata ayıklayıcı yok" 8299 8300#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway 8301msgid "Set the breakpoint anyway" 8302msgstr "Kesme noktasını yine de ayarla" 8303 8304#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno 8305#, object-pascal-format 8306msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu." 8307msgstr "Belirtilen hata ayıklayıcı yok.%s Menüdeki hata ayıklayıcı seçenekleri iletişim kutusunda bir Hata Ayıklayıcı ayarlayana kadar kesme noktalarının etkisinin olmaması." 8308 8309#: lazarusidestrconsts.lisdbgterminal 8310msgctxt "lazarusidestrconsts.lisdbgterminal" 8311msgid "Console In/Output" 8312msgstr "Terminal giriş/ çıkışı" 8313 8314#: lazarusidestrconsts.lisdbgwinpower 8315msgid "On/Off" 8316msgstr "Aç/Kapat" 8317 8318#: lazarusidestrconsts.lisdbgwinpowerhint 8319msgid "Disable/Enable updates for the entire window" 8320msgstr "Tüm pencerenin güncellemelerini devre dışı bırak/etkinleştir" 8321 8322#: lazarusidestrconsts.lisdebug 8323msgctxt "lazarusidestrconsts.lisdebug" 8324msgid "Debug" 8325msgstr "Hata ayıklama" 8326 8327#: lazarusidestrconsts.lisdebugger 8328msgctxt "lazarusidestrconsts.lisdebugger" 8329msgid "Debugger" 8330msgstr "Hata ayıklayıcı" 8331 8332#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate 8333#, object-pascal-format 8334msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." 8335msgstr "Hata ayıklayıcı hatası%sHata ayıklayıcı%s hata durumuna girdi Hata isini koru!%s Vurmak Durdur ve en iyisini um, fişi çekiyoruz." 8336 8337#: lazarusidestrconsts.lisdebuggerfeedbackerror 8338msgid "Debugger Error" 8339msgstr "Hata Ayıklayıcı Hatası" 8340 8341#: lazarusidestrconsts.lisdebuggerfeedbackinformation 8342msgid "Debugger Information" 8343msgstr "Hata ayıklayıcı bilgileri" 8344 8345#: lazarusidestrconsts.lisdebuggerfeedbackwarning 8346msgid "Debugger Warning" 8347msgstr "Hata ayıklayıcı uyarısı" 8348 8349#: lazarusidestrconsts.lisdebuggerinvalid 8350msgid "Debugger invalid" 8351msgstr "Geçersiz Hata ayıklayıcı" 8352 8353#: lazarusidestrconsts.lisdebugging 8354#, object-pascal-format 8355msgid "%s (debugging ...)" 8356msgstr "%s (hata ayıklanıyor ...)" 8357 8358#: lazarusidestrconsts.lisdebughintautotypecastclass 8359msgid "Automatic typecast for objects" 8360msgstr "Nesneler için otomatik tip analizi" 8361 8362#: lazarusidestrconsts.lisdebugoptionsfrmaddexception 8363msgid "Add Exception" 8364msgstr "İstisna Ekle" 8365 8366#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath 8367msgid "Additional search path" 8368msgstr "Ek arama yolu" 8369 8370#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls 8371msgid "BETA: Allow function calls in watches (if supported by backend)" 8372msgstr "" 8373 8374#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm 8375msgid "Automatically close the assembler window, after source not found" 8376msgstr "Kaynak bulunamadıktan sonra assembler penceresini otomatik olarak kapatın" 8377 8378#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass 8379msgid "Automatically set \"use instance class type\" for new watches" 8380msgstr "" 8381 8382#: lazarusidestrconsts.lisdebugoptionsfrmbackend 8383msgid "Debugger backend" 8384msgstr "Hata ayıklayıcı arka ucu" 8385 8386#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint 8387msgid "Breakpoint" 8388msgstr "Kırılma noktası" 8389 8390#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun 8391msgid "Clear log on run" 8392msgstr "Çalıştırma günlüğü temizle" 8393 8394#: lazarusidestrconsts.lisdebugoptionsfrmdebugger 8395msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" 8396msgid "Debugger" 8397msgstr "Hata ayıklayıcı" 8398 8399#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend 8400msgid "Debugger Backend:" 8401msgstr "Hata ayıklayıcı arka ucu:" 8402 8403#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions 8404msgid "Debugger general options" 8405msgstr "Genel Hata ayıklayıcı seçenekleri" 8406 8407#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific 8408msgid "Debugger specific options (depends on type of debugger)" 8409msgstr "Hata ayıklayıcıya özgü seçenekler (hata ayıklayıcı türüne bağlıdır)" 8410 8411#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname 8412msgid "Duplicate Exception name" 8413msgstr "İstisna adı çoğalt" 8414 8415#: lazarusidestrconsts.lisdebugoptionsfrmeditclass 8416msgid "Change type" 8417msgstr "" 8418 8419#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn 8420msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type." 8421msgstr "" 8422 8423#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname 8424msgid "Enter the name of the exception" 8425msgstr "İstisnanın adını gir" 8426 8427#: lazarusidestrconsts.lisdebugoptionsfrmeventlog 8428msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" 8429msgid "Event Log" 8430msgstr "Olay günlüğü" 8431 8432#: lazarusidestrconsts.lisdebugoptionsfrmhandledby 8433msgid "Handled by" 8434msgstr "Tarafından işlenir" 8435 8436#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger 8437msgid "Handled by Debugger" 8438msgstr "Hata Ayıklayıcı Tarafından işlenir" 8439 8440#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram 8441msgid "Handled by Program" 8442msgstr "Program tarafından işlenir" 8443 8444#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions 8445msgid "Ignore these exceptions" 8446msgstr "Bu istisnaları yoksay" 8447 8448#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions 8449msgid "Language Exceptions" 8450msgstr "Dil İstisnaları" 8451 8452#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto 8453msgid "Limit line count to" 8454msgstr "Satır sayısını sınırla" 8455 8456#: lazarusidestrconsts.lisdebugoptionsfrmmodule 8457msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" 8458msgid "Module" 8459msgstr "Modül" 8460 8461#: lazarusidestrconsts.lisdebugoptionsfrmname 8462msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" 8463msgid "Name:" 8464msgstr "Ad:" 8465 8466#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions 8467msgid "Notify on Exceptions" 8468msgstr "Lazarus İstisnalarına Haber Verin" 8469 8470#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions 8471msgid "OS Exceptions" 8472msgstr "İşletim Sistemi İstisnaları" 8473 8474#: lazarusidestrconsts.lisdebugoptionsfrmoutput 8475msgid "Output" 8476msgstr "Çıktı" 8477 8478#: lazarusidestrconsts.lisdebugoptionsfrmprocess 8479msgid "Process" 8480msgstr "Süreç" 8481 8482#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun 8483msgid "Reset Debugger after each run" 8484msgstr "Her çalıştırmadan sonra hata ayıklayıcıyı sıfırla" 8485 8486#: lazarusidestrconsts.lisdebugoptionsfrmresume 8487msgid "Resume" 8488msgstr "Devam et" 8489 8490#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled 8491msgid "Resume Handled" 8492msgstr "İşlenen sürdür" 8493 8494#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled 8495msgid "Resume Unhandled" 8496msgstr "İşlenmemiş Sürdür" 8497 8498#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop 8499msgid "Show message on stop with Error (Exit-code <> 0)" 8500msgstr "" 8501 8502#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop 8503msgid "Show message on stop" 8504msgstr "Dur mesajı göster" 8505 8506#: lazarusidestrconsts.lisdebugoptionsfrmsignals 8507msgid "Signals" 8508msgstr "Sinyaller" 8509 8510#: lazarusidestrconsts.lisdebugoptionsfrmthread 8511msgid "Thread" 8512msgstr "Konu" 8513 8514#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke 8515#, object-pascal-format 8516msgid "Unknown Debugger backend \"%s\"" 8517msgstr "Bilinmeyen Hata Ayıklama arka ucu \"%s\"" 8518 8519#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors 8520msgid "Use event log colors" 8521msgstr "Olay günlüğü renklerini kullan" 8522 8523#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger 8524msgid "-- Use IDE default Debugger --" 8525msgstr "-- IDE varsayılan Hata Ayıklama kullanın --" 8526 8527#: lazarusidestrconsts.lisdebugoptionsfrmwindows 8528msgid "Windows" 8529msgstr "Pencere" 8530 8531#: lazarusidestrconsts.lisdebugunabletoloadfile 8532msgid "Unable to load file" 8533msgstr "Dosya yüklenemiyor" 8534 8535#: lazarusidestrconsts.lisdebugunabletoloadfile2 8536#, object-pascal-format 8537msgid "Unable to load file \"%s\"." 8538msgstr "Dosya \"%s\" yüklenemedi." 8539 8540#: lazarusidestrconsts.lisdecimal 8541msgctxt "lazarusidestrconsts.lisdecimal" 8542msgid "Decimal" 8543msgstr "Ondalık" 8544 8545#: lazarusidestrconsts.lisdefault 8546msgctxt "lazarusidestrconsts.lisdefault" 8547msgid "Default" 8548msgstr "Varsayılan" 8549 8550#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl 8551msgid "Default class visibility section of new methods. For example code completion on OnShow:=" 8552msgstr "Yeni yöntemlerin varsayılan sınıf görünürlük bölümü. Örneğin, OnShow'da kod tamamlama: =" 8553 8554#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse 8555msgid "The default is ComboBox with \"True\" and \"False\" selections" 8556msgstr "Varsayılan, \"Doğru\" ve \"Yanlış\" seçimleri olan ComboBox'tur" 8557 8558#: lazarusidestrconsts.lisdefaultplaceholder 8559msgid "(default)" 8560msgstr "(varsayılan)" 8561 8562#: lazarusidestrconsts.lisdefaultsectionofmethods 8563msgid "Default section of methods" 8564msgstr "Yöntemlerin varsayılan bölümü" 8565 8566#: lazarusidestrconsts.lisdelayforcompletionbox 8567msgid "Delay for completion box" 8568msgstr "Tamamlama kutusu gecikmesi" 8569 8570#: lazarusidestrconsts.lisdelayforcompletionlonglinehint 8571msgid "Delay for long line hints in completion box" 8572msgstr "Uzun satır ipuçları tamamlama kutusunda gecikme" 8573 8574#: lazarusidestrconsts.lisdelayforhints 8575msgid "Delay for hints" 8576msgstr "İpucu geçikmesi" 8577 8578#: lazarusidestrconsts.lisdelete 8579msgctxt "lazarusidestrconsts.lisdelete" 8580msgid "Delete" 8581msgstr "Sil" 8582 8583#: lazarusidestrconsts.lisdelete2 8584msgid "Delete?" 8585msgstr "Sil?" 8586 8587#: lazarusidestrconsts.lisdeleteaddition 8588#, object-pascal-format 8589msgid "Delete addition \"%s\"?" 8590msgstr "\"%s\" ek silinsin mi?" 8591 8592#: lazarusidestrconsts.lisdeleteall 8593msgid "&Delete All" 8594msgstr "&Hepsini sil" 8595 8596#: lazarusidestrconsts.lisdeleteallbreakpoints 8597msgid "Delete all breakpoints?" 8598msgstr "Tüm kesme noktaları silinsin mi?" 8599 8600#: lazarusidestrconsts.lisdeleteallbreakpoints2 8601#, object-pascal-format 8602msgid "Delete all breakpoints in file \"%s\"?" 8603msgstr "\"%s\" dosyasındaki tüm kesme noktaları silinsin mi?" 8604 8605#: lazarusidestrconsts.lisdeleteallinsamesource 8606msgid "Delete All in same source" 8607msgstr "Tümünü aynı kaynakta sil" 8608 8609#: lazarusidestrconsts.lisdeleteallselectedbreakpoints 8610msgid "Delete all selected breakpoints?" 8611msgstr "Seçili tüm kesme noktaları silinsin mi?" 8612 8613#: lazarusidestrconsts.lisdeleteallthesefiles 8614msgid "Delete all these files?" 8615msgstr "Tüm dosyalar silinsin mi?" 8616 8617#: lazarusidestrconsts.lisdeleteambiguousfile 8618msgid "Delete ambiguous file?" 8619msgstr "Belirsiz dosya silinsin mi?" 8620 8621#: lazarusidestrconsts.lisdeletebreakpoint 8622msgid "Delete Breakpoint" 8623msgstr "Kesme Noktasını Sil" 8624 8625#: lazarusidestrconsts.lisdeletebreakpointatline 8626#, object-pascal-format 8627msgid "Delete breakpoint at%s\"%s\" line %d?" 8628msgstr "Kesme noktasını %s de sil \"%s\" satır %d?" 8629 8630#: lazarusidestrconsts.lisdeletebreakpointforaddress 8631#, object-pascal-format 8632msgid "Delete breakpoint for address %s?" 8633msgstr "%s adresi için kesme noktası silinsin mi?" 8634 8635#: lazarusidestrconsts.lisdeletebreakpointforwatch 8636#, object-pascal-format 8637msgid "Delete watchpoint for \"%s\"?" 8638msgstr "\"%s\" için izleme noktası silinsin mi?" 8639 8640#: lazarusidestrconsts.lisdeletefilefailed 8641msgid "Delete file failed" 8642msgstr "Dosya silinemedi" 8643 8644#: lazarusidestrconsts.lisdeletemacro 8645#, object-pascal-format 8646msgid "Delete macro \"%s\"?" 8647msgstr "Makro silinsin mi \"%s\"?" 8648 8649#: lazarusidestrconsts.lisdeletemode 8650#, object-pascal-format 8651msgid "Delete mode \"%s\"" 8652msgstr "Modu sil \"%s\"" 8653 8654#: lazarusidestrconsts.lisdeleteoldfile 8655#, object-pascal-format 8656msgid "Delete old file \"%s\"?" 8657msgstr "Eski dosyayı sil \"%s\"?" 8658 8659#: lazarusidestrconsts.lisdeleteoldfile2 8660msgid "Delete old file?" 8661msgstr "Eski dosyayı sil?" 8662 8663#: lazarusidestrconsts.lisdeleteselectedmacro 8664msgid "Delete selected macro?" 8665msgstr "Seçili makro silinsin mi?" 8666 8667#: lazarusidestrconsts.lisdeletethisaddition 8668msgid "Delete this addition" 8669msgstr "Bu eklemeyi sil" 8670 8671#: lazarusidestrconsts.lisdeletevalue 8672#, object-pascal-format 8673msgid "Delete value \"%s\"?" 8674msgstr "%s değeri silinsin mi?" 8675 8676#: lazarusidestrconsts.lisdeletevalue2 8677#, object-pascal-format 8678msgid "Delete value %s" 8679msgstr "%s değerini sil" 8680 8681#: lazarusidestrconsts.lisdeletingoffilefailed 8682#, object-pascal-format 8683msgid "Deleting of file \"%s\" failed." 8684msgstr "\"%s\" dosyasının silinmesi başarısız oldu." 8685 8686#: lazarusidestrconsts.lisdelimiterissemicolon 8687msgid "Delimiter is semicolon." 8688msgstr "Sınırlayıcı noktalı virgüldür." 8689 8690#: lazarusidestrconsts.lisdelphicompatibleresources 8691msgid "Delphi compatible resources. Recommended." 8692msgstr "Delphi uyumlu kaynaklar. Önerilir." 8693 8694#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid 8695msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project." 8696msgstr "\"Tasarım zamanı\" paketleri IDE'ye bileşenler ve menü öğeleri ekler. Projeler tarafından kullanılabilirler ancak projeye derlenmezler. Proje derlerken derleyici bu paketin birimlerini bulamaz." 8697 8698#: lazarusidestrconsts.lisdesktops 8699msgid "Desktops ..." 8700msgstr "Masaüstleri..." 8701 8702#: lazarusidestrconsts.lisdestinationdirectory 8703msgid "Destination directory" 8704msgstr "Hedef klasör" 8705 8706#: lazarusidestrconsts.lisdestructorcode 8707msgid "Destructor code" 8708msgstr "Destructor kodu" 8709 8710#: lazarusidestrconsts.lisdiffdlgcaseinsensitive 8711msgid "Case Insensitive" 8712msgstr "Büyük/Küçük Harfe Duyarlı" 8713 8714#: lazarusidestrconsts.lisdiffdlgfile1 8715msgid "File1" 8716msgstr "Dosya1" 8717 8718#: lazarusidestrconsts.lisdiffdlgfile2 8719msgid "File2" 8720msgstr "Dosya2" 8721 8722#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd 8723msgid "Ignore if empty lines were added or removed" 8724msgstr "Boş satırlar eklenip eklenmediğini yok sayın" 8725 8726#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe 8727msgid "Ignore difference in line ends (e.g. #10 = #13#10)" 8728msgstr "Satır sonlarındaki farkı yok sayın (ör. # 10 = # 13 # 10)" 8729 8730#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd 8731msgid "Ignore amount of space chars" 8732msgstr "Boşluk miktarını yoksay" 8733 8734#: lazarusidestrconsts.lisdiffdlgignorespaces 8735msgid "Ignore spaces (newline chars not included)" 8736msgstr "Boşlukları yoksay (satırsonu karakterleri dahil değil)" 8737 8738#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline 8739msgid "Ignore spaces at end of line" 8740msgstr "Satırın sonundaki boşlukları yoksay" 8741 8742#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline 8743msgid "Ignore spaces at start of line" 8744msgstr "Satırın başındaki boşlukları yoksay" 8745 8746#: lazarusidestrconsts.lisdiffdlgonlyselection 8747msgid "Only selection" 8748msgstr "Sadece seçim" 8749 8750#: lazarusidestrconsts.lisdiffdlgopendiffineditor 8751msgid "Open difference in editor" 8752msgstr "Farklı Editörde aç" 8753 8754#: lazarusidestrconsts.lisdifferentunitfoundatnewposition 8755#, object-pascal-format 8756msgid "different unit %s found at new position \"%s\"" 8757msgstr "farklı birim %s yeni \"%s\" konumunda bulundu" 8758 8759#: lazarusidestrconsts.lisdigits 8760msgid "Digits:" 8761msgstr "Rakamlar:" 8762 8763#: lazarusidestrconsts.lisdirectives 8764msgid "Directives" 8765msgstr "Direktifler" 8766 8767#: lazarusidestrconsts.lisdirectivesfornewunit 8768msgid "Directives for new unit" 8769msgstr "Yeni birim için direktifler" 8770 8771#: lazarusidestrconsts.lisdirectories 8772msgid "Directories" 8773msgstr "Dizinler" 8774 8775#: lazarusidestrconsts.lisdirectory 8776msgid "Directory: " 8777msgstr "Dizin: " 8778 8779#: lazarusidestrconsts.lisdirectorynotfound 8780#, object-pascal-format 8781msgid "Directory \"%s\" not found." 8782msgstr "Dizin \"%s\" bulunamadı." 8783 8784#: lazarusidestrconsts.lisdirectorynotfound2 8785#, object-pascal-format 8786msgid "directory %s not found" 8787msgstr "dizin %s bulunamadı" 8788 8789#: lazarusidestrconsts.lisdirectorynotwritable 8790msgid "Directory not writable" 8791msgstr "Dizin yazılabilir değil" 8792 8793#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles 8794msgid "Directory where the IDE puts the .po files" 8795msgstr "IDE'nin .po dosyalarını koyduğu dizin" 8796 8797#: lazarusidestrconsts.lisdisableallinsamesource 8798msgid "Disable All in same source" 8799msgstr "Tümünü aynı kaynakta devre dışı bırak" 8800 8801#: lazarusidestrconsts.lisdisablebreakpoint 8802msgid "Disable Breakpoint" 8803msgstr "Kesme Noktasını Devre Dışı Bırak" 8804 8805#: lazarusidestrconsts.lisdisabled 8806msgctxt "lazarusidestrconsts.lisdisabled" 8807msgid "Disabled" 8808msgstr "Devre dışı" 8809 8810#: lazarusidestrconsts.lisdisablegroups 8811msgid "Disable Groups" 8812msgstr "Grupları Devre Dışı Bırak" 8813 8814#: lazarusidestrconsts.lisdisablei18nforlfm 8815msgid "Disable I18N for LFM" 8816msgstr "LFM için I18N'yi devre dışı bırak" 8817 8818#: lazarusidestrconsts.lisdisableoptionxg 8819msgid "Disable Option -Xg?" 8820msgstr "-Xg Seçeneğini Devre Dışı Bırak?" 8821 8822#: lazarusidestrconsts.lisdisableoptionxg2 8823msgid "Disable option -Xg" 8824msgstr "-Xg Seçeneğini Devre Dışı Bırak" 8825 8826#: lazarusidestrconsts.lisdisassassembler 8827msgctxt "lazarusidestrconsts.lisdisassassembler" 8828msgid "Assembler" 8829msgstr "Assembler" 8830 8831#: lazarusidestrconsts.lisdisassgotoaddredittexthint 8832msgid "($address)" 8833msgstr "" 8834 8835#: lazarusidestrconsts.lisdisassgotoaddress 8836msgctxt "lazarusidestrconsts.lisdisassgotoaddress" 8837msgid "Goto Address" 8838msgstr "Adrese Git" 8839 8840#: lazarusidestrconsts.lisdisassgotoaddresshint 8841msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint" 8842msgid "Goto Address" 8843msgstr "Adrese Git" 8844 8845#: lazarusidestrconsts.lisdisassgotocurrentaddress 8846msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress" 8847msgid "Goto Current Address" 8848msgstr "Geçerli Adrese Git" 8849 8850#: lazarusidestrconsts.lisdisassgotocurrentaddresshint 8851msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint" 8852msgid "Goto Current Address" 8853msgstr "Geçerli Adrese Git" 8854 8855#: lazarusidestrconsts.lisdiscardchanges 8856msgid "Discard changes" 8857msgstr "Değişiklikleri gözardı et" 8858 8859#: lazarusidestrconsts.lisdiscardchangesall 8860msgid "Discard all changes" 8861msgstr "Tüm değişiklikleri gözardı et" 8862 8863#: lazarusidestrconsts.lisdiscardchangesandopenproject 8864msgid "Discard changes and open project" 8865msgstr "Değişiklikleri sil ve projeyi aç" 8866 8867#: lazarusidestrconsts.lisdiscardchangesandquit 8868msgid "Discard changes and quit" 8869msgstr "Değişiklikleri sil ve çık" 8870 8871#: lazarusidestrconsts.lisdiscardchangescreatenewproject 8872msgid "Discard changes, create new project" 8873msgstr "Değişiklikleri sil, yeni proje oluştur" 8874 8875#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff 8876msgid "Click on one of the above items to see the diff" 8877msgstr "Farkı görmek için yukarıdaki öğelerden birini tıklayın" 8878 8879#: lazarusidestrconsts.lisdiskdifferrorreadingfile 8880#, object-pascal-format 8881msgid "Error reading file: %s" 8882msgstr "Dosya okunurken hata oluştu: %s" 8883 8884#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges 8885msgid "Ignore all disk changes" 8886msgstr "Tüm değişiklikleri yoksay" 8887 8888#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk 8889msgid "Reload checked files from disk" 8890msgstr "Dosyayı tekrar yükle" 8891 8892#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk 8893msgid "Some files have changed on disk:" 8894msgstr "Bazı dosyalarda değişiklik yapıldı:" 8895 8896#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges 8897msgid "Some files have local changes. Either local or external changes will be overwritten." 8898msgstr "" 8899 8900#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda 8901msgid "Distinguish big and small letters e.g. A and a" 8902msgstr "Büyük ve küçük harfleri ayırt et, örn. A ve a" 8903 8904#: lazarusidestrconsts.lisdlgadd 8905msgctxt "lazarusidestrconsts.lisdlgadd" 8906msgid "Add ..." 8907msgstr "Ekle ..." 8908 8909#: lazarusidestrconsts.lisdlgalloptions 8910msgid "All options ..." 8911msgstr "Tüm seçenekler ..." 8912 8913#: lazarusidestrconsts.lisdlgchangeclass 8914msgid "Change Class ..." 8915msgstr "Sınıf değiştir ..." 8916 8917#: lazarusidestrconsts.lisdlgdefines 8918msgid "Defines ..." 8919msgstr "Tanımlar ..." 8920 8921#: lazarusidestrconsts.lisdlgedit 8922msgctxt "lazarusidestrconsts.lisdlgedit" 8923msgid "Edit ..." 8924msgstr "Düzen ..." 8925 8926#: lazarusidestrconsts.lisdlgexport 8927msgctxt "lazarusidestrconsts.lisdlgexport" 8928msgid "Export ..." 8929msgstr "Dışa Aktar ..." 8930 8931#: lazarusidestrconsts.lisdlgimport 8932msgctxt "lazarusidestrconsts.lisdlgimport" 8933msgid "Import ..." 8934msgstr "İçe aktar ..." 8935 8936#: lazarusidestrconsts.lisdlgmore 8937msgctxt "lazarusidestrconsts.lisdlgmore" 8938msgid "More ..." 8939msgstr "Daha fazla..." 8940 8941#: lazarusidestrconsts.lisdlgopen 8942msgctxt "lazarusidestrconsts.lisdlgopen" 8943msgid "Open ..." 8944msgstr "Aç ..." 8945 8946#: lazarusidestrconsts.lisdlgsave 8947msgctxt "lazarusidestrconsts.lisdlgsave" 8948msgid "Save ..." 8949msgstr "Kaydet ..." 8950 8951#: lazarusidestrconsts.lisdoesnotexists 8952#, object-pascal-format 8953msgid "%s does not exist: %s" 8954msgstr "%s yok: %s" 8955 8956#: lazarusidestrconsts.lisdonotchange 8957msgid "Do not change" 8958msgstr "Değiştirme" 8959 8960#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning 8961#, object-pascal-format 8962msgid "%sDo not check if another IDE instance is already running" 8963msgstr "%s Başka bir IDE örneğinin zaten çalışıp çalışmadığını kontrol etme" 8964 8965#: lazarusidestrconsts.lisdonotclosetheproject 8966msgid "Do not close the project" 8967msgstr "Projeyi kapatma" 8968 8969#: lazarusidestrconsts.lisdonotcompiledependencies 8970msgid "do not compile dependencies" 8971msgstr "bağımlılıkları derleme" 8972 8973#: lazarusidestrconsts.lisdonotshowsplashscreen 8974msgid "Do not show splash screen" 8975msgstr "Açılış ekranı gösterme" 8976 8977#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject 8978msgid "Do not show this dialog for this project" 8979msgstr "Bu iletişim kutusunu bu proje için gösterme" 8980 8981#: lazarusidestrconsts.lisdonotshowthismessageagain 8982msgid "Do not show this message again" 8983msgstr "Bu mesajı tekrar gösterme" 8984 8985#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild 8986msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured." 8987msgstr "Derlemeden sonra güncellenmiş proje bilgi dosyasını yazmayın. Belirtilmezse, yapılandırılmışsa derleme numarası artırılır." 8988 8989#: lazarusidestrconsts.lisdonwloadonlinepackages 8990#, object-pascal-format 8991msgid "" 8992"The following package(s) are not available locally: %s.\n" 8993"In order to install it, you must download them first. Download now?" 8994msgstr "" 8995"Aşağıdaki paketler yerel olarak mevcut değildir: %s.\n" 8996"Yüklemek için önce onları indirmelisiniz. Şimdi İndirin?" 8997 8998#: lazarusidestrconsts.lisdown 8999msgctxt "lazarusidestrconsts.lisdown" 9000msgid "Down" 9001msgstr "Aşağı" 9002 9003#: lazarusidestrconsts.lisdowngrade 9004msgid "Downgrade" 9005msgstr "Düşürme" 9006 9007#: lazarusidestrconsts.lisdowngradeconfiguration 9008msgid "Downgrade configuration" 9009msgstr "Düşen konfigürasyon" 9010 9011#: lazarusidestrconsts.lisdownload 9012msgid "Download" 9013msgstr "İndir" 9014 9015#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject 9016msgid "Do you still want to create the new project?" 9017msgstr "Hala yeni proje oluşturmak istiyor musunuz?" 9018 9019#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject 9020msgid "Do you still want to open another project?" 9021msgstr "Yine de başka bir proje açmak istiyor musunuz?" 9022 9023#: lazarusidestrconsts.lisdoyoustillwanttoquit 9024msgid "Do you still want to quit?" 9025msgstr "Hala ayrılmak istiyor musun?" 9026 9027#: lazarusidestrconsts.lisdrawgridlinesobjectinspector 9028msgid "Draw grid lines" 9029msgstr "Izgara çizgileri çiz" 9030 9031#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn 9032msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing." 9033msgstr "Mesajlar penceresinin odağı olmasa bile seçimi odaklanmış olarak çizin. Temanızda neredeyse hiç net görünmeyen bir çizim varsa, bunu kullanın." 9034 9035#: lazarusidestrconsts.lisdropdowncount 9036msgid "Drop Down Count" 9037msgstr "Aşağı açılır sayısı" 9038 9039#: lazarusidestrconsts.lisdsgcopycomponents 9040msgid "Copy selected components to clipboard" 9041msgstr "Seçilen bileşenleri panoya kopyala" 9042 9043#: lazarusidestrconsts.lisdsgcutcomponents 9044msgid "Cut selected components to clipboard" 9045msgstr "Seçilen bileşenleri panoya kopyala" 9046 9047#: lazarusidestrconsts.lisdsgorderbackone 9048msgid "Move component one back" 9049msgstr "Bileşeni geriye taşıyın" 9050 9051#: lazarusidestrconsts.lisdsgorderforwardone 9052msgid "Move component one forward" 9053msgstr "Bileşeni bir ileriye taşıyın" 9054 9055#: lazarusidestrconsts.lisdsgordermovetoback 9056msgid "Move component to back" 9057msgstr "Bileşeni arkaya taşı" 9058 9059#: lazarusidestrconsts.lisdsgordermovetofront 9060msgid "Move component to front" 9061msgstr "Bileşeni öne taşıyın" 9062 9063#: lazarusidestrconsts.lisdsgpastecomponents 9064msgid "Paste selected components from clipboard" 9065msgstr "Seçilen bileşenleri panodan yapıştırın" 9066 9067#: lazarusidestrconsts.lisdsgselectparentcomponent 9068msgid "Select parent component" 9069msgstr "Üst bileşen seç" 9070 9071#: lazarusidestrconsts.lisdsgshownonvisualcomponents 9072msgid "Show nonvisual components" 9073msgstr "Görsel olmayan bileşenleri göster" 9074 9075#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents 9076msgid "Toggle showing nonvisual components" 9077msgstr "Görsel olmayan bileşenleri gösterme" 9078 9079#: lazarusidestrconsts.lisduplicate 9080msgid "Duplicate" 9081msgstr "Aynı" 9082 9083#: lazarusidestrconsts.lisduplicateentry 9084msgid "Duplicate entry" 9085msgstr "Yinelenen giriş" 9086 9087#: lazarusidestrconsts.lisduplicatefilename 9088msgid "Duplicate File Name" 9089msgstr "Yinelenen Dosya Adı" 9090 9091#: lazarusidestrconsts.lisduplicatefoundofvalue 9092#, object-pascal-format 9093msgid "Duplicate found of value \"%s\"." 9094msgstr "Yinelenen değer \"%s\" bulundu." 9095 9096#: lazarusidestrconsts.lisduplicatemodename 9097#, object-pascal-format 9098msgid "Mode \"%s\" is already present in the list." 9099msgstr "\"%s\" modu listede zaten var." 9100 9101#: lazarusidestrconsts.lisduplicatename 9102msgid "Duplicate Name" 9103msgstr "Yinelenen ad" 9104 9105#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe 9106#, object-pascal-format 9107msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" 9108msgstr "Yinelenen ad: \"%s\" adlı bir bileşen, devralınan bileşen %s içinde zaten var" 9109 9110#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths 9111msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9112msgstr "Yinelenen ppu dosyaları. Birini silin veya tüm arama yollarının doğru sırada olduğundan emin olun (İpucu: FPC önce son yolu kullanır)." 9113 9114#: lazarusidestrconsts.lisduplicatesearchpath 9115msgid "Duplicate search path" 9116msgstr "Arama yolunu çoğalt" 9117 9118#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh 9119msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9120msgstr "Yinelenen kaynaklar. Birini silin veya tüm arama yollarının doğru sırada olduğundan emin olun (İpucu: FPC önce son yolu kullanır)." 9121 9122#: lazarusidestrconsts.lisduplicateunit 9123msgid "Duplicate Unit" 9124msgstr "Birim Çoğalt" 9125 9126#: lazarusidestrconsts.lisduplicateunitin 9127#, object-pascal-format 9128msgid "Duplicate unit \"%s\" in \"%s\"" 9129msgstr "\"%s\" ile \"%s\" aynı birim" 9130 9131#: lazarusidestrconsts.lisdynpkgamounttoscrollin 9132msgid "Amount to scroll in" 9133msgstr "" 9134 9135#: lazarusidestrconsts.lisdynpkgamounttoscrollin2 9136msgid "Amount to scroll in (%)" 9137msgstr "" 9138 9139#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax 9140msgid "Amount to scroll in (Max)" 9141msgstr "" 9142 9143#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa 9144msgid "Auto Scroll on delete past left border" 9145msgstr "" 9146 9147#: lazarusidestrconsts.lisdynpkgautoscrollontypepast 9148msgid "Auto Scroll on type past right border" 9149msgstr "" 9150 9151#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw 9152msgid "Trigger on min chars (% of width)" 9153msgstr "" 9154 9155#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis 9156msgid "Trigger on min chars visible" 9157msgstr "" 9158 9159#: lazarusidestrconsts.lisedit 9160msgctxt "lazarusidestrconsts.lisedit" 9161msgid "Edit" 9162msgstr "Düzen" 9163 9164#: lazarusidestrconsts.liseditadditionalhelpformessages 9165msgid "Edit additional help for messages" 9166msgstr "İletiler için ek yardım düzenleme" 9167 9168#: lazarusidestrconsts.liseditcontexthelp 9169msgid "Edit context help" 9170msgstr "Bağlam yardımını düzenle" 9171 9172#: lazarusidestrconsts.lisedithelp 9173msgid "Edit help" 9174msgstr "Yardım düzenle" 9175 9176#: lazarusidestrconsts.liseditkey 9177msgid "Edit Key" 9178msgstr "Tuş Düzenle" 9179 9180#: lazarusidestrconsts.liseditorcolors 9181msgid "Editor Colors" 9182msgstr "Editör Renkleri" 9183 9184#: lazarusidestrconsts.liseditormacros 9185msgid "Editor Macros" 9186msgstr "Editör makroları" 9187 9188#: lazarusidestrconsts.liseditortoolbar 9189msgid "Editor ToolBar" 9190msgstr "Editör Araç Çubuğu" 9191 9192#: lazarusidestrconsts.liseditortoolbarsettings 9193msgid "Editor Toolbar Settings" 9194msgstr "Editör Araç Çubuğu Ayarları" 9195 9196#: lazarusidestrconsts.liseditortoolbarvisible 9197msgid "Editor Toolbar is &visible" 9198msgstr "Editör &Araç Çubuğu görünsün" 9199 9200#: lazarusidestrconsts.lisedoptsloadascheme 9201msgid "Load a scheme" 9202msgstr "Bir şema yükle" 9203 9204#: lazarusidestrconsts.lisedtdefallpackages 9205msgid "All packages" 9206msgstr "Tüm paketler" 9207 9208#: lazarusidestrconsts.lisedtdefcurrentproject 9209msgid "Current Project" 9210msgstr "Mevcut Proje" 9211 9212#: lazarusidestrconsts.lisedtdefsallprojects 9213msgid "All projects" 9214msgstr "Tüm projeler" 9215 9216#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi 9217msgid "set FPC mode to DELPHI" 9218msgstr "fPC modunu DELPHI olarak ayarla" 9219 9220#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc 9221msgid "set FPC mode to FPC" 9222msgstr "fPC modunu FPC'ye ayarla" 9223 9224#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc 9225msgid "set FPC mode to GPC" 9226msgstr "fPC modunu GPC'ye ayarla" 9227 9228#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas 9229msgid "set FPC mode to MacPas" 9230msgstr "fPC modunu MacPas olarak ayarla" 9231 9232#: lazarusidestrconsts.lisedtdefsetfpcmodetotp 9233msgid "set FPC mode to TP" 9234msgstr "fPC modunu TP olarak ayarla" 9235 9236#: lazarusidestrconsts.lisedtdefsetiocheckson 9237msgid "set IOCHECKS on" 9238msgstr "iOCHECKS açık" 9239 9240#: lazarusidestrconsts.lisedtdefsetoverflowcheckson 9241msgid "set OVERFLOWCHECKS on" 9242msgstr "oVERFLOWCHECKS'yi açık" 9243 9244#: lazarusidestrconsts.lisedtdefsetrangecheckson 9245msgid "set RANGECHECKS on" 9246msgstr "rANGECHECKS'i açık" 9247 9248#: lazarusidestrconsts.lisedtdefuseheaptrcunit 9249msgid "use HeapTrc unit" 9250msgstr "heapTrc birimini kullanın" 9251 9252#: lazarusidestrconsts.lisedtdefuselineinfounit 9253msgid "use LineInfo unit" 9254msgstr "lineInfo birimini kullanın" 9255 9256#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename 9257msgid "A valid tool needs at least a title and a filename." 9258msgstr "Geçerli bir araç en az bir başlık ve bir dosya adı gerekiyor." 9259 9260#: lazarusidestrconsts.lisedtexttooledittool 9261msgid "Edit Tool" 9262msgstr "Aracı Düzenle" 9263 9264#: lazarusidestrconsts.lisedtexttoolkey 9265msgctxt "lazarusidestrconsts.lisedtexttoolkey" 9266msgid "Key" 9267msgstr "Tuş" 9268 9269#: lazarusidestrconsts.lisedtexttoolmacros 9270msgctxt "lazarusidestrconsts.lisedtexttoolmacros" 9271msgid "Macros" 9272msgstr "Makro" 9273 9274#: lazarusidestrconsts.lisedtexttoolparameters 9275msgid "Parameters:" 9276msgstr "Parametreler:" 9277 9278#: lazarusidestrconsts.lisedtexttoolprogramfilename 9279msgid "Program Filename:" 9280msgstr "Program Adı:" 9281 9282#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages 9283msgid "Scan output for FPC messages" 9284msgstr "Free Pascal Derleyici mesajları için tarama çıktısı" 9285 9286#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages 9287msgid "Scan output for \"make\" messages" 9288msgstr "Make mesajları için tarama çıktısı" 9289 9290#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired 9291msgid "Title and Filename required" 9292msgstr "Başlık ve Dosya Adı Gerekli" 9293 9294#: lazarusidestrconsts.lisedtexttoolworkingdirectory 9295msgid "Working Directory:" 9296msgstr "Çalışma dizini:" 9297 9298#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit 9299msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")" 9300msgstr "Mesaj önceliğini her zaman gösterecek şekilde yükseltin (varsayılan olarak düşük öncelikli \" ayrıntılı \\ \")" 9301 9302#: lazarusidestrconsts.lisemdall 9303msgctxt "lazarusidestrconsts.lisemdall" 9304msgid "All" 9305msgstr "Tümü" 9306 9307#: lazarusidestrconsts.lisemdemptymethods 9308msgctxt "lazarusidestrconsts.lisemdemptymethods" 9309msgid "Empty Methods" 9310msgstr "Boş Yöntemler" 9311 9312#: lazarusidestrconsts.lisemdfoundemptymethods 9313msgid "Found empty methods:" 9314msgstr "Boş yöntemler bulundu:" 9315 9316#: lazarusidestrconsts.lisemdnoclass 9317msgid "No class" 9318msgstr "Sınıf yok" 9319 9320#: lazarusidestrconsts.lisemdnoclassat 9321#, object-pascal-format 9322msgid "No class at %s(%s,%s)" 9323msgstr "Sınıf %s yok (%s,%s)" 9324 9325#: lazarusidestrconsts.lisemdonlypublished 9326msgid "Only published" 9327msgstr "Sadece yayınlandı" 9328 9329#: lazarusidestrconsts.lisemdpublic 9330msgid "Public" 9331msgstr "Halka açık" 9332 9333#: lazarusidestrconsts.lisemdpublished 9334msgid "Published" 9335msgstr "Yayınlanan" 9336 9337#: lazarusidestrconsts.lisemdremovemethods 9338msgid "Remove methods" 9339msgstr "Yöntemleri kaldır" 9340 9341#: lazarusidestrconsts.lisemdsearchintheseclasssections 9342msgid "Search in these class sections:" 9343msgstr "Bu sınıf bölümlerinde ara:" 9344 9345#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause 9346#, object-pascal-format 9347msgid "Unable to show empty methods of the current class, because%s%s" 9348msgstr "Geçerli sınıfın boş yöntemleri gösterilemiyor, çünkü %s %s" 9349 9350#: lazarusidestrconsts.lisempty 9351msgid "Empty" 9352msgstr "Boş" 9353 9354#: lazarusidestrconsts.lisemptydestinationforpublishing 9355msgid "Destination directory for publishing is either a relative path or empty." 9356msgstr "Yayımlama için hedef dizin göreceli bir yoldur veya boştur." 9357 9358#: lazarusidestrconsts.lisenableall 9359msgid "&Enable All" 9360msgstr "&Hepsini etkinleştir" 9361 9362#: lazarusidestrconsts.lisenableallinsamesource 9363msgid "Enable All in same source" 9364msgstr "Tümünü aynı kaynakta etkinleştir" 9365 9366#: lazarusidestrconsts.lisenablebreakpoint 9367msgid "Enable Breakpoint" 9368msgstr "Kesme noktasını etkinleştir" 9369 9370#: lazarusidestrconsts.lisenabled 9371msgctxt "lazarusidestrconsts.lisenabled" 9372msgid "Enabled" 9373msgstr "Etkin" 9374 9375#: lazarusidestrconsts.lisenabledonlyforpackages 9376msgid "Enabled only for packages." 9377msgstr "Sadece paketler için etkin." 9378 9379#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage 9380#, object-pascal-format 9381msgid ". Enable flag \"Use Unit\" of unit %s in package %s" 9382msgstr ". Paket %s içindeki %s birimi \" Birimi kullan\" bayrağını etkinleştir" 9383 9384#: lazarusidestrconsts.lisenablegroups 9385msgid "Enable Groups" 9386msgstr "Grupları Etkinleştir" 9387 9388#: lazarusidestrconsts.lisenablei18nforlfm 9389msgid "Enable I18N for LFM" 9390msgstr "LFM için I18N'yi etkinleştir" 9391 9392#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport 9393msgid "Enable internationalization and translation support" 9394msgstr "Uluslararasılaştırma ve çeviri desteğini etkinleştir" 9395 9396#: lazarusidestrconsts.lisenablemacros 9397msgid "Enable Macros" 9398msgstr "Makroları Etkinleştir" 9399 9400#: lazarusidestrconsts.lisenableoptiondwarf 9401msgid "Enable Dwarf 2 (-gw)?" 9402msgstr "(-gw) Dwarf 2 aktifleştir?" 9403 9404#: lazarusidestrconsts.lisenableoptiondwarf2 9405msgid "Enable Dwarf 2 (-gw)" 9406msgstr "(-gw) Dwarf 2 aktifleştir" 9407 9408#: lazarusidestrconsts.lisenableoptiondwarf2sets 9409msgid "Enable Dwarf 2 with sets" 9410msgstr "Ayarlarla Dwarf 2 aktifleştir" 9411 9412#: lazarusidestrconsts.lisenableoptiondwarf3 9413msgid "Enable Dwarf 3 (-gw3)" 9414msgstr "(-gw3) Dwarf 3 etkinleştir" 9415 9416#: lazarusidestrconsts.lisenableoptionxg 9417msgid "Enable Option -Xg?" 9418msgstr "-Xg seçeneğini etkinleştir?" 9419 9420#: lazarusidestrconsts.lisenableoptionxg2 9421msgid "Enable option -Xg" 9422msgstr "-Xg seçeneğini etkinleştir" 9423 9424#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix 9425msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier" 9426msgstr "Aktif = Return tuşuna basıldığında tüm tanımlayıcı değiştirilir ve Shift + Return öneki değiştirir, Pasif = Return tuşuna basıldığında öneki değiştirir ve Shift + Return tüm tanımlayıcıyı değiştirir" 9427 9428#: lazarusidestrconsts.lisenclose 9429msgid "Enclose" 9430msgstr "Dahil et" 9431 9432#: lazarusidestrconsts.lisencloseinifdef 9433msgid "Enclose in $IFDEF" 9434msgstr "$IFDEF dahil et" 9435 9436#: lazarusidestrconsts.lisencodingnumberoffilesfailed 9437#, object-pascal-format 9438msgid "Number of files failed to convert: %d" 9439msgstr "Dönüştürülemeyen dosya sayısı: %d" 9440 9441#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis 9442#, object-pascal-format 9443msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" 9444msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." 9445msgstr "Diskteki \"%s\"%s dosyasının kodlaması%s. Yeni kodlama%s." 9446 9447#: lazarusidestrconsts.lisendlessloopinmacros 9448msgid "Endless loop in macros" 9449msgstr "Makrolarda sonsuz döngü" 9450 9451#: lazarusidestrconsts.lisenternewnameformacros 9452#, object-pascal-format 9453msgid "Enter new name for Macro \"%s\"" 9454msgstr "Makro için \"%s\"\" yeni ad girin" 9455 9456#: lazarusidestrconsts.lisenvironmentvariablenameasparameter 9457msgid "Environment variable, name as parameter" 9458msgstr "Ortam değişkeni, parametrenin adı" 9459 9460#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound 9461msgid "Directory not found" 9462msgstr "Dizin bulunamadı" 9463 9464#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename 9465msgid "Invalid debugger filename" 9466msgstr "Geçersiz hata ayıklayıcı dosya adı" 9467 9468#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg 9469#, object-pascal-format 9470msgid "The debugger file \"%s\" is not an executable." 9471msgstr "\"%s\" hata ayıklayıcı dosyası yürütülebilir değil." 9472 9473#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg 9474#, object-pascal-format 9475msgid "Test directory \"%s\" not found." 9476msgstr "Test dizini \"%s\" bulunamadı." 9477 9478#: lazarusidestrconsts.liserrinvalidoption 9479#, object-pascal-format 9480msgid "Invalid option at position %d: \"%s\"" 9481msgstr "%d konumundaki geçersiz seçenek: \"%s\"" 9482 9483#: lazarusidestrconsts.liserrnooptionallowed 9484#, object-pascal-format 9485msgid "Option at position %d does not allow an argument: %s" 9486msgstr "%d konumundaki seçenek, bir bağımsız değişkene izin vermiyor: %s" 9487 9488#: lazarusidestrconsts.liserroptionneeded 9489#, object-pascal-format 9490msgid "Option at position %d needs an argument : %s" 9491msgstr "%d konumundaki seçenek bir argümana ihtiyaç duyuyor: %s" 9492 9493#: lazarusidestrconsts.liserror 9494msgid "Error: " 9495msgstr "Hata: " 9496 9497#: lazarusidestrconsts.liserrorcreatingfile 9498msgid "Error creating file" 9499msgstr "Dosya oluşturulurken hata oluştu" 9500 9501#: lazarusidestrconsts.liserrordeletingfile 9502msgid "Error deleting file" 9503msgstr "Dosya silinirken hata oluştu" 9504 9505#: lazarusidestrconsts.liserrorin 9506#, object-pascal-format 9507msgid "Error in %s" 9508msgstr "%s hatası" 9509 9510#: lazarusidestrconsts.liserrorinthecompilerfilename 9511msgid "Error in the compiler file name:" 9512msgstr "Derleyici dosya adında hata:" 9513 9514#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother 9515msgid "Error in the custom compiler options (Other):" 9516msgstr "Özel derleyici seçeneklerinde hata (Diğer):" 9517 9518#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol 9519msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):" 9520msgstr "Özel bağlayıcı seçeneklerinde hata (Derleyiciye derleme ve Bağlama/Geçiş seçenekleri):" 9521 9522#: lazarusidestrconsts.liserrorinthedebuggerpathaddition 9523msgid "Error in the \"Debugger path addition\":" 9524msgstr "\"Hata ayıklayıcı yolu ekinde\" hata:" 9525 9526#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles 9527msgid "Error in the search path for \"Include files\":" 9528msgstr "\"Dosya ekle\" için arama yolunda hata var:" 9529 9530#: lazarusidestrconsts.liserrorinthesearchpathforlibraries 9531msgid "Error in the search path for \"Libraries\":" 9532msgstr "\"Kitaplıklar\" için arama yolunda hata:" 9533 9534#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles 9535msgid "Error in the search path for \"Object files\":" 9536msgstr "\"Nesne dosyaları\" arama yolunda hata:" 9537 9538#: lazarusidestrconsts.liserrorinthesearchpathforothersources 9539msgid "Error in the search path for \"Other sources\":" 9540msgstr "\"Diğer kaynaklar\" arama yolunda hata:" 9541 9542#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles 9543msgid "Error in the search path for \"Other unit files\":" 9544msgstr "\"Diğer birim dosyaları\" arama yolunda hata:" 9545 9546#: lazarusidestrconsts.liserrorintheunitoutputdirectory 9547msgid "Error in the \"unit output directory\":" 9548msgstr "\"Birim çıktı dizininde\" hata:" 9549 9550#: lazarusidestrconsts.liserrorinvalidbuildmode 9551#, object-pascal-format 9552msgid "Error: (lazarus) invalid build mode \"%s\"" 9553msgstr "Hata: (lazarus) geçersiz derleme modu \"%s\"" 9554 9555#: lazarusidestrconsts.liserrorloadingfile 9556msgid "Error loading file" 9557msgstr "Dosya yüklenirken hata oluştu" 9558 9559#: lazarusidestrconsts.liserrorloadingfile2 9560#, object-pascal-format 9561msgid "Error loading file \"%s\":" 9562msgstr "\"%s\" dosyasını yüklerken hata oluştu:" 9563 9564#: lazarusidestrconsts.liserrorloadingfrom 9565#, object-pascal-format 9566msgid "Error loading %s from%s%s%s%s" 9567msgstr "%s%s%s%s adresinden %s yüklenirken hata oluştu" 9568 9569#: lazarusidestrconsts.liserrormovingcomponent 9570msgid "Error moving component" 9571msgstr "Bileşeni hareket ettirirken hata oluştu" 9572 9573#: lazarusidestrconsts.liserrormovingcomponent2 9574#, object-pascal-format 9575msgid "Error moving component %s:%s" 9576msgstr "%s bileşenini taşıma hatası: %s" 9577 9578#: lazarusidestrconsts.liserrornamingcomponent 9579msgid "Error naming component" 9580msgstr "Bileşen adlandırma hatası" 9581 9582#: lazarusidestrconsts.liserroropeningcomponent 9583msgid "Error opening component" 9584msgstr "Bileşen açılırken hata oluştu" 9585 9586#: lazarusidestrconsts.liserroropeningform 9587msgid "Error opening form" 9588msgstr "Form açma hatası" 9589 9590#: lazarusidestrconsts.liserrorparsinglfmcomponentstream 9591msgid "Error parsing lfm component stream." 9592msgstr "Lfm bileşen akışının ayrıştırılması sırasında hata oluştu." 9593 9594#: lazarusidestrconsts.liserrorreadingpackagelistfromfile 9595#, object-pascal-format 9596msgid "Error reading package list from file%s%s%s%s" 9597msgstr "%s%s%s%s dosyasından paket listesi okunurken hata oluştu" 9598 9599#: lazarusidestrconsts.liserrorreadingxml 9600msgid "Error reading XML" 9601msgstr "XML okunurken hata oluştu" 9602 9603#: lazarusidestrconsts.liserrorreadingxmlfile 9604#, object-pascal-format 9605msgid "Error reading xml file \"%s\"%s%s" 9606msgstr "Xml dosyası okunurken hata oluştu \"%s\" %s %s" 9607 9608#: lazarusidestrconsts.liserrorrenamingfile 9609msgid "Error renaming file" 9610msgstr "Dosya yeniden adlandırılırken bir hata oluştu" 9611 9612#: lazarusidestrconsts.liserrors 9613msgctxt "lazarusidestrconsts.liserrors" 9614msgid "Errors" 9615msgstr "Hatalar" 9616 9617#: lazarusidestrconsts.liserrors2 9618#, object-pascal-format 9619msgid ", Errors: %s" 9620msgstr ", Hatalar: %s" 9621 9622#: lazarusidestrconsts.liserrorsavingform 9623msgid "Error saving form" 9624msgstr "Form kaydetme hatası" 9625 9626#: lazarusidestrconsts.liserrorsavingto 9627#, object-pascal-format 9628msgid "Error saving %s to%s%s%s%s" 9629msgstr "%s, %s %s %s %s'ye kaydedilirken hata oluştu" 9630 9631#: lazarusidestrconsts.liserrorsettingthenameofacomponentto 9632#, object-pascal-format 9633msgid "Error setting the name of a component %s to %s" 9634msgstr "%s bileşeninin adını %s olarak ayarlama hatası" 9635 9636#: lazarusidestrconsts.liserrorwritingfile 9637#, object-pascal-format 9638msgid "Error writing file \"%s\"" 9639msgstr "Dosya \"%s\" yazarken hata oluştu" 9640 9641#: lazarusidestrconsts.liserrorwritingpackagelisttofile 9642#, object-pascal-format 9643msgid "Error writing package list to file%s%s%s%s" 9644msgstr "%s %s %s %s dosyasına paket listesi yazarken hata oluştu" 9645 9646#: lazarusidestrconsts.lisevalexpression 9647msgctxt "lazarusidestrconsts.lisevalexpression" 9648msgid "Eval expression" 9649msgstr "Eval ifadesi" 9650 9651#: lazarusidestrconsts.lisevaluate 9652msgid "E&valuate" 9653msgstr "Değe&rlendir" 9654 9655#: lazarusidestrconsts.lisevaluateall 9656msgid "Evaluate all" 9657msgstr "" 9658 9659#: lazarusidestrconsts.lisevaluatemodify 9660msgid "&Evaluate/Modify" 9661msgstr "&Değiştir/değerlendir" 9662 9663#: lazarusidestrconsts.liseventlogclear 9664msgid "Clear Events" 9665msgstr "Etkinlikleri Temizle" 9666 9667#: lazarusidestrconsts.liseventlogoptions 9668msgid "Event Log Options ..." 9669msgstr "Olay Günlüğü Seçenekleri ..." 9670 9671#: lazarusidestrconsts.liseventlogsavetofile 9672msgid "Save Events to File" 9673msgstr "Etkinlikleri Dosyaya Kaydet" 9674 9675#: lazarusidestrconsts.liseventslogaddcomment 9676msgid "Add Comment ..." 9677msgstr "Yorum ekle ..." 9678 9679#: lazarusidestrconsts.liseventslogaddcomment2 9680msgid "Add Comment" 9681msgstr "Yorum ekle" 9682 9683#: lazarusidestrconsts.liseverynthlinenumber 9684msgid "Every n-th line number" 9685msgstr "Her \"n\" inci satır numarası" 9686 9687#: lazarusidestrconsts.lisexamplefile 9688msgid "Example file:" 9689msgstr "Örnek dosyası:" 9690 9691#: lazarusidestrconsts.lisexamplesbuildallselected 9692msgid "Build all selected" 9693msgstr "Tüm seçileni derle" 9694 9695#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac 9696#, object-pascal-format 9697msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" 9698msgstr "Örnekler: %sIdentifier %sTMyEnum.Enum %sUnitname.Identifier %s # PackageName.UnitName.Identifier" 9699 9700#: lazarusidestrconsts.lisexamplesopenfirstselected 9701msgid "Open first selected" 9702msgstr "İlk seçileni aç" 9703 9704#: lazarusidestrconsts.lisexceptiondialog 9705msgid "Debugger Exception Notification" 9706msgstr "Hata ayıklayıcı Özel Durum Bildirimi" 9707 9708#: lazarusidestrconsts.lisexcludedatruntime 9709#, object-pascal-format 9710msgid "%s excluded at run time" 9711msgstr "%s çalışma zamanında hariç tutuldu" 9712 9713#: lazarusidestrconsts.lisexecutableisadirectory 9714#, object-pascal-format 9715msgid "executable \"%s\" is a directory" 9716msgstr "çalıştırılabilir \"%s\" bir dizin" 9717 9718#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun 9719#, object-pascal-format 9720msgid "executable \"%s\" lacks the permission to run" 9721msgstr "çalıştırılabilir \"%s\" çalıştırılacak izin yok" 9722 9723#: lazarusidestrconsts.lisexecutingcommandafter 9724msgid "Executing command after" 9725msgstr "Sonra komut çalıştırılıyor" 9726 9727#: lazarusidestrconsts.lisexecutingcommandbefore 9728msgid "Executing command before" 9729msgstr "Önce komut çalıştırılıyor" 9730 9731#: lazarusidestrconsts.lisexecutionstopped 9732msgid "Execution stopped" 9733msgstr "Yürütme durduruldu" 9734 9735#: lazarusidestrconsts.lisexecutionstoppedexitcode 9736#, object-pascal-format 9737msgid "Execution stopped with exit-code %1:d ($%2:s)" 9738msgstr "" 9739 9740#: lazarusidestrconsts.lisexit 9741msgctxt "lazarusidestrconsts.lisexit" 9742msgid "Exit" 9743msgstr "Çıkış" 9744 9745#: lazarusidestrconsts.lisexitcode 9746#, object-pascal-format 9747msgid "Exit code %s" 9748msgstr "Çıkış kodu %s" 9749 9750#: lazarusidestrconsts.lisexpandall 9751msgid "Expand All (*)" 9752msgstr "Hepsini genişlet (*)" 9753 9754#: lazarusidestrconsts.lisexpandallclasses 9755msgid "Expand all classes" 9756msgstr "Tüm sınıfları genişlet" 9757 9758#: lazarusidestrconsts.lisexpandallpackages 9759msgid "Expand all packages" 9760msgstr "Tüm paketleri genişlet" 9761 9762#: lazarusidestrconsts.lisexpandallunits 9763msgid "Expand all units" 9764msgstr "Tüm birimleri genişlet" 9765 9766#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor 9767msgid "Expanded filename of current editor file" 9768msgstr "Geçerli düzenleyici dosyasının genişletilmiş dosya adı" 9769 9770#: lazarusidestrconsts.lisexport 9771msgctxt "lazarusidestrconsts.lisexport" 9772msgid "Export" 9773msgstr "Dışa Aktar" 9774 9775#: lazarusidestrconsts.lisexportall 9776msgid "Export all" 9777msgstr "Tümünü dışa aktar" 9778 9779#: lazarusidestrconsts.lisexportallitemstofile 9780msgid "Export All Items to File" 9781msgstr "Tüm Öğeleri Dosyaya Ver" 9782 9783#: lazarusidestrconsts.lisexportenvironmentoptions 9784msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" 9785msgid "Export environment options" 9786msgstr "Dışa aktarma ortamı seçenekleri" 9787 9788#: lazarusidestrconsts.lisexporthtml 9789msgid "Export as HTML" 9790msgstr "HTML olarak dışa aktarma" 9791 9792#: lazarusidestrconsts.lisexportimport 9793msgid "Export / Import" 9794msgstr "Dışa/İçe aktar" 9795 9796#: lazarusidestrconsts.lisexportlist 9797msgid "Export list" 9798msgstr "Listeyi dışa aktar" 9799 9800#: lazarusidestrconsts.lisexportpackagelistxml 9801msgid "Export package list (*.xml)" 9802msgstr "Paket listesini dışa aktar (* .xml)" 9803 9804#: lazarusidestrconsts.lisexportselected 9805msgid "Export selected" 9806msgstr "Seçilenleri dışa aktar" 9807 9808#: lazarusidestrconsts.lisexportsub 9809msgid "Export >>" 9810msgstr "Dışa Aktar >>" 9811 9812#: lazarusidestrconsts.lisexpression 9813msgid "Expression:" 9814msgstr "İfade:" 9815 9816#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith 9817#, object-pascal-format 9818msgid "Extend include file search path of package \"%s\" with%s\"%s\"?" 9819msgstr "\"%s\" paketinin dosya arama yolunu %s \"%s\" ile genişletilsin mi?" 9820 9821#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith 9822#, object-pascal-format 9823msgid "Extend include files search path of project with%s\"%s\"?" 9824msgstr "Projenin include dosya arama yolunu %s ile genişlet \"%s\"?" 9825 9826#: lazarusidestrconsts.lisextendincludepath 9827msgid "Extend include path?" 9828msgstr "Yol genişletilsin mi?" 9829 9830#: lazarusidestrconsts.lisextendunitpath 9831msgid "Extend unit path?" 9832msgstr "Birim yolunu genişletilsin mi?" 9833 9834#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith 9835#, object-pascal-format 9836msgid "Extend unit search path of package \"%s\" with%s\"%s\"?" 9837msgstr "Paketin birim arama yolunu \"%s\" %s \"%s\" ile uzat?" 9838 9839#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith 9840#, object-pascal-format 9841msgid "Extend unit search path of project with%s\"%s\"?" 9842msgstr "Projenin birim arama yolunu %s ile genişlet\"%s\"?" 9843 9844#: lazarusidestrconsts.lisextract 9845msgid "Extract" 9846msgstr "Çıkart" 9847 9848#: lazarusidestrconsts.lisextractprocedure 9849msgctxt "lazarusidestrconsts.lisextractprocedure" 9850msgid "Extract Procedure" 9851msgstr "Prosedürü çıkart" 9852 9853#: lazarusidestrconsts.lisextremelyverbose 9854msgid "Extremely Verbose" 9855msgstr "Son derece ayrıntılı" 9856 9857#: lazarusidestrconsts.lisexttoolexternaltools 9858msgid "External Tools" 9859msgstr "Harici Araçlar" 9860 9861#: lazarusidestrconsts.lisexttoolmaximumtoolsreached 9862msgid "Maximum Tools reached" 9863msgstr "Maksimum Araçlar ulaştı" 9864 9865#: lazarusidestrconsts.lisexttoolthereisamaximumoftools 9866#, object-pascal-format 9867msgid "There is a maximum of %s tools." 9868msgstr "En fazla %s araç var." 9869 9870#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources 9871#, object-pascal-format 9872msgid "Failed to add %d not unique resource(s)" 9873msgstr "%d benzersiz kaynak (lar) eklenemedi" 9874 9875#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor 9876#, object-pascal-format 9877msgid "Failed to create Application Bundle for \"%s\"" 9878msgstr "\"%s\" için Uygulama Paketi oluşturulamadı." 9879 9880#: lazarusidestrconsts.lisfailedtoloadfoldstat 9881msgid "Failed to load fold state" 9882msgstr "Katlama durumu yüklenemedi" 9883 9884#: lazarusidestrconsts.lisfailedtoresolvemacros 9885msgid "failed to resolve macros" 9886msgstr "makroları çözemedi" 9887 9888#: lazarusidestrconsts.lisfailedtosavefile 9889msgid "Failed to save file." 9890msgstr "Dosya kaydedilemedi." 9891 9892#: lazarusidestrconsts.lisfatal 9893msgctxt "lazarusidestrconsts.lisfatal" 9894msgid "Fatal" 9895msgstr "Ölümcül" 9896 9897#: lazarusidestrconsts.lisfile 9898msgctxt "lazarusidestrconsts.lisfile" 9899msgid "File" 9900msgstr "Dosya" 9901 9902#: lazarusidestrconsts.lisfile2 9903msgid "File: " 9904msgstr "Dosya: " 9905 9906#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway 9907#, object-pascal-format 9908msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" 9909msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?" 9910msgstr "\"%s\"%s dosyası bir metin dosyasına benzemiyor.%s Yine de açılsın mı?" 9911 9912#: lazarusidestrconsts.lisfileextensionofprograms 9913msgid "File extension of programs" 9914msgstr "Programların dosya uzantıları" 9915 9916#: lazarusidestrconsts.lisfilefilter 9917msgid "File filter" 9918msgstr "Dosya filtresi" 9919 9920#: lazarusidestrconsts.lisfilefilters 9921msgid "File Filters" 9922msgstr "Dosya Filtreleri" 9923 9924#: lazarusidestrconsts.lisfilefiltersaddrow 9925msgid "Add Row" 9926msgstr "Satır ekle" 9927 9928#: lazarusidestrconsts.lisfilefiltersdeleterow 9929msgid "Delete Row" 9930msgstr "Satırı Sil" 9931 9932#: lazarusidestrconsts.lisfilefiltersinsertrow 9933msgid "Insert Row" 9934msgstr "Satır Ekle" 9935 9936#: lazarusidestrconsts.lisfilefiltersmask 9937msgid "File mask" 9938msgstr "Dosya maskesi" 9939 9940#: lazarusidestrconsts.lisfilefilterssetdefaults 9941msgid "Set defaults" 9942msgstr "Varsayılanları ayarla" 9943 9944#: lazarusidestrconsts.lisfilefilterstitle 9945msgid "These are file filters that will appear in all File Open dialogs" 9946msgstr "Bunlar, tüm Dosya Aç iletişim kutularında görünecek dosya filtreleridir" 9947 9948#: lazarusidestrconsts.lisfilefound 9949msgid "File found" 9950msgstr "Dosya bulundu" 9951 9952#: lazarusidestrconsts.lisfilehaschangedsave 9953#, object-pascal-format 9954msgid "File \"%s\" has changed. Save?" 9955msgstr "Dosya \"%s\" değiştirildi.Değişiklikler kaydedilsin mi?" 9956 9957#: lazarusidestrconsts.lisfilehasnoproject 9958msgid "File has no project" 9959msgstr "Dosyanın hiçbir proje yok" 9960 9961#: lazarusidestrconsts.lisfileisdirectory 9962msgid "File is directory" 9963msgstr "Dosya dizinidir" 9964 9965#: lazarusidestrconsts.lisfileisnotanexecutable 9966msgid "File is not an executable" 9967msgstr "Dosya yürütülebilir değil" 9968 9969#: lazarusidestrconsts.lisfileisnotwritable 9970msgid "File is not writable" 9971msgstr "Dosya yazılabilir değil" 9972 9973#: lazarusidestrconsts.lisfileissymlink 9974msgid "File is symlink" 9975msgstr "Dosya sembolik bağ" 9976 9977#: lazarusidestrconsts.lisfileisvirtual 9978#, object-pascal-format 9979msgid "File \"%s\" is virtual." 9980msgstr "Dosya \"%s\" sanal." 9981 9982#: lazarusidestrconsts.lisfilelinkerror 9983msgid "File link error" 9984msgstr "Dosya bağlantısı hatası" 9985 9986#: lazarusidestrconsts.lisfilenameaddress 9987msgid "Filename/Address" 9988msgstr "Dosya adı/Adresi" 9989 9990#: lazarusidestrconsts.lisfilenamestyle 9991msgid "Filename Style" 9992msgstr "Dosya Adı Stili" 9993 9994#: lazarusidestrconsts.lisfilenotfound 9995msgid "File not found" 9996msgstr "Dosya bulunamadı" 9997 9998#: lazarusidestrconsts.lisfilenotfound2 9999#, object-pascal-format 10000msgctxt "lazarusidestrconsts.lisfilenotfound2" 10001msgid "File \"%s\" not found." 10002msgstr "Dosya \"%s\" bulunamadı." 10003 10004#: lazarusidestrconsts.lisfilenotfound3 10005#, object-pascal-format 10006msgid "file %s not found" 10007msgstr "dosya %s bulunamadı" 10008 10009#: lazarusidestrconsts.lisfilenotfound4 10010msgid "file not found" 10011msgstr "dosya bulunamadı" 10012 10013#: lazarusidestrconsts.lisfilenotfound5 10014#, object-pascal-format 10015msgid "File not found:%s%s" 10016msgstr "Dosya bulunamadı: %s %s" 10017 10018#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit 10019#, object-pascal-format 10020msgid "File \"%s\" not found.%sDo you want to create it?" 10021msgstr "Dosya \"%s\" bulunamadı %s Oluşturmak ister misiniz?" 10022 10023#: lazarusidestrconsts.lisfilenotlowercase 10024msgid "File not lowercase" 10025msgstr "Dosya küçük harf değil" 10026 10027#: lazarusidestrconsts.lisfilenottext 10028msgid "File not text" 10029msgstr "Dosya değil metin" 10030 10031#: lazarusidestrconsts.lisfilescountconvertedtotextformat 10032#, object-pascal-format 10033msgid "%d files were converted to text format." 10034msgstr "%d dosya metin biçimine dönüştürüldü." 10035 10036#: lazarusidestrconsts.lisfilesettings 10037msgid "File Settings" 10038msgstr "Dosya Ayarları" 10039 10040#: lazarusidestrconsts.lisfileshasincorrectsyntax 10041#, object-pascal-format 10042msgid "File %s has incorrect syntax." 10043msgstr "Dosyada %s yanlış sözdizimi var." 10044 10045#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection 10046#, object-pascal-format 10047msgid "Files: %s, has Register procedure: %s, in package uses section: %s" 10048msgstr "Dosyalar: %s, Kayıt işlemi var: %s, içinde paket kullanıyor: %s" 10049 10050#: lazarusidestrconsts.lisfileshaverightencoding 10051msgid "*** All found files already have the right encoding ***" 10052msgstr "*** Bulunan tüm dosyalarda zaten doğru kodlama var ***" 10053 10054#: lazarusidestrconsts.lisfilesinasciiorutf8encoding 10055msgid "Files in ASCII or UTF-8 encoding" 10056msgstr "ASCII veya UTF-8 kodlamalı dosyalar" 10057 10058#: lazarusidestrconsts.lisfilesisconvertedtotextformat 10059#, object-pascal-format 10060msgid "File %s was converted to text format." 10061msgstr "Dosya %s metin formatına dönüştürülür." 10062 10063#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding 10064msgid "Files not in ASCII nor UTF-8 encoding" 10065msgstr "ASCII'de değil UTF-8 kodlamalı dosyalar" 10066 10067#: lazarusidestrconsts.lisfilewheredebugoutputiswritten 10068msgid "file where debug output is written to. If it is not specified, debug output is written to the console." 10069msgstr "hata ayıklama çıktısının yazıldığı dosya. Belirtilmezse, hata ayıklama çıktısı konsola yazılır." 10070 10071#: lazarusidestrconsts.lisfilter 10072msgid "Filter" 10073msgstr "Filtre" 10074 10075#: lazarusidestrconsts.lisfilter3 10076#, object-pascal-format 10077msgid "Filter: %s" 10078msgstr "Filtre: %s" 10079 10080#: lazarusidestrconsts.lisfilterallmessagesofcertaintype 10081msgid "Filter all messages of certain type" 10082msgstr "Belli türdeki tüm iletileri filtreleyin" 10083 10084#: lazarusidestrconsts.lisfilterallmessagesoftype 10085#, object-pascal-format 10086msgid "Filter all messages of type %s" 10087msgstr "%s türündeki tüm iletileri filtreleyin" 10088 10089#: lazarusidestrconsts.lisfilteralreadyexists 10090msgid "Filter already exists" 10091msgstr "Filtre zaten var" 10092 10093#: lazarusidestrconsts.lisfilterdebugmessagesandbelow 10094msgid "Filter Debug Messages and below" 10095msgstr "Hata Ayıklama Mesajlarını ve Altını Filtrele" 10096 10097#: lazarusidestrconsts.lisfilterhintsandbelow 10098msgid "Filter Hints and below" 10099msgstr "İpuçlarını ve altını filtrele" 10100 10101#: lazarusidestrconsts.lisfilterhintswithoutsourceposition 10102msgid "Filter Hints without Source Position" 10103msgstr "Kaynak Konumu Olmayan İpuçları Filtrele" 10104 10105#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency 10106msgid "Filter None, do not filter by urgency" 10107msgstr "Filtre Yok, acil olarak filtreleme yapmayın" 10108 10109#: lazarusidestrconsts.lisfilternonurgentmessages 10110msgid "Filter non urgent Messages" 10111msgstr "Acil olmayan mesajları filtrele" 10112 10113#: lazarusidestrconsts.lisfilternotesandbelow 10114msgid "Filter Notes and below" 10115msgstr "Notları ve altını filtrele" 10116 10117#: lazarusidestrconsts.lisfiltersets 10118msgid "Filter Sets" 10119msgstr "Filtre Ayarları" 10120 10121#: lazarusidestrconsts.lisfiltertheavailableoptionslist 10122msgid "Filter the available options list" 10123msgstr "Kullanılabilir seçenekler listesini filtrele" 10124 10125#: lazarusidestrconsts.lisfilterverbosemessagesandbelow 10126msgid "Filter Verbose Messages and below" 10127msgstr "Ayrıntılı Mesajları ve Altını Filtrele" 10128 10129#: lazarusidestrconsts.lisfilterwarningsandbelow 10130msgid "Filter Warnings and below" 10131msgstr "Uyarıları ve altını filtrele" 10132 10133#: lazarusidestrconsts.lisfind 10134msgid "Find ..." 10135msgstr "Bul ..." 10136 10137#: lazarusidestrconsts.lisfinddeclarationof 10138#, object-pascal-format 10139msgid "Find Declaration of %s" 10140msgstr "%s deklarasyonunu Bul" 10141 10142#: lazarusidestrconsts.lisfindfiledirectories 10143msgid "D&irectories" 10144msgstr "Kl&asör" 10145 10146#: lazarusidestrconsts.lisfindfilefilemask 10147msgid "Fi&le mask" 10148msgstr "D&osya maskesi" 10149 10150#: lazarusidestrconsts.lisfindfileincludesubdirectories 10151msgid "Include &sub directories" 10152msgstr "&Alt dizinleri dahil et" 10153 10154#: lazarusidestrconsts.lisfindfilemultilinepattern 10155msgid "&Multiline pattern" 10156msgstr "&Çok satırlı desen" 10157 10158#: lazarusidestrconsts.lisfindfilesearchallfilesinproject 10159msgid "search all files in &project" 10160msgstr "projedeki tüm dosyalarda ara" 10161 10162#: lazarusidestrconsts.lisfindfilesearchallopenfiles 10163msgid "search all &open files" 10164msgstr "tüm açı&k dosyalarda ara" 10165 10166#: lazarusidestrconsts.lisfindfilesearchinactivefile 10167msgid "search in &active file" 10168msgstr "aktif dosya için&de ara" 10169 10170#: lazarusidestrconsts.lisfindfilesearchindirectories 10171msgid "search in &directories" 10172msgstr "dizinlerde &arama" 10173 10174#: lazarusidestrconsts.lisfindfilessearchinprojectgroup 10175msgid "search in project &group" 10176msgstr "p&roje grubunda ara" 10177 10178#: lazarusidestrconsts.lisfindfilewhere 10179msgid "Where" 10180msgstr "Nerede" 10181 10182#: lazarusidestrconsts.lisfindkeycombination 10183msgid "Find key combination" 10184msgstr "Tuş kombinasyonunu bul" 10185 10186#: lazarusidestrconsts.lisfindmissingunit 10187msgid "Find missing unit" 10188msgstr "Eksik birimi bul" 10189 10190#: lazarusidestrconsts.lisfirst 10191msgid "First" 10192msgstr "İlk" 10193 10194#: lazarusidestrconsts.lisfirsttest 10195msgid "&First test" 10196msgstr "&İlk test" 10197 10198#: lazarusidestrconsts.lisfixlfmfile 10199msgid "Fix LFM file" 10200msgstr "LFM dosyasını düzelt" 10201 10202#: lazarusidestrconsts.lisfloatingpoin 10203msgid "Floating Point" 10204msgstr "Kayan nokta" 10205 10206#: lazarusidestrconsts.lisfocushint 10207msgid "Focus hint" 10208msgstr "İpucuna odaklan" 10209 10210#: lazarusidestrconsts.lisforcerenaming 10211msgid "Force renaming" 10212msgstr "Yeniden adlandırmayı zorla" 10213 10214#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers 10215msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units" 10216msgstr "Örneğin, yerel değişkenleri, sonra geçerli sınıfın üyelerini, sonra ataları, sonra geçerli birimi, sonra kullanılan birimleri gösterir" 10217 10218#: lazarusidestrconsts.lisform 10219msgid "Form" 10220msgstr "Form" 10221 10222#: lazarusidestrconsts.lisformacosdarwin 10223msgid "For macOS (Darwin)" 10224msgstr "MacOs(Darwin) için" 10225 10226#: lazarusidestrconsts.lisformaterror 10227msgid "Format error" 10228msgstr "Format hatası" 10229 10230#: lazarusidestrconsts.lisforwindows 10231msgid "For Windows" 10232msgstr "Windows için" 10233 10234#: lazarusidestrconsts.lisfoundversionexpected 10235#, object-pascal-format 10236msgid "Found version %s, expected %s" 10237msgstr "Sürüm %s bulundu, bekleniyor %s" 10238 10239#: lazarusidestrconsts.lisfpcfullversioneg20701 10240msgid "FPC version as one number (e.g. 20701)" 10241msgstr "Bir sayı olarak FPC sürümü (ör. 20701)" 10242 10243#: lazarusidestrconsts.lisfpcmakefailed 10244msgid "fpcmake failed" 10245msgstr "fpcmake başarısız oldu" 10246 10247#: lazarusidestrconsts.lisfpcmessagefile2 10248msgid "FPC message file:" 10249msgstr "FPC ileti dosyası:" 10250 10251#: lazarusidestrconsts.lisfpcmessagesappendix 10252msgid "FPC messages: Appendix" 10253msgstr "FPC mesajları: Ek" 10254 10255#: lazarusidestrconsts.lisfpcresources 10256msgid "FPC resources (.res)" 10257msgstr "FPC kaynakları (.res)" 10258 10259#: lazarusidestrconsts.lisfpcsources 10260msgid "FPC sources" 10261msgstr "FPC kaynakları" 10262 10263#: lazarusidestrconsts.lisfpctooold 10264msgid "FPC too old" 10265msgstr "FPC çok eski" 10266 10267#: lazarusidestrconsts.lisfpcversion 10268msgid "FPC Version: " 10269msgstr "FPC Sürümü: " 10270 10271#: lazarusidestrconsts.lisfpcversioneg222 10272msgid "FPC Version (e.g. 2.2.2)" 10273msgstr "FPC Sürümü (ör. 2.2.2)" 10274 10275#: lazarusidestrconsts.lisfpdoceditor 10276msgctxt "lazarusidestrconsts.lisfpdoceditor" 10277msgid "FPDoc Editor" 10278msgstr "FPDoc Editör" 10279 10280#: lazarusidestrconsts.lisfpdocerrorwriting 10281#, object-pascal-format 10282msgid "Error writing \"%s\"%s%s" 10283msgstr "\"%s\"%s%s yazılırken hata oluştu" 10284 10285#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror 10286msgid "FPDoc syntax error" 10287msgstr "FPDoc sözdizimi hatası" 10288 10289#: lazarusidestrconsts.lisfpdocpackagename 10290msgid "FPDoc package name:" 10291msgstr "FPDoc paket adı:" 10292 10293#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename 10294msgid "FPDoc package name. Default is project file name." 10295msgstr "FPDoc paket adı, varsayılan proje dosyası adıdır." 10296 10297#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement 10298#, object-pascal-format 10299msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" 10300msgstr "Fpdoc öğesinde \"%s\"bir sözdizimi hatası var: %s %s" 10301 10302#: lazarusidestrconsts.lisfppkgcompilernotexecutable 10303#, object-pascal-format 10304msgid "The compiler [%s] configured for Fppkg is not an executable." 10305msgstr "Fppkg için yapılandırılmış [%s] derleyicisi çalıştırılabilir değil." 10306 10307#: lazarusidestrconsts.lisfppkgcompilernotexists 10308#, object-pascal-format 10309msgid "The compiler [%s] configured for Fppkg does not exist." 10310msgstr "Fppkg için yapılandırılmış derleyici [%s] mevcut değil." 10311 10312#: lazarusidestrconsts.lisfppkgcompilernotfound 10313#, object-pascal-format 10314msgid "Could not find the compiler [%s] configured for Fppkg." 10315msgstr "Fppkg için yapılandırılmış derleyici [%s] bulunamadı." 10316 10317#: lazarusidestrconsts.lisfppkgcompilerproblem 10318msgid "there is a problem with the Free Pascal compiler executable, " 10319msgstr "free Pascal derleyicisinin çalıştırılabilirliği ile ilgili bir sorun var, " 10320 10321#: lazarusidestrconsts.lisfppkgconfgenproblems 10322msgid "Warnings have to be resolved first" 10323msgstr "İlk önce uyarılar çözülmek zorunda" 10324 10325#: lazarusidestrconsts.lisfppkgconfiguration 10326msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default." 10327msgstr "Yapılandırma dosyası genellikle \"fppkg.cfg\" adına sahiptir. Hatalı olduğunda Free Pascal paketlerine bağımlılıkları çözmek mümkün olmayabilir. Varsayılanı kullanmak için boş bırakın." 10328 10329#: lazarusidestrconsts.lisfppkgcreatefilefailed 10330#, object-pascal-format 10331msgid "Failed to generate the configuration file \"%s\": %s" 10332msgstr "\"%s\" yapılandırma dosyası oluşturulamadı: %s" 10333 10334#: lazarusidestrconsts.lisfppkgfilestobewritten 10335msgid "Files to be written:" 10336msgstr "Yazılacak dosyalar:" 10337 10338#: lazarusidestrconsts.lisfppkgfixconfiguration 10339msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually." 10340msgstr "Konfigürasyon dosyalarını otomatik olarak geri yüklemeyi deneyebilir veya konfigürasyon dosyasını manuel olarak uyarlayabilirsiniz." 10341 10342#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed 10343msgid "Failed to retrieve the version of the fpcmkcfg configuration tool." 10344msgstr "Fpcmkcfg yapılandırma aracının sürümü alınamadı." 10345 10346#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing 10347msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files." 10348msgstr "Yapılandırma dosyalarını oluşturmak için gereken fpcmkcfg yapılandırma aracı bulunamadı." 10349 10350#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded 10351msgid "An up-to-date version is needed to create the configuration files." 10352msgstr "Yapılandırma dosyalarını oluşturmak için güncel bir sürüm gerekir." 10353 10354#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold 10355msgid "It is probably too old to create the configuration files." 10356msgstr "Konfigürasyon dosyalarını oluşturmak için muhtemelen çok eskidir." 10357 10358#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold 10359#, object-pascal-format 10360msgid "The fpcmkcfg configuration tool it too old [%s]." 10361msgstr "Fpcmkcfg yapılandırma aracı çok eski [%s]." 10362 10363#: lazarusidestrconsts.lisfppkginstallationpath 10364#, object-pascal-format 10365msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\"" 10366msgstr "Free Pascal Derleyici kurulumunun öneki gereklidir. Örneğin, \"%s\" ve/veya \"%s\" birimlerine sahiptir." 10367 10368#: lazarusidestrconsts.lisfppkglibprefix 10369#, object-pascal-format 10370msgid "Fpc library prefix: %s" 10371msgstr "Fpc kütüphane öneki: %s" 10372 10373#: lazarusidestrconsts.lisfppkgprefix 10374#, object-pascal-format 10375msgid "Fpc prefix: %s" 10376msgstr "Fpc öneki: %s" 10377 10378#: lazarusidestrconsts.lisfppkgproblem 10379msgid "Problem with Fppkg configuration" 10380msgstr "Fppkg yapılandırmasıyla ilgili sorun" 10381 10382#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded 10383msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable." 10384msgstr "" 10385"Son sürümün yüklendiğinden ve yolun mevcut olduğundan veya derleyici tarafından çalıştırılabilir olduğundan emin olun.\n" 10386"." 10387 10388#: lazarusidestrconsts.lisfppkgrtlnotfound 10389msgid "Fppkg reports that the RTL is not installed." 10390msgstr "Fppkg, RTL'nin yüklü olmadığını bildiriyor." 10391 10392#: lazarusidestrconsts.lisfppkgwriteconfexception 10393#, object-pascal-format 10394msgid "A problem occurred while trying to create a new Fppkg configuration: %s" 10395msgstr "Yeni bir Fppkg yapılandırması oluşturmaya çalışırken bir sorun oluştu: %s" 10396 10397#: lazarusidestrconsts.lisfppkgwriteconffailed 10398#, object-pascal-format 10399msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal." 10400msgstr "Yeni bir Fppkg yapılandırması oluşturulamadı (%s) Yapılandırmayı el ile düzeltmeniz veya Free Pascal'ı yeniden yüklemeniz gerekir." 10401 10402#: lazarusidestrconsts.lisfppkgwriteconfigfile 10403msgid "Write new configuration files" 10404msgstr "Yeni yapılandırma dosyaları yaz" 10405 10406#: lazarusidestrconsts.lisframe 10407msgid "Frame" 10408msgstr "Çerçeve" 10409 10410#: lazarusidestrconsts.lisfrbackwardsearch 10411msgid "&Backward search" 10412msgstr "&Öncekini ara" 10413 10414#: lazarusidestrconsts.lisfreeingbufferlines 10415#, object-pascal-format 10416msgid "freeing buffer lines: %s" 10417msgstr "arabellek satırlarını boşaltma: %s" 10418 10419#: lazarusidestrconsts.lisfreepascalcompilermessages 10420msgid "Free Pascal Compiler messages" 10421msgstr "Free Pascal Derleyici mesajları" 10422 10423#: lazarusidestrconsts.lisfreepascalprefix 10424msgid "Free Pascal compiler prefix" 10425msgstr "Free Pascal derleyici öneki" 10426 10427#: lazarusidestrconsts.lisfreepascalsourcedirectory 10428msgid "Free Pascal source directory" 10429msgstr "Free Pascal kaynak dizini" 10430 10431#: lazarusidestrconsts.lisfrforwardsearch 10432msgid "Forwar&d search" 10433msgstr "&Sonrakini Ara" 10434 10435#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp 10436msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" 10437msgstr "Aranacak diğer dosyalar (ör. /path/*.pas ;/path2/*.pp)" 10438 10439#: lazarusidestrconsts.lisfrifindorrenameidentifier 10440msgid "Find or Rename Identifier" 10441msgstr "Tanımlayıcıyı Bul veya Yeniden Adlandır" 10442 10443#: lazarusidestrconsts.lisfrifindreferences 10444msgid "Find References" 10445msgstr "Referanslarda Bul" 10446 10447#: lazarusidestrconsts.lisfriidentifier 10448#, object-pascal-format 10449msgid "Identifier: %s" 10450msgstr "Tanımlayıcı: %s" 10451 10452#: lazarusidestrconsts.lisfriinallopenpackagesandprojects 10453msgid "in all open packages and projects" 10454msgstr "açık paket ve projelerde" 10455 10456#: lazarusidestrconsts.lisfriincurrentunit 10457msgid "in current unit" 10458msgstr "geçerli birimde" 10459 10460#: lazarusidestrconsts.lisfriinmainproject 10461msgid "in main project" 10462msgstr "ana projede" 10463 10464#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit 10465msgid "in project/package owning current unit" 10466msgstr "projede/pakette mevcut birimde" 10467 10468#: lazarusidestrconsts.lisfriinvalididentifier 10469msgid "Invalid Identifier" 10470msgstr "Geçersiz Tanımlayıcı" 10471 10472#: lazarusidestrconsts.lisfrirenameallreferences 10473msgid "Rename all References" 10474msgstr "Tüm başvuruları yeniden adlandır" 10475 10476#: lazarusidestrconsts.lisfrirenaming 10477msgid "Renaming" 10478msgstr "Yeniden adlandır" 10479 10480#: lazarusidestrconsts.lisfrisearch 10481msgid "Search" 10482msgstr "Ara" 10483 10484#: lazarusidestrconsts.lisfrisearchincommentstoo 10485msgid "Search in comments too" 10486msgstr "Yorumlarda ara" 10487 10488#: lazarusidestrconsts.lisfull 10489msgid "Full" 10490msgstr "Tam" 10491 10492#: lazarusidestrconsts.lisfunction 10493msgctxt "lazarusidestrconsts.lisfunction" 10494msgid "Function" 10495msgstr "Fonksiyon" 10496 10497#: lazarusidestrconsts.lisgeneral 10498msgctxt "lazarusidestrconsts.lisgeneral" 10499msgid "General" 10500msgstr "Genel" 10501 10502#: lazarusidestrconsts.lisgeneratefppkgcfg 10503#, object-pascal-format 10504msgid "Fppkg configuration: %s" 10505msgstr "Fppkg yapılandırması: %s" 10506 10507#: lazarusidestrconsts.lisgeneratefppkgcompcfg 10508#, object-pascal-format 10509msgid "Fppkg compiler configuration: %s" 10510msgstr "Fppkg derleyici yapılandırması: %s" 10511 10512#: lazarusidestrconsts.lisgeneratefppkgconfiguration 10513msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool." 10514msgstr "Fpcmkcfg aracıyla yeni Fppkg yapılandırma dosyaları oluşturmak için bu ekranı kullanın." 10515 10516#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption 10517msgid "Generate new Fppkg configuration files" 10518msgstr "Yeni Fppkg yapılandırma dosyaları oluşturun" 10519 10520#: lazarusidestrconsts.lisgetwordatcurrentcursorposition 10521msgid "get word at current cursor position" 10522msgstr "mevcut imleç konumundan kelime alın" 10523 10524#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2 10525msgid "Get word at current cursor position." 10526msgstr "Mevcut imleç konumundan kelime alın." 10527 10528#: lazarusidestrconsts.lisglobalsettings 10529msgid "Global settings" 10530msgstr "Genel Ayarlar" 10531 10532#: lazarusidestrconsts.lisgotoline 10533msgid "Goto Line" 10534msgstr "Satıra Git" 10535 10536#: lazarusidestrconsts.lisgotoselected 10537msgid "Goto selected" 10538msgstr "Seçiliye git" 10539 10540#: lazarusidestrconsts.lisgplnotice 10541msgid "" 10542"<description>\n" 10543"\n" 10544"Copyright (C) <year> <name of author> <contact>\n" 10545"\n" 10546"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 10547"\n" 10548"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" 10549"\n" 10550"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 10551msgstr "" 10552"<Açıklama>\n" 10553"\n" 10554"Telif Hakkı (C) <yıl> <yazarın adı> <contact>\n" 10555"\n" 10556"Bu kaynak ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; Lisansın 2. sürümü veya (isteğe bağlı olarak) daha sonraki bir sürüm.\n" 10557"\n" 10558"Bu kod faydalı olacağı umuduyla dağıtılmıştır, ancak HİÇBİR GARANTİ YOKTUR; HİÇBİR AMAÇLI OLMAK İÇİN TİCARİRLİK veya FİTNESS'in zımni garantisi olmadan. Daha fazla bilgi için GNU Genel Kamu Lisansına bakınız.\n" 10559"\n" 10560"GNU Genel Kamu Lisansının bir kopyası World Wide Web'de <http://www.gnu.org/copyleft/gpl.html> adresinde bulunmaktadır. Ayrıca, Free Software Foundation, Inc.'e, 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazarak da elde edebilirsiniz." 10561 10562#: lazarusidestrconsts.lisgroup 10563msgid "Group" 10564msgstr "Grup" 10565 10566#: lazarusidestrconsts.lisgroupassignexisting 10567#, object-pascal-format 10568msgid "Assign to existing \"%s\" group?" 10569msgstr "Var olan \"%s\" grubuna ata?" 10570 10571#: lazarusidestrconsts.lisgroupemptydelete 10572#, object-pascal-format 10573msgid "No more breakpoints are assigned to group \"%s\", delete it?" 10574msgstr "\"%s\" grubuna daha fazla kesme noktası atanmadı, silinsin mi?" 10575 10576#: lazarusidestrconsts.lisgroupemptydeletemore 10577#, object-pascal-format 10578msgid "%sThere are %d more empty groups, delete all?" 10579msgstr "%sDaha fazla boş grup var %d hepsini silinsin mi?" 10580 10581#: lazarusidestrconsts.lisgrouplocalvariables 10582msgid "Group automatically defined local variables" 10583msgstr "Grup otomatik olarak tanımlanmış yerel değişkenleri" 10584 10585#: lazarusidestrconsts.lisgroupnameemptyclearinstead 10586msgid "The group name cannot be empty. Clear breakpoints' group(s)?" 10587msgstr "Grup adı boş olamaz.Kesme noktaları grubunu temizle?" 10588 10589#: lazarusidestrconsts.lisgroupnameinput 10590msgid "Group name:" 10591msgstr "Grup ismi:" 10592 10593#: lazarusidestrconsts.lisgroupnameinvalid 10594msgid "BreakpointGroup name must be a valid Pascal identifier name." 10595msgstr "Kesme noktası grubu adı, geçerli Pascal tanımlayıcı adı olmalıdır." 10596 10597#: lazarusidestrconsts.lisgroupsetnew 10598msgid "Set new group ..." 10599msgstr "Yeni gurup ayarla ..." 10600 10601#: lazarusidestrconsts.lisgroupsetnone 10602msgid "Clear group(s)" 10603msgstr "Temiz gruplar" 10604 10605#: lazarusidestrconsts.lisgroupsfordebugoutput 10606msgid "Enable or Disable groups of debug output. Valid Options are:" 10607msgstr "Hata giderme çıktı gruplarını etkinleştir veya devre dışı bırak. Geçerli Seçenekler şunlardır:" 10608 10609#: lazarusidestrconsts.lisgrowtolarges 10610msgid "Grow to Largest" 10611msgstr "En büyüğe büyümek" 10612 10613#: lazarusidestrconsts.lishashelp 10614msgid "Has Help" 10615msgstr "Yardım var" 10616 10617#: lazarusidestrconsts.lisheadercolors 10618msgid "Header colors" 10619msgstr "Başlık renkleri" 10620 10621#: lazarusidestrconsts.lisheadercommentforclass 10622msgid "Header comment for class" 10623msgstr "Sınıf için üstbilgi açıklaması" 10624 10625#: lazarusidestrconsts.lishelp 10626msgctxt "lazarusidestrconsts.lishelp" 10627msgid "Help" 10628msgstr "Yardım" 10629 10630#: lazarusidestrconsts.lishelpentries 10631msgid "Help entries" 10632msgstr "Yardım girdileri" 10633 10634#: lazarusidestrconsts.lishelpselectordialog 10635msgid "Help selector" 10636msgstr "Seçici yardım" 10637 10638#: lazarusidestrconsts.lishexadecimal 10639msgid "Hexadecimal" 10640msgstr "Onaltılık" 10641 10642#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage 10643msgid "Help for Free Pascal Compiler message" 10644msgstr "Free Pascal Derleyici mesajı için yardım" 10645 10646#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh 10647msgid "Hide all hints and warnings by inserting IDE directives {%H-}" 10648msgstr "IDE yönergeleri {% H-}\" ekleyerek tüm ipuçlarını ve uyarılarını gizle" 10649 10650#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh 10651msgid "Hide message at %s by inserting IDE directive {%H-}" 10652msgstr "%s adresindeki mesajı IDE yönergesi {% H-}\" ekleyerek gizle" 10653 10654#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh 10655msgid "Hide message by inserting IDE directive {%H-}" 10656msgstr "IDE direktifi {% H-}\" ekleyerek iletiyi gizle" 10657 10658#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit 10659#, object-pascal-format 10660msgid "Hide message by inserting {$warn %s off} to unit \"%s\"" 10661msgstr "{$warn %s off} ünitesini \"%s\" birimine ekleyerek mesajı gizle" 10662 10663#: lazarusidestrconsts.lishidesearch 10664msgid "Hide Search" 10665msgstr "Aramayı Gizle" 10666 10667#: lazarusidestrconsts.lishidewindow 10668msgctxt "lazarusidestrconsts.lishidewindow" 10669msgid "Hide window" 10670msgstr "Pencereyi gizle" 10671 10672#: lazarusidestrconsts.lishidewithpackageoptionvm 10673#, object-pascal-format 10674msgid "Hide with package option (-vm%s)" 10675msgstr "Paket seçeneğiyle gizle (-vm %s)" 10676 10677#: lazarusidestrconsts.lishidewithprojectoptionvm 10678#, object-pascal-format 10679msgid "Hide with project option (-vm%s)" 10680msgstr "Proje seçeneğiyle gizle (-vm %s)" 10681 10682#: lazarusidestrconsts.lishint 10683msgctxt "lazarusidestrconsts.lishint" 10684msgid "Hint" 10685msgstr "İpucu" 10686 10687#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals 10688msgid "Hint: A default value can be defined in the conditionals." 10689msgstr "İpucu: Koşullarda varsayılan bir değer tanımlanabilir." 10690 10691#: lazarusidestrconsts.lishintatpropertysnameshowsdescription 10692msgid "A hint at property's name shows its description." 10693msgstr "Mülkiyet adına verilen bir ipucu onun açıklamasını göstermektedir." 10694 10695#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename 10696msgid "Hint: Check if two packages contain a unit with the same name." 10697msgstr "İpucu: İki paketin aynı ada sahip bir birimi olup olmadığını kontrol edin." 10698 10699#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths 10700msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from." 10701msgstr "İpucu: Miras alınan yolların nereden geldiğini öğrenmek için \"Seçenekleri Göster\" i tıklayın." 10702 10703#: lazarusidestrconsts.lishints 10704#, object-pascal-format 10705msgid ", Hints: %s" 10706msgstr ", İpuçları: %s" 10707 10708#: lazarusidestrconsts.lishintsaveall 10709msgid "Save all" 10710msgstr "Hepsini kaydet" 10711 10712#: lazarusidestrconsts.lishintstepinto 10713msgid "Step Into" 10714msgstr "İçine adım" 10715 10716#: lazarusidestrconsts.lishintstepout 10717msgid "Run until function returns" 10718msgstr "Fonksiyon geri dönene kadar çalıştır" 10719 10720#: lazarusidestrconsts.lishintstepover 10721msgid "Step Over" 10722msgstr "Adım atmak" 10723 10724#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon 10725#, object-pascal-format 10726msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." 10727msgstr "İpucu: \"Make Resourcestring\" fonksiyonu bir sitringin sabit olmasını bekliyor.%s Lütfen ifadeyi seçin ve tekrar deneyin." 10728 10729#: lazarusidestrconsts.lishinttoggleformunit 10730msgid "Toggle Form/Unit" 10731msgstr "Form/Birim Değiştir" 10732 10733#: lazarusidestrconsts.lishintviewforms 10734msgid "View Forms" 10735msgstr "Formları Görüntüle" 10736 10737#: lazarusidestrconsts.lishintviewunits 10738msgid "View Units" 10739msgstr "Birimleri Görüntüle" 10740 10741#: lazarusidestrconsts.lishitcount 10742msgid "Hitcount" 10743msgstr "İsabet sayısı" 10744 10745#: lazarusidestrconsts.lishlpoptsdatabases 10746msgid "Databases" 10747msgstr "Veritabanları" 10748 10749#: lazarusidestrconsts.lishlpoptshelpoptions 10750msgid "Help Options" 10751msgstr "Yardım Seçenekleri" 10752 10753#: lazarusidestrconsts.lishlpoptsproperties 10754msgid "Properties:" 10755msgstr "Özellikler:" 10756 10757#: lazarusidestrconsts.lishlpoptsviewers 10758msgid "Viewers" 10759msgstr "İzleyiciler" 10760 10761#: lazarusidestrconsts.lishofpcdochtmlpath 10762msgid "FPC Doc HTML Path" 10763msgstr "FPC Doc HTML Yolu" 10764 10765#: lazarusidestrconsts.lishorizontal 10766msgid "Horizontal" 10767msgstr "Yatay" 10768 10769#: lazarusidestrconsts.lishorizontallinesbetweenproperties 10770msgid "Horizontal lines between properties." 10771msgstr "Özellikler arasında yatay çizgiler var." 10772 10773#: lazarusidestrconsts.lisid 10774msgctxt "lazarusidestrconsts.lisid" 10775msgid "ID" 10776msgstr "ID" 10777 10778#: lazarusidestrconsts.lisidcaddition 10779msgid "Addition" 10780msgstr "İlave" 10781 10782#: lazarusidestrconsts.lisidcopening 10783msgid "Opening" 10784msgstr "Açılıyor" 10785 10786#: lazarusidestrconsts.liside 10787msgid "IDE" 10788msgstr "IDE" 10789 10790#: lazarusidestrconsts.lisidebuildoptions 10791msgid "IDE build options" 10792msgstr "IDE kurulum seçenekleri" 10793 10794#: lazarusidestrconsts.lisidecompileandrestart 10795msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages." 10796msgstr "IDE paketleri kurulurken/kaldırılırken yeniden derlenecek ve yeniden başlatılacak." 10797 10798#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus 10799#, object-pascal-format 10800msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s" 10801msgstr "Lazarus'a hoş geldiniz.%0:s Bulunan IDE yapılandırması daha önce Lazarus'un başka bir kurulumu tarafından kullanılıyordu.%0:s Eğer iki veya daha fazla Lazarus kurulumunuz varsa, aynı konfigürasyonu paylaşmamaları gerekir. Bu, çakışmalara yol açabilir ve Lazarus kurulumlarınız kullanılamaz hale gelebilir.%0:s%0:s Yalnızca bir kurulumunuz varsa ve Lazarus çalıştırılabilir dosyasını kopyaladıysanız veya taşıdıysanız, bu yapılandırmayı yükseltebilirsiniz.%0:s%1:s%0:s%0:s Seçin:%0:s%0:s * Güncelleme bilgisi: Bu yapılandırmayı kullanın ve gelecekte bu Lazarus ile birlikte kullanılmak üzere güncelleyin. Eski kurulum artık bunu kullanmayacak.%0:s * Yoksay: Bu konfigürasyonu kullanın, ancak uyarıyı saklayın. Bu, diğer kurulumla çakışmalara neden olabilir.%0:s * İptal: Şimdi çıkın. Ardından, bu Lazarus'u doğru yapılandırma ile başlatarak sorunu çözebilirsiniz.%0:s%0:s Ek bilgiler:%0:s Bu yapılandırma şudur:%2:s%0:s Bu, Lazarus kurulumuna ait. :%3:s%0:s Geçerli IDE şu kaynaktan başlatıldı:%4:s%0:s" 10802 10803#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage 10804#, object-pascal-format 10805msgid "Creating Makefile for package %s" 10806msgstr "%s paketi için Makefile oluşturuluyor" 10807 10808#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage 10809#, object-pascal-format 10810msgid "Error: running 'compile after' tool failed for package %s" 10811msgstr "Hata: 'derleme sonrası' aracı çalıştırılıyor%s paketi için başarısız oldu" 10812 10813#: lazarusidestrconsts.lisideinfoinformationabouttheide 10814msgid "Information about the IDE" 10815msgstr "IDE hakkında bilgi" 10816 10817#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage 10818#, object-pascal-format 10819msgid "WARNING: unit name invalid %s, package=%s" 10820msgstr "UYARI: birim adı geçersiz %s, paket = %s" 10821 10822#: lazarusidestrconsts.lisidemacros 10823msgid "IDE Macros" 10824msgstr "IDE Makroları" 10825 10826#: lazarusidestrconsts.lisidemaintainsscaledinmainunit 10827msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit." 10828msgstr "IDE, Uygulamayı sürdürür. Ana ünitede ölçeklendirilmiş (Yüksek DPI)." 10829 10830#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit 10831msgid "The IDE maintains the title in main unit." 10832msgstr "IDE ana ünitede başlık tutar." 10833 10834#: lazarusidestrconsts.lisidentifier 10835msgid "identifier" 10836msgstr "tanımlayıcı" 10837 10838#: lazarusidestrconsts.lisidentifierbeginswith 10839msgid "Identifier begins with ..." 10840msgstr "Tanımlayıcı başlıyor ..." 10841 10842#: lazarusidestrconsts.lisidentifiercontains 10843msgid "Identifier contains ..." 10844msgstr "Tanımlayıcı içeriyor ..." 10845 10846#: lazarusidestrconsts.lisideoptions 10847msgid "IDE Options:" 10848msgstr "IDE Seçenekleri:" 10849 10850#: lazarusidestrconsts.lisidetitleshowsbuildmode 10851msgid "IDE title shows selected build mode" 10852msgstr "IDE başlığında seçili yapı modu gösterilsin" 10853 10854#: lazarusidestrconsts.lisidetitleshowsprojectdir 10855msgid "IDE title shows project directory" 10856msgstr "IDE başlığında proje dizinini göster" 10857 10858#: lazarusidestrconsts.lisidetitlestartswithprojectname 10859msgid "IDE title starts with project name" 10860msgstr "IDE başlığı proje adı ile başlasın" 10861 10862#: lazarusidestrconsts.lisiecoallbuildmodes 10863msgid "All build modes" 10864msgstr "Tüm yapı modları" 10865 10866#: lazarusidestrconsts.lisiecocompileroptionsof 10867msgid "Compiler options of" 10868msgstr "Derleyici seçenekleri" 10869 10870#: lazarusidestrconsts.lisiecocurrentbuildmode 10871msgid "Current build mode" 10872msgstr "Geçerli kurulum modu" 10873 10874#: lazarusidestrconsts.lisiecoerroropeningxml 10875msgid "Error opening XML" 10876msgstr "XML açılırken hata oluştu" 10877 10878#: lazarusidestrconsts.lisiecoerroropeningxmlfile 10879#, object-pascal-format 10880msgid "Error opening XML file \"%s\":%s%s" 10881msgstr "XML dosyası \"%s\"açılırken hata oluştu: %s %s" 10882 10883#: lazarusidestrconsts.lisiecoexportcompileroptions 10884msgid "Export Compiler Options" 10885msgstr "Derleyici Seçeneklerini Dışa Aktar" 10886 10887#: lazarusidestrconsts.lisiecoexportfileexists 10888msgid "Export file exists" 10889msgstr "Dışa aktarma dosyası var" 10890 10891#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti 10892#, object-pascal-format 10893msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" 10894msgstr "Dışa aktarma dosyası \"%s\" var.%s Dosyayı aç ve sadece derleyici seçeneklerini değiştirilsin mi?%s (Diğer ayarlar korunur.)" 10895 10896#: lazarusidestrconsts.lisiecoimportcompileroptions 10897msgid "Import Compiler Options" 10898msgstr "Alma Derleyici Seçenekleri" 10899 10900#: lazarusidestrconsts.lisiecoloadfromfile 10901msgid "Load from file" 10902msgstr "Dosyadan yükle" 10903 10904#: lazarusidestrconsts.lisieconocompileroptionsinfile 10905#, object-pascal-format 10906msgid "File \"%s\" does not contain compiler options." 10907msgstr "Dosya \"%s\" derleyici seçenekleri içermiyor." 10908 10909#: lazarusidestrconsts.lisiecorecentfiles 10910msgid "Recent files" 10911msgstr "Son Dosyalar" 10912 10913#: lazarusidestrconsts.lisiecosavetofile 10914msgid "Save to file" 10915msgstr "Dosyaya kaydet" 10916 10917#: lazarusidestrconsts.lisifnotchecked 10918msgid "If not checked:" 10919msgstr "Kontrol edilmediyse:" 10920 10921#: lazarusidestrconsts.lisifonlysessioninfochangedthenask 10922msgid "If only the session info changed, ask about saving it." 10923msgstr "Yalnızca oturum bilgileri değiştiyse, kaydetme hakkında bilgi isteyin." 10924 10925#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst 10926#, object-pascal-format 10927msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" 10928msgstr "İki farklı Lazarus sürümü kullanmak istiyorsanız, ikinci Lazarus'a birincil-config-path veya pcp.%s komut satırı parametresi ile başlatmalısınız. Örneğin:" 10929 10930#: lazarusidestrconsts.lisignore 10931msgctxt "lazarusidestrconsts.lisignore" 10932msgid "Ignore" 10933msgstr "Aldırmamak" 10934 10935#: lazarusidestrconsts.lisignoreall 10936msgid "Ignore all" 10937msgstr "Hepsini Yoksay" 10938 10939#: lazarusidestrconsts.lisignoreandcontinue 10940msgid "Ignore and continue" 10941msgstr "Yoksay ve devam et" 10942 10943#: lazarusidestrconsts.lisignoreexceptiontype 10944msgid "Ignore this exception type" 10945msgstr "Bu istisna türünü yoksay" 10946 10947#: lazarusidestrconsts.lisignoreuseasancestor 10948#, object-pascal-format 10949msgid "Ignore, use %s as ancestor" 10950msgstr "Yoksay, %s atası olarak kullan" 10951 10952#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage 10953msgid "Imitate indentation of current unit, project or package" 10954msgstr "Mevcut birimin, projenin veya paketin taklitini taklit edin" 10955 10956#: lazarusidestrconsts.lisimplementationcommentforclass 10957msgid "Implementation comment for class" 10958msgstr "Sınıf için uygulama yorumu" 10959 10960#: lazarusidestrconsts.lisimport 10961msgctxt "lazarusidestrconsts.lisimport" 10962msgid "Import" 10963msgstr "İçe aktar" 10964 10965#: lazarusidestrconsts.lisimportant 10966msgctxt "lazarusidestrconsts.lisimportant" 10967msgid "Important" 10968msgstr "Önemli" 10969 10970#: lazarusidestrconsts.lisimportenvironmentoptions 10971msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" 10972msgid "Import environment options" 10973msgstr "İçe aktarma ortamı seçenekleri" 10974 10975#: lazarusidestrconsts.lisimportfromfile 10976msgid "Import from File" 10977msgstr "Dosyayı İçe Aktar" 10978 10979#: lazarusidestrconsts.lisimportingbuildmodesnotsupported 10980msgid "Importing BuildModes is not supported for packages." 10981msgstr "Yapı Modellerini İçe Aktarma, paketler için desteklenmiyor." 10982 10983#: lazarusidestrconsts.lisimportlist 10984msgid "Import list" 10985msgstr "İçe aktarma listesi" 10986 10987#: lazarusidestrconsts.lisimportpackagelistxml 10988msgid "Import package list (*.xml)" 10989msgstr "Paketi listesi içe aktar (* .xml)" 10990 10991#: lazarusidestrconsts.lisimpossible 10992msgid "Impossible" 10993msgstr "İmkansız" 10994 10995#: lazarusidestrconsts.lisinasourcedirectoryofthepackage 10996#, object-pascal-format 10997msgid "In a source directory of the package \"%s\"." 10998msgstr "Paketin kaynak dizininde \"%s\"." 10999 11000#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates 11001msgid "In a source directory of the project. Check for duplicates." 11002msgstr "Projenin bir kaynak dizininde çoğaltıcı olup olmadığını kontrol edin." 11003 11004#: lazarusidestrconsts.lisincludeallsubdirectories 11005msgid "Include all subdirectories" 11006msgstr "Tüm alt dizinleri dahil et" 11007 11008#: lazarusidestrconsts.lisincludefilter 11009msgid "Include filter" 11010msgstr "Filtre ekle" 11011 11012#: lazarusidestrconsts.lisincludepath 11013msgid "include path" 11014msgstr "yolu ekle" 11015 11016#: lazarusidestrconsts.lisincludepaths 11017msgid "Include paths" 11018msgstr "Yolları ekle" 11019 11020#: lazarusidestrconsts.lisincludesubdirectories 11021msgid "Include subdirectories" 11022msgstr "Alt dizinleri dahil et" 11023 11024#: lazarusidestrconsts.lisincompatibleppu 11025#, object-pascal-format 11026msgid ", incompatible ppu=%s" 11027msgstr ", Uyumsuz ppu = %s" 11028 11029#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound 11030msgid "Incorrect configuration directory found" 11031msgstr "Yanlış yapılandırma dizini bulundu" 11032 11033#: lazarusidestrconsts.lisincorrectfppkgconfiguration 11034#, object-pascal-format 11035msgid "there is a problem with the Fppkg configuration. (%s)" 11036msgstr "fppkg yapılandırmasında bir sorun var. (%s)" 11037 11038#: lazarusidestrconsts.lisindentationforpascalsources 11039msgid "Indentation for Pascal sources" 11040msgstr "Pascal kaynakları için girinti" 11041 11042#: lazarusidestrconsts.lisindex 11043msgid "Index" 11044msgstr "Dizin" 11045 11046#: lazarusidestrconsts.lisinformation 11047msgid "Information" 11048msgstr "Bilgi" 11049 11050#: lazarusidestrconsts.lisinformationaboutunit 11051#, object-pascal-format 11052msgid "Information about %s" 11053msgstr "%s hakkında bilgi" 11054 11055#: lazarusidestrconsts.lisinformationaboutusedfpc 11056msgid "Information about used FPC" 11057msgstr "Kullanılmış FPC hakkında bilgi" 11058 11059#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag 11060msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." 11061msgstr "FPC biriminde arama yolu. Muhtemelen FPC paketi tarafından yüklenmiştir. Derleyici ve ppu dosyasının aynı kurulumdan olup olmadığını kontrol edin." 11062 11063#: lazarusidestrconsts.lisinfrontofrelated 11064msgid "In front of related" 11065msgstr "İlişkili olarak" 11066 11067#: lazarusidestrconsts.lisinheriteditem 11068msgid "Inherited Item" 11069msgstr "Devralınan Öğe" 11070 11071#: lazarusidestrconsts.lisinheritedparameters 11072msgid "Inherited parameters" 11073msgstr "Devralınan parametreler" 11074 11075#: lazarusidestrconsts.lisinheritedprojectcomponent 11076msgid "Inherited project component" 11077msgstr "Devralınan proje bileşeni" 11078 11079#: lazarusidestrconsts.lisinitializelocalvariable 11080msgid "Initialize Local Variable" 11081msgstr "Yerel Değişken Başlat" 11082 11083#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil 11084#, object-pascal-format 11085msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" 11086msgstr "Projenin/paketin temiz bir kopyasını oluşturmak için, aşağıdaki dizindeki tüm dosyalar silinecek ve tüm içeriği kaybolacak.%s \"%s\" içindeki tüm dosyaları sil?" 11087 11088#: lazarusidestrconsts.lisinsert 11089msgctxt "lazarusidestrconsts.lisinsert" 11090msgid "Insert" 11091msgstr "Ekle" 11092 11093#: lazarusidestrconsts.lisinsertassignment 11094#, object-pascal-format 11095msgid "Insert Assignment %s := ..." 11096msgstr "Atama Ekle %s: = ..." 11097 11098#: lazarusidestrconsts.lisinsertdate 11099msgid "insert date" 11100msgstr "tarih ekle" 11101 11102#: lazarusidestrconsts.lisinsertdateandtime 11103msgid "insert date and time" 11104msgstr "tarih ve saat ekle" 11105 11106#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring 11107msgid "Insert date and time. Optional: format string." 11108msgstr "Zaman ve tarih ekleyin. İsteğe bağlı: biçim dizesi." 11109 11110#: lazarusidestrconsts.lisinsertdateoptionalformatstring 11111msgid "Insert date. Optional: format string." 11112msgstr "Tarih ekleyin. İsteğe bağlı: biçim dizesi." 11113 11114#: lazarusidestrconsts.lisinsertendifneeded 11115msgid "insert end if needed" 11116msgstr "gerekirse end if ekleyin" 11117 11118#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure 11119msgid "" 11120"Insert header of current procedure.\n" 11121"\n" 11122"Optional Parameters (comma separated):\n" 11123"WithStart, // proc keyword e.g. 'function', 'class procedure'\n" 11124"WithoutClassKeyword,// without 'class' proc keyword\n" 11125"AddClassName, // extract/add ClassName.\n" 11126"WithoutClassName, // skip classname\n" 11127"WithoutName, // skip function name\n" 11128"WithoutParamList, // skip param list\n" 11129"WithVarModifiers, // extract 'var', 'out', 'const'\n" 11130"WithParameterNames, // extract parameter names\n" 11131"WithoutParamTypes, // skip colon, param types and default values\n" 11132"WithDefaultValues, // extract default values\n" 11133"WithResultType, // extract colon + result type\n" 11134"WithOfObject, // extract 'of object'\n" 11135"WithCallingSpecs, // extract cdecl; inline;\n" 11136"WithProcModifiers, // extract forward; alias; external;\n" 11137"WithComments, // extract comments and spaces\n" 11138"InUpperCase, // turn to uppercase\n" 11139"CommentsToSpace, // replace comments with a single space\n" 11140" // (default is to skip unnecessary space,\n" 11141" // e.g 'Do ;' normally becomes 'Do;'\n" 11142" // with this option you get 'Do ;')\n" 11143"WithoutBrackets, // skip start- and end-bracket of parameter list\n" 11144"WithoutSemicolon, // skip semicolon at end\n" 11145msgstr "" 11146"Geçerli prosedürün başlığını yerleştirin.\n" 11147"\n" 11148"İsteğe bağlı Parametreler (virgülle ayrılmış):\n" 11149"WithStart, // proc anahtar kelimesi ör. 'function', 'sınıf prosedürü'\n" 11150"WithoutClassKeyword, // 'class' proc anahtar sözcüğü olmadan\n" 11151"AddClassName, // özüt / ClassName ekleyin.\n" 11152"WithoutClassName, // sınıf adını atla\n" 11153"WithoutName, // işlev adını atla\n" 11154"WithoutParamList, // param listesini atla\n" 11155"WithVarModifiers, // 'var', 'out', 'const' ifadesini çıkarın.\n" 11156"WithParameterNames, // parametre adlarını çıkarın\n" 11157"WithoutParamTypes, // kolon atla, param tipleri ve varsayılan değerler\n" 11158"WithDefaultValues, // varsayılan değerleri al\n" 11159"WithResultType, // kolon + sonuç türünü çıkarın\n" 11160"WithOfObject, // 'nesne' ayıkla\n" 11161"WithCallingSpecs, // extract cdecl; Çizgide;\n" 11162"WithProcModifiers, // öne çıkar; takma; dış;\n" 11163"WithComments, // yorumları ve boşlukları çıkart\n" 11164"InUpperCase, // büyük harfe dön\n" 11165"CommentsToSpace, // yorumları bir boşlukla değiştirin\n" 11166" // (varsayılan olarak gereksiz yere atlamak,\n" 11167" // e.g 'Do;' normalde 'Yap;'\n" 11168" // bu seçenekle 'Yap;'\n" 11169"WithoutBrackets, // parametre listesinin başlangıç ve bitiş dirseklerini atlayın\n" 11170"WithoutSemicolon, // sonunda noktalı virgül atla\n" 11171 11172#: lazarusidestrconsts.lisinsertmacro 11173msgctxt "lazarusidestrconsts.lisinsertmacro" 11174msgid "Insert Macro" 11175msgstr "Makro ekle" 11176 11177#: lazarusidestrconsts.lisinsertnameofcurrentprocedure 11178msgid "Insert name of current procedure." 11179msgstr "Geçerli procedure adını ekleyin." 11180 11181#: lazarusidestrconsts.lisinsertprintshorttag 11182msgid "Insert PrintShort tag" 11183msgstr "Yazdırma kısayolu ekle" 11184 11185#: lazarusidestrconsts.lisinsertprintshorttag2 11186msgid "Insert printshort tag" 11187msgstr "Yazdırma kısayolu ekle" 11188 11189#: lazarusidestrconsts.lisinsertprocedurehead 11190msgid "insert procedure head" 11191msgstr "prosedür başlığı ekleyin" 11192 11193#: lazarusidestrconsts.lisinsertprocedurename 11194msgid "insert procedure name" 11195msgstr "procedure adını girin" 11196 11197#: lazarusidestrconsts.lisinsertsemicolonifneeded 11198msgid "Insert semicolon if needed" 11199msgstr "Gerekirse noktalı virgül ekleyin" 11200 11201#: lazarusidestrconsts.lisinserttime 11202msgid "insert time" 11203msgstr "zaman ekle" 11204 11205#: lazarusidestrconsts.lisinserttimeoptionalformatstring 11206msgid "Insert time. Optional: format string." 11207msgstr "Zaman ekleyin. İsteğe bağlı: biçim dizesi." 11208 11209#: lazarusidestrconsts.lisinserturltag 11210msgid "Insert url tag" 11211msgstr "URL etiketi ekle" 11212 11213#: lazarusidestrconsts.lisinsession 11214msgid "In session" 11215msgstr "Oturumda" 11216 11217#: lazarusidestrconsts.lisinspect 11218msgid "&Inspect" 11219msgstr "&Denetle" 11220 11221#: lazarusidestrconsts.lisinspectaddwatch 11222#, fuzzy 11223msgctxt "lazarusidestrconsts.lisinspectaddwatch" 11224msgid "Add watch" 11225msgstr "İzleme ekle" 11226 11227#: lazarusidestrconsts.lisinspectclassinherit 11228#, object-pascal-format 11229msgid "%s: class %s inherits from %s" 11230msgstr "%s: %s sınıfı %s kaynağından devralındı" 11231 11232#: lazarusidestrconsts.lisinspectdata 11233msgid "Data" 11234msgstr "Veri" 11235 11236#: lazarusidestrconsts.lisinspectdialog 11237msgid "Debug Inspector" 11238msgstr "Hata Ayıklama Denetçisi" 11239 11240#: lazarusidestrconsts.lisinspectmethods 11241msgid "Methods" 11242msgstr "Yöntemler" 11243 11244#: lazarusidestrconsts.lisinspectpointerto 11245#, object-pascal-format 11246msgid "Pointer to %s" 11247msgstr "%s işaretçisi" 11248 11249#: lazarusidestrconsts.lisinspectproperties 11250msgctxt "lazarusidestrconsts.lisinspectproperties" 11251msgid "Properties" 11252msgstr "Özellikler" 11253 11254#: lazarusidestrconsts.lisinspectshowcolclass 11255msgid "Show class column" 11256msgstr "Sınıf sütununu göster" 11257 11258#: lazarusidestrconsts.lisinspectshowcoltype 11259msgid "Show type column" 11260msgstr "Tip sütununu göster" 11261 11262#: lazarusidestrconsts.lisinspectshowcolvisibility 11263msgid "Show visibility column" 11264msgstr "Görünürlük sütununu göster" 11265 11266#: lazarusidestrconsts.lisinspectunavailableerror 11267#, object-pascal-format 11268msgid "%s: unavailable (error: %s)" 11269msgstr "%s: kullanılamıyor (hata:%s)" 11270 11271#: lazarusidestrconsts.lisinspectuseinstance 11272msgid "Instance" 11273msgstr "Örnek" 11274 11275#: lazarusidestrconsts.lisinspectuseinstancehint 11276msgid "Use instance class" 11277msgstr "Örnek sınıfını kullanın" 11278 11279#: lazarusidestrconsts.lisinstallationfailed 11280msgid "Installation failed" 11281msgstr "Yükleme başarısız" 11282 11283#: lazarusidestrconsts.lisinstalled 11284msgid "installed" 11285msgstr "yüklü" 11286 11287#: lazarusidestrconsts.lisinstallitilikethefat 11288msgid "Install it, I like the fat" 11289msgstr "Yükle, şişkin seviyorum" 11290 11291#: lazarusidestrconsts.lisinstallpackagesmsg 11292#, object-pascal-format 11293msgid "" 11294"The following packages are not installed, but available in the main repository: %s.\n" 11295"Do you wish to install missing packages?" 11296msgstr "" 11297"Aşağıdaki paketler yüklenmemiş, ancak ana depoda bulunmaktadır:%s.\n" 11298"Eksik paketleri yüklemek ister misiniz?" 11299 11300#: lazarusidestrconsts.lisinstallselection 11301msgid "Install selection" 11302msgstr "Seçimi yükle" 11303 11304#: lazarusidestrconsts.lisinstalluninstallpackages 11305msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" 11306msgid "Install/Uninstall Packages" 11307msgstr "Paketleri Yükle/Kaldır" 11308 11309#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile 11310msgid "Instead of compile package create a simple Makefile." 11311msgstr "Derleme paketi yerine basit bir Makefile oluşturun." 11312 11313#: lazarusidestrconsts.lisinsufficientencoding 11314msgid "Insufficient encoding" 11315msgstr "Yetersiz kodlama" 11316 11317#: lazarusidestrconsts.lisinteractive 11318msgid "Interactive" 11319msgstr "Etkileşimli" 11320 11321#: lazarusidestrconsts.lisinternalerror 11322#, object-pascal-format 11323msgid "internal error: %s" 11324msgstr "dahili hata: %s" 11325 11326#: lazarusidestrconsts.lisinvaliddelete 11327msgid "Invalid delete" 11328msgstr "Geçersiz silme" 11329 11330#: lazarusidestrconsts.lisinvalidexecutable 11331msgid "Invalid Executable" 11332msgstr "Geçersiz Yürütülebilir" 11333 11334#: lazarusidestrconsts.lisinvalidexecutablemessagetext 11335#, object-pascal-format 11336msgid "The file \"%s\" is not executable." 11337msgstr "\"%s\" dosyası yürütülebilir değil." 11338 11339#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction 11340#, object-pascal-format 11341msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." 11342msgstr "Geçersiz ifade.%s İpucu: \"Make Resourcestring\" foksiyonu, tek bir dosyada bir sabit stringi bekliyor. Lütfen ifadeyi seçin ve tekrar deneyin." 11343 11344#: lazarusidestrconsts.lisinvalidfilename 11345msgid "Invalid file name" 11346msgstr "Geçersiz dosya adı" 11347 11348#: lazarusidestrconsts.lisinvalidfilter 11349msgid "Invalid filter" 11350msgstr "Geçersiz filtre" 11351 11352#: lazarusidestrconsts.lisinvalidlinecolumninmessage 11353#, object-pascal-format 11354msgid "Invalid line, column in message%s%s" 11355msgstr "Geçersiz satır, ileti %s %s sütundaki sütun" 11356 11357#: lazarusidestrconsts.lisinvalidmacrosin 11358#, object-pascal-format 11359msgid "Invalid macros in \"%s\"" 11360msgstr "\"%s\" daki geçersiz makrolar" 11361 11362#: lazarusidestrconsts.lisinvalidmacrosinexternaltool 11363#, object-pascal-format 11364msgid "Invalid macros \"%s\" in external tool \"%s\"" 11365msgstr "Harici araç \"%s\" daki \"%s\" geçersiz makrolar" 11366 11367#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie 11368#, object-pascal-format 11369msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." 11370msgstr "%s geçersiz makro. Makro adı Pascal tanımlayıcı olmalı." 11371 11372#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword 11373#, object-pascal-format 11374msgid "Invalid macro name \"%s\". The name is a keyword." 11375msgstr "Geçersiz makro adı \"%s\". Ad bir anahtar kelimedir." 11376 11377#: lazarusidestrconsts.lisinvalidmask 11378msgid "Invalid Mask" 11379msgstr "Geçersiz Maske" 11380 11381#: lazarusidestrconsts.lisinvalidmode 11382#, object-pascal-format 11383msgid "Invalid mode %s" 11384msgstr "Geçersiz mod %s" 11385 11386#: lazarusidestrconsts.lisinvalidmultiselection 11387msgid "Invalid multiselection" 11388msgstr "Geçersiz çoklu seçim" 11389 11390#: lazarusidestrconsts.lisinvalidoff 11391msgid "Invalid (Off)" 11392msgstr "Geçersiz (Kapalı)" 11393 11394#: lazarusidestrconsts.lisinvalidon 11395msgid "Invalid (On)" 11396msgstr "Geçersiz (Açık)" 11397 11398#: lazarusidestrconsts.lisinvalidpascalidentifiercap 11399msgid "Invalid Pascal Identifier" 11400msgstr "Geçersiz Pascal Tanımlayıcı" 11401 11402#: lazarusidestrconsts.lisinvalidpascalidentifiername 11403#, object-pascal-format 11404msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?" 11405msgstr "\"%s\" ismi geçerli bir Pascal tanımlayıcısı değil.%s Yine de kullanılsın mı?" 11406 11407#: lazarusidestrconsts.lisinvalidprocname 11408msgid "Invalid proc name" 11409msgstr "Geçersiz proc adı" 11410 11411#: lazarusidestrconsts.lisinvalidprojectfilename 11412msgid "Invalid project filename" 11413msgstr "Geçersiz proje dosyası" 11414 11415#: lazarusidestrconsts.lisinvalidpublishingdirectory 11416msgid "Invalid publishing Directory" 11417msgstr "Geçersiz yayınlama Dizini" 11418 11419#: lazarusidestrconsts.lisinvalidselection 11420msgid "Invalid selection" 11421msgstr "Geçersiz seçim" 11422 11423#: lazarusidestrconsts.lisinvalidversionin 11424#, object-pascal-format 11425msgid "invalid version in %s" 11426msgstr "%s sürümü geçersiz" 11427 11428#: lazarusidestrconsts.lisisalreadypartoftheproject 11429#, object-pascal-format 11430msgid "%s is already part of the Project." 11431msgstr "%s zaten Projenin bir parçası." 11432 11433#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject 11434#, object-pascal-format 11435msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" 11436msgstr "\"%s\" geçersiz bir proje adı %sLütfen başka birini seçin (ör. Project1.lpi)" 11437 11438#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed 11439#, object-pascal-format 11440msgid "%s is a %s.%sThis circular dependency is not allowed." 11441msgstr "%s bir %s.%sBu döngüsel bağımlılığa izin verilmedi." 11442 11443#: lazarusidestrconsts.lisisddirectorynotfound 11444msgid "directory not found" 11445msgstr "dizin bulunamadı" 11446 11447#: lazarusidestrconsts.lisissues 11448msgid "Issues" 11449msgstr "Sorunlar" 11450 11451#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe 11452#, object-pascal-format 11453msgid "I wonder how you did that. Error in the %s:" 11454msgstr "Bunu nasıl yaptığını merak ediyorum, %s hatası:" 11455 11456#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory 11457msgid "I wonder how you did that: Error in the base directory:" 11458msgstr "Bunu nasıl yaptığını merak ediyorum: Temel dizindeki hata:" 11459 11460#: lazarusidestrconsts.lisjhjumphistory 11461msgctxt "lazarusidestrconsts.lisjhjumphistory" 11462msgid "Jump History" 11463msgstr "Geçmişe atla" 11464 11465#: lazarusidestrconsts.lisjumptoerror 11466msgid "Jump to error" 11467msgstr "Hataya atla" 11468 11469#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion 11470msgid "When an error in the sources is found at identifier completion, jump to it." 11471msgstr "Kaynaktaki bir hata tanımlayıcı tamamlandıktan sonra bulunursa atla." 11472 11473#: lazarusidestrconsts.lisjumptoprocedure 11474#, object-pascal-format 11475msgid "Jump to procedure %s" 11476msgstr "%s prosedüre atla" 11477 11478#: lazarusidestrconsts.liskb 11479#, object-pascal-format 11480msgid "%s KB" 11481msgstr "%s KB" 11482 11483#: lazarusidestrconsts.liskeep2 11484msgid "Keep" 11485msgstr "Tut" 11486 11487#: lazarusidestrconsts.liskeepfileopen 11488msgid "Keep converted files open in editor" 11489msgstr "Dönüştürülen dosyaları düzenleyicide açık tut" 11490 11491#: lazarusidestrconsts.liskeepfileopenhint 11492msgid "All project files will be open in editor after conversion" 11493msgstr "Tüm proje dosyaları dönüştürmeden sonra editörde açılacaktır" 11494 11495#: lazarusidestrconsts.liskeepininstalllist 11496msgid "Keep in install list" 11497msgstr "Kurulum listesinde sakla" 11498 11499#: lazarusidestrconsts.liskeepname 11500msgid "Keep name" 11501msgstr "Adı sakla" 11502 11503#: lazarusidestrconsts.liskeepopen 11504msgid "Keep open" 11505msgstr "Açık tut" 11506 11507#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate 11508msgid "Keep relative indentation of multi line template" 11509msgstr "Çok satırlı şablonun göreli girintisini koru" 11510 11511#: lazarusidestrconsts.liskeepsubindentation 11512msgid "Keep indentation" 11513msgstr "Girintiyi tut" 11514 11515#: lazarusidestrconsts.liskeepthemandcontinue 11516msgid "Keep them and continue" 11517msgstr "Onları sakla ve devam et" 11518 11519#: lazarusidestrconsts.liskey 11520msgctxt "lazarusidestrconsts.liskey" 11521msgid "Key" 11522msgstr "Tuş" 11523 11524#: lazarusidestrconsts.liskeycatcustom 11525msgid "Custom commands" 11526msgstr "Özel komutlar" 11527 11528#: lazarusidestrconsts.liskeycatdesigner 11529msgid "Designer commands" 11530msgstr "Tasarımcı komutları" 11531 11532#: lazarusidestrconsts.liskeycatobjinspector 11533msgid "Object Inspector commands" 11534msgstr "Nesne Denetleyici komutları" 11535 11536#: lazarusidestrconsts.liskeyor2keysequence 11537msgid "Key (or 2 key sequence)" 11538msgstr "Tuş (veya 2 tuş dizisi)" 11539 11540#: lazarusidestrconsts.liskmabortbuilding 11541msgid "Abort building" 11542msgstr "İnşaattan vazgeç" 11543 11544#: lazarusidestrconsts.liskmaddbpaddress 11545msgid "Add Address Breakpoint" 11546msgstr "Adres Kesme Noktası Ekle" 11547 11548#: lazarusidestrconsts.liskmaddbpsource 11549msgid "Add Source Breakpoint" 11550msgstr "Kaynak kesme noktası ekle" 11551 11552#: lazarusidestrconsts.liskmaddbpwatchpoint 11553msgid "Add Data/WatchPoint" 11554msgstr "Veri/İzleme Noktası Ekle" 11555 11556#: lazarusidestrconsts.liskmaddwatch 11557msgctxt "lazarusidestrconsts.liskmaddwatch" 11558msgid "Add watch" 11559msgstr "İzleme ekle" 11560 11561#: lazarusidestrconsts.liskmbuildmanymodes 11562msgid "Build many modes" 11563msgstr "Birçok modda oluştur" 11564 11565#: lazarusidestrconsts.liskmbuildprojectprogram 11566msgid "Build project/program" 11567msgstr "Proje/program oluştur" 11568 11569#: lazarusidestrconsts.liskmchoosekeymappingscheme 11570msgid "Choose Keymapping scheme" 11571msgstr "Tuş haritası şemasını seçin" 11572 11573#: lazarusidestrconsts.liskmclassic 11574msgid "Classic" 11575msgstr "Klasik" 11576 11577#: lazarusidestrconsts.liskmcleanupandbuild 11578msgctxt "lazarusidestrconsts.liskmcleanupandbuild" 11579msgid "Clean up and build" 11580msgstr "Temizle ve derle" 11581 11582#: lazarusidestrconsts.liskmcloseproject 11583msgid "Close project" 11584msgstr "Projeyi kapat" 11585 11586#: lazarusidestrconsts.liskmcodetoolsdefineseditor 11587msgid "CodeTools defines editor" 11588msgstr "CodeTools editörü tanımları" 11589 11590#: lazarusidestrconsts.liskmcompileprojectprogram 11591msgid "Compile project/program" 11592msgstr "Proje/program derle" 11593 11594#: lazarusidestrconsts.liskmconfigbuildfile 11595msgid "Config \"Build File\"" 11596msgstr "\"Dosya derleme\" Yapılandırması" 11597 11598#: lazarusidestrconsts.liskmconfigurecustomcomponents 11599msgid "Configure Custom Components" 11600msgstr "Özel Bileşenleri Yapılandırma" 11601 11602#: lazarusidestrconsts.liskmcontextsensitivehelp 11603msgid "Context sensitive help" 11604msgstr "Bağlama duyarlı yardım" 11605 11606#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage 11607msgid "Convert Delphi package to Lazarus package" 11608msgstr "Delphi paketini Lazarus paketine dönüştürme" 11609 11610#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject 11611msgid "Convert Delphi Project to Lazarus Project" 11612msgstr "Delphi Projesini Lazarus Projesine Dönüştürme" 11613 11614#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit 11615msgid "Convert Delphi Unit to Lazarus Unit" 11616msgstr "Delphi Birimini Lazarus Birimine Dönüştür" 11617 11618#: lazarusidestrconsts.liskmconvertdfmfiletolfm 11619msgid "Convert DFM File to LFM" 11620msgstr "DFM Dosyasını LFM'ye Dönüştür" 11621 11622#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard 11623msgid "Copy selected components" 11624msgstr "Seçili Bileşenleri panoya kopyala" 11625 11626#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard 11627msgid "Cut selected components" 11628msgstr "Seçili Bileşenleri panoya kopyala" 11629 11630#: lazarusidestrconsts.liskmdefaulttoosx 11631msgid "Default adapted to macOS" 11632msgstr "MacOS'a uyarlanmış varsayılan" 11633 11634#: lazarusidestrconsts.liskmdeletelastchar 11635msgid "Delete last char" 11636msgstr "Son harfi sil" 11637 11638#: lazarusidestrconsts.liskmdiffeditorfiles 11639msgid "Diff Editor Files" 11640msgstr "Diff Editör Dosyaları" 11641 11642#: lazarusidestrconsts.liskmeditcodetemplates 11643msgid "Edit Code Templates" 11644msgstr "Kod Şablonlarını Düzenle" 11645 11646#: lazarusidestrconsts.liskmeditcontextsensitivehelp 11647msgid "Edit context sensitive help" 11648msgstr "Bağlama duyarlı yardımını düzenle" 11649 11650#: lazarusidestrconsts.liskmencloseselection 11651msgid "Enclose Selection" 11652msgstr "Seçimi Dahil Et" 11653 11654#: lazarusidestrconsts.liskmevaluatemodify 11655msgid "Evaluate/Modify" 11656msgstr "Değiştir / değerlendirin" 11657 11658#: lazarusidestrconsts.liskmexampleprojects 11659msgid "Example Projects" 11660msgstr "Örnek Projeler" 11661 11662#: lazarusidestrconsts.liskmexternaltoolssettings 11663msgid "External Tools settings" 11664msgstr "Harici Araçlar ayarları" 11665 11666#: lazarusidestrconsts.liskmfindincremental 11667msgid "Find Incremental" 11668msgstr "Artımlı Bul" 11669 11670#: lazarusidestrconsts.liskmgotomarker0 11671msgid "Go to bookmark 0" 11672msgstr "0 işaretine git" 11673 11674#: lazarusidestrconsts.liskmgotomarker1 11675msgid "Go to bookmark 1" 11676msgstr "İşaretleyiciye git 1" 11677 11678#: lazarusidestrconsts.liskmgotomarker2 11679msgid "Go to bookmark 2" 11680msgstr "2. işaretçiye git" 11681 11682#: lazarusidestrconsts.liskmgotomarker3 11683msgid "Go to bookmark 3" 11684msgstr "3. işaretçiye git" 11685 11686#: lazarusidestrconsts.liskmgotomarker4 11687msgid "Go to bookmark 4" 11688msgstr "4 numaralı işaretçiye git" 11689 11690#: lazarusidestrconsts.liskmgotomarker5 11691msgid "Go to bookmark 5" 11692msgstr "İşaretleyiciye git 5" 11693 11694#: lazarusidestrconsts.liskmgotomarker6 11695msgid "Go to bookmark 6" 11696msgstr "İşaretleyiciye git 6" 11697 11698#: lazarusidestrconsts.liskmgotomarker7 11699msgid "Go to bookmark 7" 11700msgstr "İşaretçiye git 7" 11701 11702#: lazarusidestrconsts.liskmgotomarker8 11703msgid "Go to bookmark 8" 11704msgstr "İşaretleyiciye git 8" 11705 11706#: lazarusidestrconsts.liskmgotomarker9 11707msgid "Go to bookmark 9" 11708msgstr "İşaretleyiciye git 9" 11709 11710#: lazarusidestrconsts.liskmgotosourceeditor1 11711msgid "Go to source editor 1" 11712msgstr "Kaynak editöre git 1" 11713 11714#: lazarusidestrconsts.liskmgotosourceeditor10 11715msgid "Go to source editor 10" 11716msgstr "Kaynak editöre git 10" 11717 11718#: lazarusidestrconsts.liskmgotosourceeditor2 11719msgid "Go to source editor 2" 11720msgstr "Kaynak editörüne git 2" 11721 11722#: lazarusidestrconsts.liskmgotosourceeditor3 11723msgid "Go to source editor 3" 11724msgstr "Kaynak editöre git 3" 11725 11726#: lazarusidestrconsts.liskmgotosourceeditor4 11727msgid "Go to source editor 4" 11728msgstr "Kaynak editörüne git 4" 11729 11730#: lazarusidestrconsts.liskmgotosourceeditor5 11731msgid "Go to source editor 5" 11732msgstr "Kaynak editöre git 5" 11733 11734#: lazarusidestrconsts.liskmgotosourceeditor6 11735msgid "Go to source editor 6" 11736msgstr "Kaynak editöre git 6" 11737 11738#: lazarusidestrconsts.liskmgotosourceeditor7 11739msgid "Go to source editor 7" 11740msgstr "Kaynak editöre git 7" 11741 11742#: lazarusidestrconsts.liskmgotosourceeditor8 11743msgid "Go to source editor 8" 11744msgstr "Kaynak editöre git 8" 11745 11746#: lazarusidestrconsts.liskmgotosourceeditor9 11747msgid "Go to source editor 9" 11748msgstr "Kaynak editöre git 9" 11749 11750#: lazarusidestrconsts.liskminsertdateandtime 11751msgid "Insert date and time" 11752msgstr "Tarih ve saat ekle" 11753 11754#: lazarusidestrconsts.liskminsertusername 11755msgid "Insert username" 11756msgstr "Kullanıcı adını ekle" 11757 11758#: lazarusidestrconsts.liskminspect 11759msgid "Inspect" 11760msgstr "Denetle" 11761 11762#: lazarusidestrconsts.liskmkeymappingscheme 11763msgid "Keymapping Scheme" 11764msgstr "Tuş Haritası Şeması" 11765 11766#: lazarusidestrconsts.liskmlazarusdefault 11767msgid "Lazarus default" 11768msgstr "Lazarus (varsayılan)" 11769 11770#: lazarusidestrconsts.liskmmacosxapple 11771msgid "macOS, Apple style" 11772msgstr "mac OS X (Apple stili)" 11773 11774#: lazarusidestrconsts.liskmmacosxlaz 11775msgid "macOS, Lazarus style" 11776msgstr "mac OS X (Lazarus tarzı)" 11777 11778#: lazarusidestrconsts.liskmnewpackage 11779msgid "New package" 11780msgstr "Yeni paket" 11781 11782#: lazarusidestrconsts.liskmnewproject 11783msgid "New project" 11784msgstr "Yeni proje" 11785 11786#: lazarusidestrconsts.liskmnewprojectfromfile 11787msgid "New project from file" 11788msgstr "Dosyadan yeni proje" 11789 11790#: lazarusidestrconsts.liskmnewunit 11791msgctxt "lazarusidestrconsts.liskmnewunit" 11792msgid "New Unit" 11793msgstr "Yeni Birim" 11794 11795#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme 11796msgid "Note: All keys will be set to the values of the chosen scheme." 11797msgstr "Not: Tüm tuşlar, seçilen şema değerlerine ayarlanacaktır." 11798 11799#: lazarusidestrconsts.liskmopenpackagefile 11800msgid "Open package file" 11801msgstr "Paket dosyası aç" 11802 11803#: lazarusidestrconsts.liskmopenrecent 11804msgctxt "lazarusidestrconsts.liskmopenrecent" 11805msgid "Open Recent" 11806msgstr "Son Açılanlar" 11807 11808#: lazarusidestrconsts.liskmopenrecentpackage 11809msgid "Open recent package" 11810msgstr "Son açılan paket" 11811 11812#: lazarusidestrconsts.liskmopenrecentproject 11813msgid "Open recent project" 11814msgstr "Son açılan proje" 11815 11816#: lazarusidestrconsts.liskmpastecomponentsfromclipboard 11817msgid "Paste Components" 11818msgstr "Bileşenleri panodan yapıştır" 11819 11820#: lazarusidestrconsts.liskmpauseprogram 11821msgid "Pause program" 11822msgstr "Programı duraklat" 11823 11824#: lazarusidestrconsts.liskmpublishproject 11825msgid "Publish project" 11826msgstr "Projeyi yayınla" 11827 11828#: lazarusidestrconsts.liskmquickcompilenolinking 11829msgid "Quick compile, no linking" 11830msgstr "Hızlı derleme, bağlama yok" 11831 11832#: lazarusidestrconsts.liskmremoveactivefilefromproject 11833msgid "Remove Active File from Project" 11834msgstr "Aktif Dosyayı Projeden Kaldır" 11835 11836#: lazarusidestrconsts.liskmrunprogram 11837msgid "Run program" 11838msgstr "Programı çalıştır" 11839 11840#: lazarusidestrconsts.liskmsaveall 11841msgid "SaveAll" 11842msgstr "Hepsini kaydet" 11843 11844#: lazarusidestrconsts.liskmsaveas 11845msgid "SaveAs" 11846msgstr "Farklı kaydet" 11847 11848#: lazarusidestrconsts.liskmsaveproject 11849msgid "Save project" 11850msgstr "Projeyi kaydet" 11851 11852#: lazarusidestrconsts.liskmsaveprojectas 11853msgid "Save project as" 11854msgstr "Projeyi farklı kaydet" 11855 11856#: lazarusidestrconsts.liskmselectlineend 11857msgctxt "lazarusidestrconsts.liskmselectlineend" 11858msgid "Select Line End" 11859msgstr "Satır Sonunu Seçin" 11860 11861#: lazarusidestrconsts.liskmselectlinestart 11862msgctxt "lazarusidestrconsts.liskmselectlinestart" 11863msgid "Select Line Start" 11864msgstr "Satır Başlamasını Seç" 11865 11866#: lazarusidestrconsts.liskmselectpagebottom 11867msgctxt "lazarusidestrconsts.liskmselectpagebottom" 11868msgid "Select Page Bottom" 11869msgstr "Sayfa Altını Seç" 11870 11871#: lazarusidestrconsts.liskmselectpagetop 11872msgctxt "lazarusidestrconsts.liskmselectpagetop" 11873msgid "Select Page Top" 11874msgstr "Sayfa Üstünü Seç" 11875 11876#: lazarusidestrconsts.liskmselectwordleft 11877msgctxt "lazarusidestrconsts.liskmselectwordleft" 11878msgid "Select Word Left" 11879msgstr "Soldan Sözcük Seçin" 11880 11881#: lazarusidestrconsts.liskmselectwordright 11882msgctxt "lazarusidestrconsts.liskmselectwordright" 11883msgid "Select Word Right" 11884msgstr "Sağdan Sözcük Seçin" 11885 11886#: lazarusidestrconsts.liskmsetfreebookmark 11887msgid "Set free Bookmark" 11888msgstr "Serbest yer imi ayarla" 11889 11890#: lazarusidestrconsts.liskmsetmarker0 11891msgid "Set bookmark 0" 11892msgstr "Yer imini ayarla 0" 11893 11894#: lazarusidestrconsts.liskmsetmarker1 11895msgid "Set bookmark 1" 11896msgstr "Yer imini ayarla 1" 11897 11898#: lazarusidestrconsts.liskmsetmarker2 11899msgid "Set bookmark 2" 11900msgstr "Yer imini ayarla 2" 11901 11902#: lazarusidestrconsts.liskmsetmarker3 11903msgid "Set bookmark 3" 11904msgstr "Yer imini ayarla 3" 11905 11906#: lazarusidestrconsts.liskmsetmarker4 11907msgid "Set bookmark 4" 11908msgstr "Yer imini ayarla 4" 11909 11910#: lazarusidestrconsts.liskmsetmarker5 11911msgid "Set bookmark 5" 11912msgstr "Yer imini ayarla 5" 11913 11914#: lazarusidestrconsts.liskmsetmarker6 11915msgid "Set bookmark 6" 11916msgstr "Yer imini ayarla 6" 11917 11918#: lazarusidestrconsts.liskmsetmarker7 11919msgid "Set bookmark 7" 11920msgstr "Yer imini ayarla 7" 11921 11922#: lazarusidestrconsts.liskmsetmarker8 11923msgid "Set bookmark 8" 11924msgstr "Yer imini ayarla 8" 11925 11926#: lazarusidestrconsts.liskmsetmarker9 11927msgid "Set bookmark 9" 11928msgstr "Yer imini ayarla 9" 11929 11930#: lazarusidestrconsts.liskmstopprogram 11931msgid "Stop Program" 11932msgstr "Programı Durdur" 11933 11934#: lazarusidestrconsts.liskmtogglebetweenunitandform 11935msgid "Toggle between Unit and Form" 11936msgstr "Birim ve Form arasında geçiş yap" 11937 11938#: lazarusidestrconsts.liskmtogglemarker0 11939msgid "Toggle bookmark 0" 11940msgstr "Yer imini değiştir 0" 11941 11942#: lazarusidestrconsts.liskmtogglemarker1 11943msgid "Toggle bookmark 1" 11944msgstr "Yer imini değiştir 1" 11945 11946#: lazarusidestrconsts.liskmtogglemarker2 11947msgid "Toggle bookmark 2" 11948msgstr "Yer imini değiştir 2" 11949 11950#: lazarusidestrconsts.liskmtogglemarker3 11951msgid "Toggle bookmark 3" 11952msgstr "Yer imini değiştir 3" 11953 11954#: lazarusidestrconsts.liskmtogglemarker4 11955msgid "Toggle bookmark 4" 11956msgstr "Yer imini değiştir 4" 11957 11958#: lazarusidestrconsts.liskmtogglemarker5 11959msgid "Toggle bookmark 5" 11960msgstr "Yer imini değiştir 5" 11961 11962#: lazarusidestrconsts.liskmtogglemarker6 11963msgid "Toggle bookmark 6" 11964msgstr "Yer imini değiştir 6" 11965 11966#: lazarusidestrconsts.liskmtogglemarker7 11967msgid "Toggle bookmark 7" 11968msgstr "Yer imini değiştir 7" 11969 11970#: lazarusidestrconsts.liskmtogglemarker8 11971msgid "Toggle bookmark 8" 11972msgstr "Yer imini değiştir 8" 11973 11974#: lazarusidestrconsts.liskmtogglemarker9 11975msgid "Toggle bookmark 9" 11976msgstr "Yer imini değiştir 9" 11977 11978#: lazarusidestrconsts.liskmtoggleviewassembler 11979msgctxt "lazarusidestrconsts.liskmtoggleviewassembler" 11980msgid "View Assembler" 11981msgstr "Assembler Görüntüle" 11982 11983#: lazarusidestrconsts.liskmtoggleviewbreakpoints 11984msgid "View Breakpoints" 11985msgstr "Kesme noktalarını görüntüle" 11986 11987#: lazarusidestrconsts.liskmtoggleviewcallstack 11988msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack" 11989msgid "View Call Stack" 11990msgstr "Çağrı Yığını Göster" 11991 11992#: lazarusidestrconsts.liskmtoggleviewcodebrowser 11993msgid "Toggle view Code Browser" 11994msgstr "Kod Tarayıcısı görünümü Aç/Kapat" 11995 11996#: lazarusidestrconsts.liskmtoggleviewcodeexplorer 11997msgid "Toggle view Code Explorer" 11998msgstr "Kod Gezgini görünümünü Aç/Kapat" 11999 12000#: lazarusidestrconsts.liskmtoggleviewcomponentpalette 12001msgid "Toggle View Component Palette" 12002msgstr "Bileşen Paleti görünümü Aç/Kapat" 12003 12004#: lazarusidestrconsts.liskmtoggleviewdebugevents 12005msgid "View Debuger Event Log" 12006msgstr "Hata Ayıklama Olay Günlüğünü Göster" 12007 12008#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput 12009msgid "View Debugger Output" 12010msgstr "Hata Ayıklayıcı Çıktısı görüntüle" 12011 12012#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor 12013msgid "Toggle view Documentation Editor" 12014msgstr "Belge Düzenleyicisi görünümüne geçiş yap" 12015 12016#: lazarusidestrconsts.liskmtoggleviewhistory 12017msgctxt "lazarusidestrconsts.liskmtoggleviewhistory" 12018msgid "View History" 12019msgstr "Geçmişi Görüntüle" 12020 12021#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons 12022msgid "Toggle view IDE speed buttons" 12023msgstr "IDE hızlı düğmeleri görünümü Aç/Kapat" 12024 12025#: lazarusidestrconsts.liskmtoggleviewlocalvariables 12026msgid "View Local Variables" 12027msgstr "Yerel Değişkenleri Görüntüle" 12028 12029#: lazarusidestrconsts.liskmtoggleviewmessages 12030msgid "Toggle view Messages" 12031msgstr "Mesajlar gösterimini Aç/Kapat" 12032 12033#: lazarusidestrconsts.liskmtoggleviewobjectinspector 12034msgid "Toggle view Object Inspector" 12035msgstr "Nesnesi denetçisi gösterimi Aç/Kapat" 12036 12037#: lazarusidestrconsts.liskmtoggleviewpseudoterminal 12038msgid "View Console In/Output" 12039msgstr "Terminal Çıkışını Görüntüle" 12040 12041#: lazarusidestrconsts.liskmtoggleviewregisters 12042msgid "View Registers" 12043msgstr "Kayıtları Görüntüle" 12044 12045#: lazarusidestrconsts.liskmtoggleviewsearchresults 12046msgid "Toggle view Search Results" 12047msgstr "Arama Sonuçları görünümü Aç/Kapat" 12048 12049#: lazarusidestrconsts.liskmtoggleviewsourceeditor 12050msgid "Toggle view Source Editor" 12051msgstr "Kaynak Düzenleyicisi görünümü Aç/Kapat" 12052 12053#: lazarusidestrconsts.liskmtoggleviewthreads 12054msgctxt "lazarusidestrconsts.liskmtoggleviewthreads" 12055msgid "View Threads" 12056msgstr "Konuları Görüntüle" 12057 12058#: lazarusidestrconsts.liskmtoggleviewwatches 12059msgid "View Watches" 12060msgstr "Saatleri Görüntüle" 12061 12062#: lazarusidestrconsts.liskmviewjumphistory 12063msgid "View jump history" 12064msgstr "Atlama geçmişini görüntüle" 12065 12066#: lazarusidestrconsts.liskmviewprojectoptions 12067msgid "View project options" 12068msgstr "Proje seçeneklerini görüntüleme" 12069 12070#: lazarusidestrconsts.liskmviewprojectsource 12071msgid "View Project Source" 12072msgstr "Proje Kaynağını Görüntüle" 12073 12074#: lazarusidestrconsts.liskmviewunitinfo 12075msgid "View Unit Info" 12076msgstr "Birim Bilgisini Görüntüle" 12077 12078#: lazarusidestrconsts.lislastopened 12079msgid "Last opened" 12080msgstr "Son açılan" 12081 12082#: lazarusidestrconsts.lislaunchingapplicationinvalid 12083msgid "Launching application invalid" 12084msgstr "Başlatma uygulaması geçersiz" 12085 12086#: lazarusidestrconsts.lislaunchingcmdline 12087msgid "Launching target command line" 12088msgstr "Hedef komut satırı başlatılıyor" 12089 12090#: lazarusidestrconsts.lislazarus 12091msgid "Lazarus" 12092msgstr "Lazarus" 12093 12094#: lazarusidestrconsts.lislazarusdefault 12095msgid "Lazarus Default" 12096msgstr "Lazarus Varsayılan" 12097 12098#: lazarusidestrconsts.lislazarusdirectory 12099msgid "Lazarus directory" 12100msgstr "Lazarus dizini" 12101 12102#: lazarusidestrconsts.lislazarusdiroverride 12103msgid "directory to be used as a basedirectory" 12104msgstr "dizin, bir alt dizin olarak kullanılacak" 12105 12106#: lazarusidestrconsts.lislazaruseditorv 12107#, object-pascal-format 12108msgid "Lazarus IDE v%s" 12109msgstr "Lazarus IDE v%s" 12110 12111#: lazarusidestrconsts.lislazaruside 12112msgid "Lazarus IDE" 12113msgstr "Lazarus IDE" 12114 12115#: lazarusidestrconsts.lislazaruslanguageid 12116msgid "Lazarus language ID (e.g. en, de, br, fi)" 12117msgstr "Lazarus dil kimliği (ör. En, de, tr, fi)" 12118 12119#: lazarusidestrconsts.lislazaruslanguagename 12120msgid "Lazarus language name (e.g. english, deutsch)" 12121msgstr "Lazarus dil adı (ör. Ingilizce, türkçe)" 12122 12123#: lazarusidestrconsts.lislazarusoptionsprojectfilename 12124msgid "lazarus [options] <project-filename>" 12125msgstr "lazarus [seçenekler] <proje-dosya adı>" 12126 12127#: lazarusidestrconsts.lislazbuildaboaction 12128msgctxt "lazarusidestrconsts.lislazbuildaboaction" 12129msgid "Action" 12130msgstr "Aksiyon" 12131 12132#: lazarusidestrconsts.lislazbuildabochooseoutputdir 12133msgid "Choose output directory of the IDE executable " 12134msgstr "Çalıştırılabilir IDE çıktı dizinini seçin " 12135 12136#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile 12137msgid "Are you sure you want to delete this build profile?" 12138msgstr "Bu yapı profilini silmek istediğinizden emin misiniz?" 12139 12140#: lazarusidestrconsts.lislazbuildbuildmany 12141msgid "Build Many" 12142msgstr "Birçok inşa" 12143 12144#: lazarusidestrconsts.lislazbuildcommonsettings 12145msgid "Common Settings" 12146msgstr "Ortak Ayarlar" 12147 12148#: lazarusidestrconsts.lislazbuildconfirmbuild 12149msgid "Confirm before build" 12150msgstr "İnşaa öncesi onaylayın" 12151 12152#: lazarusidestrconsts.lislazbuildconfirmdeletion 12153msgid "Confirm deletion" 12154msgstr "Silmeyi onayla" 12155 12156#: lazarusidestrconsts.lislazbuilddebugide 12157msgid "Debug IDE" 12158msgstr "IDE hata ayıklama" 12159 12160#: lazarusidestrconsts.lislazbuilddefines 12161msgid "Defines" 12162msgstr "Tanımlar" 12163 12164#: lazarusidestrconsts.lislazbuilddefineswithoutd 12165msgid "Defines without -d" 12166msgstr "-d olmadan tanımlar" 12167 12168#: lazarusidestrconsts.lislazbuildeditdefines 12169msgid "Edit Defines" 12170msgstr "Tanımları Düzenle" 12171 12172#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile 12173msgid "Edit list of defines which can be used by any profile" 12174msgstr "Herhangi bir profil tarafından kullanılabilecek tanımların listesini düzenleyin" 12175 12176#: lazarusidestrconsts.lislazbuilderrorwritingfile 12177msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" 12178msgid "Error writing file" 12179msgstr "Dosya yazarken hata oluştu" 12180 12181#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow 12182#, object-pascal-format 12183msgid "%s%s%s%slazbuild is non interactive, aborting now." 12184msgstr "%s %s %s %slazbuild etkileşimli değil, şimdi iptal ediliyor." 12185 12186#: lazarusidestrconsts.lislazbuildmanageprofiles 12187msgid "Manage Build Profiles" 12188msgstr "Yapı Profillerini Yönet" 12189 12190#: lazarusidestrconsts.lislazbuildmanageprofiles2 12191msgid "Manage profiles" 12192msgstr "Profilleri yönet" 12193 12194#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile 12195msgid "Name of the active profile" 12196msgstr "Etkin profilin adı" 12197 12198#: lazarusidestrconsts.lislazbuildnewprof 12199msgid "Add New Profile" 12200msgstr "Yeni Profil Ekle" 12201 12202#: lazarusidestrconsts.lislazbuildnewprofinfo 12203msgid "Current build options will be associated with:" 12204msgstr "Mevcut yapı seçenekleri ile ilişkili:" 12205 12206#: lazarusidestrconsts.lislazbuildnormalide 12207msgid "Normal IDE" 12208msgstr "Normal IDE" 12209 12210#: lazarusidestrconsts.lislazbuildoptimizedide 12211msgid "Optimized IDE" 12212msgstr "Optimize IDE" 12213 12214#: lazarusidestrconsts.lislazbuildoptions 12215msgid "Options:" 12216msgstr "Seçenekler:" 12217 12218#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler 12219msgid "Options passed to compiler" 12220msgstr "Seçenekler derleyiciye geçti" 12221 12222#: lazarusidestrconsts.lislazbuildprofile 12223msgid "Profile to build" 12224msgstr "Profile göre derle" 12225 12226#: lazarusidestrconsts.lislazbuildrenameprof 12227msgid "Rename Profile" 12228msgstr "Profili Yeniden Adlandır" 12229 12230#: lazarusidestrconsts.lislazbuildrenameprofinfo 12231msgid "New name for profile:" 12232msgstr "Profilin yeni adı:" 12233 12234#: lazarusidestrconsts.lislazbuildrestartafterbuild 12235msgid "Restart after building IDE" 12236msgstr "IDE kurduktan sonra yeniden başlatın" 12237 12238#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically 12239msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" 12240msgstr "IDE'yi oluşturduktan sonra Lazarus'u otomatik olarak yeniden başlatın (diğer parçaları oluştururken hiçbir etkisi yoktur)" 12241 12242#: lazarusidestrconsts.lislazbuildselectprofilestobuild 12243msgid "Select profiles to build" 12244msgstr "Oluşturulacak profilleri seçin" 12245 12246#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding 12247msgid "Show confirmation dialog when building directly from Tools menu" 12248msgstr "Doğrudan Araçlar menüsünden oluştururken onay iletişim kutusunu göster" 12249 12250#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline 12251msgid "Show options and defines for command line" 12252msgstr "Komut satırı için seçenekleri ve tanımları göster" 12253 12254#: lazarusidestrconsts.lislazbuildtargetcpu 12255msgid "Target CPU:" 12256msgstr "Hedef CPU:" 12257 12258#: lazarusidestrconsts.lislazbuildtargetdirectory 12259msgid "Target directory:" 12260msgstr "Hedef klasör:" 12261 12262#: lazarusidestrconsts.lislazbuildtargetos 12263msgid "Target OS:" 12264msgstr "Hedeflenen İşletim Sistemi:" 12265 12266#: lazarusidestrconsts.lislazbuildunabletowritefile 12267#, object-pascal-format 12268msgid "Unable to write file \"%s\":%s" 12269msgstr "Dosya \"%s\" yazamadı: %s" 12270 12271#: lazarusidestrconsts.lislazbuildupdaterevinc 12272msgid "Update revision.inc" 12273msgstr "Güncelleme revizyon.inc" 12274 12275#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog 12276msgid "Update revision info in \"About Lazarus\" dialog" 12277msgstr "\"Lazarus Hakkında\" iletişim kutusundaki düzeltme bilgisini güncelle" 12278 12279#: lazarusidestrconsts.lislazcleanupbuildall 12280msgid "Clean Up + Build all" 12281msgstr "Temizle + Hepsini kur" 12282 12283#: lazarusidestrconsts.lislazver 12284msgid "Lazarus Version (e.g. 1.2.4)" 12285msgstr "Lazarus Sürümü (ör. 1.2.4)" 12286 12287#: lazarusidestrconsts.lislclwidgettype 12288msgid "LCL widget type" 12289msgstr "LCL widget türü" 12290 12291#: lazarusidestrconsts.lisldaddlinktoinherited 12292msgid "Add link to inherited" 12293msgstr "Devralınan bağlantı ekle" 12294 12295#: lazarusidestrconsts.lisldcopyfrominherited 12296msgid "Copy from inherited" 12297msgstr "Devralınandan kopyala" 12298 12299#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo 12300#, object-pascal-format 12301msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s" 12302msgstr "%s geçerli bir FPDoc yolu yok.%s %s için fpdoc dosyası oluşturmaktan vazgeç" 12303 12304#: lazarusidestrconsts.lisldmoveentriestoinherited 12305msgid "Move entries to inherited" 12306msgstr "Taşınır girişleri devralınan" 12307 12308#: lazarusidestrconsts.lisldnovalidfpdocpath 12309msgid "No valid FPDoc path" 12310msgstr "Geçerli FPDoc yolu yok" 12311 12312#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe 12313#, object-pascal-format 12314msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." 12315msgstr "%s birimi herhangi bir paket veya proje değil.%sLütfen birimi bir pakete veya projeye ekleyin.%s fpdoc dosyası oluşturulamadı." 12316 12317#: lazarusidestrconsts.lisleft 12318msgctxt "lazarusidestrconsts.lisleft" 12319msgid "Left" 12320msgstr "Sol" 12321 12322#: lazarusidestrconsts.lisleftborderspacespinedithint 12323msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." 12324msgstr "Sol kenarlık: Bu değer taban sınırlarına eklenir ve devam için sola boşluk kullanılır." 12325 12326#: lazarusidestrconsts.lisleftgroupboxcaption 12327msgid "Left anchoring" 12328msgstr "Sol çapa" 12329 12330#: lazarusidestrconsts.lisleftsiblingcomboboxhint 12331msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 12332msgstr "Bu, sol tarafın tutturulduğu kardeş kontrolüdür. Ankraj için Delphi stilinde tutturma için boş bırakın (BorderSpacing ve ReferenceSide önemli değil)." 12333 12334#: lazarusidestrconsts.lisleftsides 12335msgid "Left sides" 12336msgstr "Sol taraf" 12337 12338#: lazarusidestrconsts.lisleftspaceequally 12339msgid "Left space equally" 12340msgstr "Sol boşluk eşit" 12341 12342#: lazarusidestrconsts.lisless 12343msgid "Less" 12344msgstr "Az" 12345 12346#: lazarusidestrconsts.lislevels 12347msgctxt "lazarusidestrconsts.lislevels" 12348msgid "Levels" 12349msgstr "Seviyeler" 12350 12351#: lazarusidestrconsts.lislfmfile 12352msgid "LFM file" 12353msgstr "LFM dosyası" 12354 12355#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties 12356msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." 12357msgstr "LFM dosyası, LCL'de bulunmayan bilinmeyen özellikler / sınıflar içeriyor. Değiştirilebilir veya çıkarılabilirler." 12358 12359#: lazarusidestrconsts.lislfmfilecorrupt 12360msgid "LFM file corrupt" 12361msgstr "LFM dosyası bozuk" 12362 12363#: lazarusidestrconsts.lislfmisok 12364msgid "LFM is ok" 12365msgstr "LFM tamam" 12366 12367#: lazarusidestrconsts.lislgplnotice 12368msgid "" 12369"<description>\n" 12370"\n" 12371"Copyright (C) <year> <name of author> <contact>\n" 12372"\n" 12373"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 12374"\n" 12375"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 12376"\n" 12377"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 12378msgstr "" 12379"<Açıklama>\n" 12380"\n" 12381"Telif Hakkı (C) <yıl> <yazarın adı> <contact>\n" 12382"\n" 12383"Bu kütüphane ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Kütüphanesi Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; Lisansın 2. sürümü veya (isteğe bağlı olarak) daha sonraki bir sürüm.\n" 12384"\n" 12385"Bu program faydalı olacağı umuduyla dağıtılmıştır; HİÇBİR AMAÇLI OLMAK İÇİN TİCARİRLİK veya FİTNESS'in zımni garantisi olmadan. Daha fazla bilgi için GNU Kütüphanesi Genel Kamu Lisansına bakınız.\n" 12386"\n" 12387"Bu kütüphaneyle birlikte GNU Kütüphanesi Genel Kamu Lisansının bir kopyasını almış olmalısınız; değilse, Özgür Yazılım Vakfı, Inc., 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazınız." 12388 12389#: lazarusidestrconsts.lislibrarypath 12390msgid "library path" 12391msgstr "kütüphane yolu" 12392 12393#: lazarusidestrconsts.lislibraryprogramdescriptor 12394msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)." 12395msgstr "Ücretsiz bir Pascal paylaşılan kütüphanesi (Windows altında .dll, Linux'ta .so, MacOS X altında .dylib)." 12396 12397#: lazarusidestrconsts.lisline 12398msgid "Line:" 12399msgstr "Satır:" 12400 12401#: lazarusidestrconsts.lislinelength 12402msgid "Line/Length" 12403msgstr "Satır/Uzunluk" 12404 12405#: lazarusidestrconsts.lislink 12406msgid "Link:" 12407msgstr "Bağlantı:" 12408 12409#: lazarusidestrconsts.lislinkeroptions 12410msgid "linker options" 12411msgstr "linker seçenekleri" 12412 12413#: lazarusidestrconsts.lislinktarget 12414msgid "Link target" 12415msgstr "Bağlantı hedefi" 12416 12417#: lazarusidestrconsts.lislistofallcasevalues 12418msgid "list of all case values" 12419msgstr "tüm case değerlerinin listesi" 12420 12421#: lazarusidestrconsts.lisloadingfailed 12422#, object-pascal-format 12423msgid "Loading %s failed." 12424msgstr "%s yüklenemedi." 12425 12426#: lazarusidestrconsts.lisloadmacrofrom 12427msgid "Load macro from" 12428msgstr "Makroyu yükle" 12429 12430#: lazarusidestrconsts.lislocal 12431msgid "&Local" 12432msgstr "&Yerel" 12433 12434#: lazarusidestrconsts.lislocals 12435msgctxt "lazarusidestrconsts.lislocals" 12436msgid "Local Variables" 12437msgstr "Yerel değişkenler" 12438 12439#: lazarusidestrconsts.lislocalsdlgcopyall 12440msgid "Copy &all" 12441msgstr "Tümünü ko&pyala" 12442 12443#: lazarusidestrconsts.lislocalsdlgcopyname 12444msgid "&Copy Name" 12445msgstr "&Adı Kopyala" 12446 12447#: lazarusidestrconsts.lislocalsdlgcopynamevalue 12448msgid "Co&py Name and Value" 12449msgstr "Adı ve değeri &kopyala" 12450 12451#: lazarusidestrconsts.lislocalsdlgcopyrawvalue 12452msgid "Copy &RAW Value" 12453msgstr "&RAW Değerini Kopyala" 12454 12455#: lazarusidestrconsts.lislocalsdlgcopyvalue 12456msgid "C&opy Value" 12457msgstr "Değeri Kop&yala" 12458 12459#: lazarusidestrconsts.lislocalsnotevaluated 12460msgid "Locals not evaluated" 12461msgstr "Yereller değerlendirilmedi" 12462 12463#: lazarusidestrconsts.lislogcallstack 12464msgid "Log Call Stack" 12465msgstr "Günlük Çağrı Yığını" 12466 12467#: lazarusidestrconsts.lislogcallstacklimit 12468msgid "(frames limit. 0 - no limits)" 12469msgstr "(çerçeve sınırı. 0 - sınır yok)" 12470 12471#: lazarusidestrconsts.lislogevalexpression 12472msgctxt "lazarusidestrconsts.lislogevalexpression" 12473msgid "Eval expression" 12474msgstr "Eval ifadesi" 12475 12476#: lazarusidestrconsts.lislogmessage 12477msgid "Log Message" 12478msgstr "Günlük Mesajı" 12479 12480#: lazarusidestrconsts.lislowercasestring 12481msgid "lowercase string" 12482msgstr "küçük harfli string" 12483 12484#: lazarusidestrconsts.lislowercasestringgivenasparameter 12485msgid "Lowercase string given as parameter." 12486msgstr "Parametre olarak verilen küçük harfli string." 12487 12488#: lazarusidestrconsts.lislpicompatibilitymodecheckbox 12489msgid "Maximize compatibility of project files (LPI and LPS)" 12490msgstr "Proje dosyalarının uyumluluğunu en üst düzeye çıkarın (LPI ve LPS)" 12491 12492#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint 12493msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions." 12494msgstr "Projenizi eski (2.0 ve daha eski) Lazarus sürümlerinde açmak istiyorsanız bunu kontrol edin." 12495 12496#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox 12497msgid "Maximize compatibility of package file (LPK)" 12498msgstr "Paket dosyasının (LPK) uyumluluğunu en üst düzeye çıkarın" 12499 12500#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint 12501msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions." 12502msgstr "Projenizi eski (2.0 ve daha eski) Lazarus sürümlerinde açmak istiyorsanız bunu kontrol edin." 12503 12504#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative 12505#, object-pascal-format 12506msgid "lpk has vanished on disk. Using as alternative%s" 12507msgstr "lpk disk üzerinde kayboldu, alternatif olarak kullan %s" 12508 12509#: lazarusidestrconsts.lislpkismissing 12510msgid "lpk is missing" 12511msgstr "lpk eksik" 12512 12513#: lazarusidestrconsts.lislrsincludefiles 12514msgid "Lazarus resources (.lrs) include files" 12515msgstr "Lazarus kaynakları (.lrs)" 12516 12517#: lazarusidestrconsts.lismacpreferences 12518msgid "Preferences..." 12519msgstr "Seçenekler.." 12520 12521#: lazarusidestrconsts.lismacro 12522#, object-pascal-format 12523msgid "Macro %s" 12524msgstr "Makro %s" 12525 12526#: lazarusidestrconsts.lismacropromptenterdata 12527msgid "Enter data" 12528msgstr "Verileri girin" 12529 12530#: lazarusidestrconsts.lismacropromptenterrunparameters 12531msgid "Enter run parameters" 12532msgstr "Çalıştırma parametrelerini girin" 12533 12534#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject 12535msgid "Main unit has Uses section containing all units of project" 12536msgstr "Ana birim, tüm proje birimlerini içeren Uses bölümüne sahiptir" 12537 12538#: lazarusidestrconsts.lismainunitispascalsource 12539msgid "Main unit is Pascal source" 12540msgstr "Ana ünite Pascal kaynağı" 12541 12542#: lazarusidestrconsts.lismainunitispascalsourcehint 12543msgid "Assume Pascal even if it does not end with .pas/.pp suffix." 12544msgstr "Pascal'ı .pas / .pp son ekiyle bitmese bile varsayın." 12545 12546#: lazarusidestrconsts.lismakecurrent 12547msgctxt "lazarusidestrconsts.lismakecurrent" 12548msgid "Current" 12549msgstr "Geçerli" 12550 12551#: lazarusidestrconsts.lismakeexe 12552msgid "Make Executable" 12553msgstr "Yürütülebilir Dosyayı Yap" 12554 12555#: lazarusidestrconsts.lismakenotfound 12556msgid "Make not found" 12557msgstr "Bulunamadı" 12558 12559#: lazarusidestrconsts.lismakeresourcestring 12560msgid "Make ResourceString" 12561msgstr "Make ResourceString" 12562 12563#: lazarusidestrconsts.lismakeresstrappendtosection 12564msgid "Append to section" 12565msgstr "Bölümüne ekle" 12566 12567#: lazarusidestrconsts.lismakeresstrchooseanothername 12568#, object-pascal-format 12569msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." 12570msgstr "\"%s\" kaynak sorgusu zaten var.%sLütfen başka bir ad seçin.%s Yine de eklemek için Yoksay'ı kullanın." 12571 12572#: lazarusidestrconsts.lismakeresstrconversionoptions 12573msgid "Conversion Options" 12574msgstr "Dönüşüm Seçenekleri" 12575 12576#: lazarusidestrconsts.lismakeresstrcustomidentifier 12577msgid "Custom identifier" 12578msgstr "Özel tanımlayıcı" 12579 12580#: lazarusidestrconsts.lismakeresstrdialogidentifier 12581msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" 12582msgid "Identifier" 12583msgstr "Tanıtıcı" 12584 12585#: lazarusidestrconsts.lismakeresstridentifierlength 12586msgid "Identifier length:" 12587msgstr "Tanımlayıcı uzunluğu:" 12588 12589#: lazarusidestrconsts.lismakeresstridentifierprefix 12590msgid "Identifier prefix:" 12591msgstr "Tanımlayıcı öneki:" 12592 12593#: lazarusidestrconsts.lismakeresstrinsertalphabetically 12594msgid "Insert alphabetically" 12595msgstr "Alfabetik olarak ekle" 12596 12597#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive 12598msgid "Insert context sensitive" 12599msgstr "İçeriğe duyarlı ekle" 12600 12601#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect 12602msgid "Invalid Resourcestring section" 12603msgstr "Geçersiz Kaynak string seçimi" 12604 12605#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring 12606msgid "Please choose a resourcestring section from the list." 12607msgstr "Lütfen listeden bir kaynak seçme bölümü seçin." 12608 12609#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis 12610msgid "Resourcestring already exists" 12611msgstr "Kaynak string zaten var" 12612 12613#: lazarusidestrconsts.lismakeresstrresourcestringsection 12614msgid "Resourcestring section:" 12615msgstr "Kaynak string seçimi:" 12616 12617#: lazarusidestrconsts.lismakeresstrsourcepreview 12618msgid "Source preview" 12619msgstr "Kaynak önizleme" 12620 12621#: lazarusidestrconsts.lismakeresstrstringconstantinsource 12622msgid "String constant in source" 12623msgstr "Kaynaktaki sabit sabit" 12624 12625#: lazarusidestrconsts.lismakeresstrstringswithsamevalue 12626msgid "Strings with same value:" 12627msgstr "Aynı değere sahip dizeler:" 12628 12629#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto 12630msgid "Make sure all ppu files of a package are in its output directory." 12631msgstr "Bir paketin tüm ppu dosyalarının çıkış dizininde olduğundan emin olun." 12632 12633#: lazarusidestrconsts.lismanagesourceeditors 12634msgid "Manage Source Editors ..." 12635msgstr "Kaynak Düzenleyicileri Yönet ..." 12636 12637#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul 12638msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system." 12639msgstr "Paralel olarak derlemek için maksimum iş parçacığı sayısı. Varsayılan, sistemdeki çekirdek sayısını tahmin eden 0'dır." 12640 12641#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault 12642#, object-pascal-format 12643msgid "Maximum parallel processes, 0 means default (%s)" 12644msgstr "Maksimum paralel işlemler, 0 varsayılan (%s) anlamına gelir" 12645 12646#: lazarusidestrconsts.lismaxs 12647#, object-pascal-format 12648msgid "Max %d" 12649msgstr "Maks. %d" 12650 12651#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage 12652#, object-pascal-format 12653msgid "%s Maybe you have to recompile the package." 12654msgstr "%s Belki de paketi yeniden derlemelisiniz." 12655 12656#: lazarusidestrconsts.lismb 12657#, object-pascal-format 12658msgid "%s MB" 12659msgstr "%s MB" 12660 12661#: lazarusidestrconsts.lismeaction 12662msgctxt "lazarusidestrconsts.lismeaction" 12663msgid "Action" 12664msgstr "Aksiyon" 12665 12666#: lazarusidestrconsts.lismemorydump 12667msgid "Memory Dump" 12668msgstr "Bellek Dökümü" 12669 12670#: lazarusidestrconsts.lismenuabortbuild 12671msgid "Abort Build" 12672msgstr "Yapımı iptal et" 12673 12674#: lazarusidestrconsts.lismenuaboutfpc 12675msgid "About FPC" 12676msgstr "FPC Hakkında" 12677 12678#: lazarusidestrconsts.lismenuaddbreakpoint 12679msgid "Add &Breakpoint" 12680msgstr "Ekle ve Kesme Noktası" 12681 12682#: lazarusidestrconsts.lismenuaddcurfiletopkg 12683msgid "Add Active File to Package ..." 12684msgstr "Aktif Dosya Paketine Ekle ..." 12685 12686#: lazarusidestrconsts.lismenuaddjumppointtohistory 12687msgid "Add Jump Point to History" 12688msgstr "Geçmişe Atlama Noktası Ekle" 12689 12690#: lazarusidestrconsts.lismenuaddtoproject 12691msgid "Add Editor File to Project" 12692msgstr "Editör Dosyasını Projeye Ekle" 12693 12694#: lazarusidestrconsts.lismenuaddwatch 12695msgid "Add &Watch ..." 12696msgstr "&İzleme Ekle ..." 12697 12698#: lazarusidestrconsts.lismenubeaklinesinselection 12699msgid "Break Lines in Selection" 12700msgstr "Seçimde Kesme Hatları" 12701 12702#: lazarusidestrconsts.lismenubreak 12703msgid "&Break" 12704msgstr "Kırılmalar" 12705 12706#: lazarusidestrconsts.lismenubuildfile 12707msgid "Build File" 12708msgstr "Dosya Oluştur" 12709 12710#: lazarusidestrconsts.lismenubuildlazarus 12711msgid "Build Lazarus with Current Profile" 12712msgstr "Mevcut Profille Lazarus Oluştur" 12713 12714#: lazarusidestrconsts.lismenubuildlazarusprof 12715#, object-pascal-format 12716msgid "Build Lazarus with Profile: %s" 12717msgstr "Lazarus'u Profille oluştur: %s" 12718 12719#: lazarusidestrconsts.lismenuchecklfm 12720msgid "Check LFM File in Editor" 12721msgstr "Düzenleyicide LFM Dosyasını Denetle" 12722 12723#: lazarusidestrconsts.lismenucleandirectory 12724msgid "Clean Directory ..." 12725msgstr "Klasörü temizle ..." 12726 12727#: lazarusidestrconsts.lismenucleanupandbuild 12728msgid "Clean up and Build ..." 12729msgstr "Temizle ve kur ..." 12730 12731#: lazarusidestrconsts.lismenucloseall 12732msgid "Close A&ll" 12733msgstr "Hepsini kapat" 12734 12735#: lazarusidestrconsts.lismenucloseeditorfile 12736msgid "&Close Editor File" 12737msgstr "&Editör Dosyasını Kapat" 12738 12739#: lazarusidestrconsts.lismenucloseproject 12740msgid "Close Project" 12741msgstr "Projeyi Kapat" 12742 12743#: lazarusidestrconsts.lismenucodetoolsdefineseditor 12744msgid "CodeTools Defines Editor ..." 12745msgstr "Kod Araçları Tanımları Düzenleyici..." 12746 12747#: lazarusidestrconsts.lismenucommentselection 12748msgid "Comment Selection" 12749msgstr "Yorum Seçimi" 12750 12751#: lazarusidestrconsts.lismenucomparefiles 12752msgid "Compare files ..." 12753msgstr "Dosyaları karşılaştır ..." 12754 12755#: lazarusidestrconsts.lismenucompilemanymodes 12756msgid "Compile many Modes ..." 12757msgstr "Birçok Modda Derleyin ..." 12758 12759#: lazarusidestrconsts.lismenucompletecode 12760msgid "Complete Code" 12761msgstr "Komple Kod" 12762 12763#: lazarusidestrconsts.lismenucompletecodeinteractive 12764msgid "Complete Code (with dialog)" 12765msgstr "Komple Kod (iletişim kutusuyla)" 12766 12767#: lazarusidestrconsts.lismenuconfigbuildfile 12768msgid "Configure Build+Run File ..." 12769msgstr "Yapı Yapı + Dosyayı Çalıştır ..." 12770 12771#: lazarusidestrconsts.lismenuconfigcustomcomps 12772msgid "Configure Custom Components ..." 12773msgstr "Özel Bileşenleri Yapılandır ..." 12774 12775#: lazarusidestrconsts.lismenuconfigexternaltools 12776msgid "Configure External Tools ..." 12777msgstr "Dış Araçları Yapılandır ..." 12778 12779#: lazarusidestrconsts.lismenuconfigurebuildlazarus 12780msgid "Configure \"Build Lazarus\" ..." 12781msgstr "\"Lazarus oluşturmayı\" Yapılandır..." 12782 12783#: lazarusidestrconsts.lismenucontexthelp 12784msgid "Context sensitive Help" 12785msgstr "Bağlama duyarlı Yardım" 12786 12787#: lazarusidestrconsts.lismenucontinue 12788msgid "&Continue" 12789msgstr "&Devam" 12790 12791#: lazarusidestrconsts.lismenuconvertdelphipackage 12792msgid "Convert Delphi Package to Lazarus Package ..." 12793msgstr "Delphi Paketini Lazarus Paketine Dönüştür ..." 12794 12795#: lazarusidestrconsts.lismenuconvertdelphiproject 12796msgid "Convert Delphi Project to Lazarus Project ..." 12797msgstr "Delphi Projesini Lazarus Projesine Dönüştür ..." 12798 12799#: lazarusidestrconsts.lismenuconvertdelphiunit 12800msgid "Convert Delphi Unit to Lazarus Unit ..." 12801msgstr "Delphi Birimini Lazarus Birimine Dönüştür ..." 12802 12803#: lazarusidestrconsts.lismenuconvertdfmtolfm 12804msgid "Convert Binary DFM to Text LFM + Check Syntax ..." 12805msgstr "İkili DFM'yi Metin LFM'ye Dönüştür + Sözdizimini Kontrol Edin ..." 12806 12807#: lazarusidestrconsts.lismenuconvertencoding 12808msgid "Convert Encoding of Projects/Packages ..." 12809msgstr "Projelerin / Paketlerin Kodlamasını Dönüştür ..." 12810 12811#: lazarusidestrconsts.lismenudebugwindows 12812msgid "Debug Windows" 12813msgstr "Hata Ayıklama penceresi" 12814 12815#: lazarusidestrconsts.lismenudelphiconversion 12816msgid "Delphi Conversion" 12817msgstr "Delphi Dönüşümü" 12818 12819#: lazarusidestrconsts.lismenuedit 12820msgid "&Edit" 12821msgstr "&Düzen" 12822 12823#: lazarusidestrconsts.lismenueditcodetemplates 12824msgid "Code Templates ..." 12825msgstr "Kod Şablonları ..." 12826 12827#: lazarusidestrconsts.lismenueditcontexthelp 12828msgid "Edit context sensitive Help" 12829msgstr "Bağlama duyarlı Yardımını düzenle" 12830 12831#: lazarusidestrconsts.lismenueditinstallpkgs 12832msgid "Install/Uninstall Packages ..." 12833msgstr "Paketleri Yükle / Kaldır ..." 12834 12835#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging 12836#, object-pascal-format 12837msgid "Accelerator(&&) key \"%s\" needs changing" 12838msgstr "Hızlandırıcı(&&) tuşunun \"%s\" değişmesi gerekiyor" 12839 12840#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem 12841msgid "Add a new item above selected item" 12842msgstr "Seçili öğenin üstüne yeni bir öğe ekle" 12843 12844#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem 12845msgid "Add a new item after selected item" 12846msgstr "Seçili öğeden sonra yeni bir öğe ekle" 12847 12848#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem 12849msgid "Add a new item before selected item" 12850msgstr "Seçili öğeden önce yeni bir öğe ekle" 12851 12852#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem 12853msgid "Add a new item below selected item" 12854msgstr "Seçili öğenin altına yeni bir öğe ekle" 12855 12856#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem 12857msgid "Add a submenu at the right of selected item" 12858msgstr "Seçili öğenin sağına bir alt menü ekle" 12859 12860#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem 12861msgid "Add a submenu below selected item" 12862msgstr "Seçili öğenin altına bir alt menü ekle" 12863 12864#: lazarusidestrconsts.lismenueditoraddfromtemplate 12865msgid "&Add from template ..." 12866msgstr "&Şablondan ekle...." 12867 12868#: lazarusidestrconsts.lismenueditoraddiconfroms 12869#, object-pascal-format 12870msgid "Add icon from %s" 12871msgstr "%s 'den simge ekle" 12872 12873#: lazarusidestrconsts.lismenueditoraddimagelisticon 12874msgid "Add imagelist &icon" 12875msgstr "İmge ve sim&ge ekle" 12876 12877#: lazarusidestrconsts.lismenueditoraddmenuitem 12878msgid "Add menu item" 12879msgstr "Menü öğesi ekle" 12880 12881#: lazarusidestrconsts.lismenueditoraddnewitemabove 12882msgid "&Add new item above" 12883msgstr "&Yukarıya yeni öğe ekle" 12884 12885#: lazarusidestrconsts.lismenueditoraddnewitemafter 12886msgid "Add ne&w item after" 12887msgstr "Sonuna yen&i öğe ekle" 12888 12889#: lazarusidestrconsts.lismenueditoraddnewitembefore 12890msgid "&Add new item before" 12891msgstr "Ön&üne yeni öğe ekle" 12892 12893#: lazarusidestrconsts.lismenueditoraddnewitembelow 12894msgid "Add ne&w item below" 12895msgstr "Aşağıya ¥i öğe ekle" 12896 12897#: lazarusidestrconsts.lismenueditoraddonclickhandler 12898msgid "Add &OnClick handler" 12899msgstr "&Tıklama (OnClick) işleyicisi ekle" 12900 12901#: lazarusidestrconsts.lismenueditoraddseparatorafter 12902msgid "Add separator &after" 12903msgstr "&Sonuna Ayırıcı ekle" 12904 12905#: lazarusidestrconsts.lismenueditoraddseparatorbefore 12906msgid "Add separator &before" 12907msgstr "&Önüne Ayırıcı ekle" 12908 12909#: lazarusidestrconsts.lismenueditoraddsubmenu 12910msgid "Add submenu" 12911msgstr "Alt menü ekle" 12912 12913#: lazarusidestrconsts.lismenueditoraddsubmenubelow 12914msgid "Add &submenu below" 12915msgstr "Aşağıya &alt menü ekle" 12916 12917#: lazarusidestrconsts.lismenueditoraddsubmenuright 12918msgid "Add &submenu right" 12919msgstr "Sağa alt menü e&kle" 12920 12921#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved 12922#, object-pascal-format 12923msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items" 12924msgstr "\"%s\" olarak tanımlanan yeni bir menü şablonu temelinde %s,%d alt öğeyle kaydedildi" 12925 12926#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate 12927msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,," 12928msgstr "&Düzenle,Temel düzenle menüsü&Gerial,CTRL+Z,&İleri al,,-,,&Tümünü Seç,Ctrl+A,&Kes,Ctrl+X,K&opyala,Ctrl+C,&Yapıştır,Ctrl+V,&Özel yapıştır,,-,,A&ra,,D&eğiştir,,&Git ...,," 12929 12930#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate 12931msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,," 12932msgstr "&Dosya,Temel dosya menüsü,&Yeni,,&Aç ...,,&Kaydet,&Farklı Kaydet,,-,,&Yazdır,,Ya&zıcı ayarları...,,-,,&Çıkış,," 12933 12934#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate 12935msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,," 12936msgstr "&Yardım,&Temel yardım menüsü,Yardım ve &İçindekiler, F1, Ya&rdım ve Dizin,, &Çevrimiçi Yardım,,-,&Lisans Bilgisi,&Güncellemeleri Kontrol Et,,-,&Hakkında,," 12937 12938#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate 12939msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,," 12940msgstr "&Pencere,&Temel pencere menüsü, &Yeni Pencere, &Döşe,,&Kademeli, &Tümünü düzenle,,-,,&Gizle,,&Göster ,," 12941 12942#: lazarusidestrconsts.lismenueditorcaption 12943msgid "Caption" 12944msgstr "Başlık" 12945 12946#: lazarusidestrconsts.lismenueditorcaptioneditemss 12947#, object-pascal-format 12948msgid "Captioned items: %s" 12949msgstr "Başlık öğeleri:%s" 12950 12951#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank 12952msgid "Caption should not be blank" 12953msgstr "Başlık boş olmamalıdır" 12954 12955#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators 12956#, object-pascal-format 12957msgid "Change conflicting accelerator \"%s\"" 12958msgstr "Çakışan hızlandırıcıyı \"%s\" değiştir" 12959 12960#: lazarusidestrconsts.lismenueditorchangeimagelisticon 12961msgid "Change imagelist &icon" 12962msgstr "İmgeleyici ve &simgeyi değiştir" 12963 12964#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent 12965#, object-pascal-format 12966msgid "Change %s for %s" 12967msgstr "%s için %s değiştir" 12968 12969#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts 12970#, object-pascal-format 12971msgid "Change shortcut conflict \"%s\"" 12972msgstr "\"%s\" kısayol çakışmasını değiştir" 12973 12974#: lazarusidestrconsts.lismenueditorchangetheshortcutfors 12975#, object-pascal-format 12976msgid "Change the shortCut for %s" 12977msgstr "Kısayol öğesini %s için değiştirin" 12978 12979#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors 12980#, object-pascal-format 12981msgid "Change the shortCutKey2 for %s" 12982msgstr "Kısayol2 öğesini %s için değiştirin" 12983 12984#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete 12985msgid "Choose template to delete" 12986msgstr "Silinecek şablonu seçin" 12987 12988#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert 12989msgid "Choose template to insert" 12990msgstr "Eklenecek şablonu seçin" 12991 12992#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut 12993msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column" 12994msgstr "Kısayolunu düzenlemek için grileşmemiş bir öğeyi tıklayın veya o sütuna göre sıralamak için başlığı tıklayın" 12995 12996#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind 12997msgid "Component is unexpected kind" 12998msgstr "Bileşen beklenmedik bir tür" 12999 13000#: lazarusidestrconsts.lismenueditorcomponentisunnamed 13001msgid "Component is unnamed" 13002msgstr "Bileşen adlandırılmamış" 13003 13004#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete 13005msgid "<conflict resolution complete>" 13006msgstr "<çakışma çözümü tamamlandı>" 13007 13008#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd 13009#, object-pascal-format 13010msgid "Conflicts found initially: %d" 13011msgstr "Başlangıçta bulunan çakışmalar: %d" 13012 13013#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels 13014#, object-pascal-format 13015msgid "Deepest nested menu level: %s" 13016msgstr "En derin iç içe menü seviyesi: %s" 13017 13018#: lazarusidestrconsts.lismenueditordeleteitem 13019msgid "&Delete item" 13020msgstr "&Öğeyi sil" 13021 13022#: lazarusidestrconsts.lismenueditordeletemenutemplate 13023msgid "&Delete menu template ..." 13024msgstr "Menü şablonunu &sil ..." 13025 13026#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate 13027msgid "Delete saved menu template" 13028msgstr "Kayıtlı menü şablonunu sil" 13029 13030#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate 13031msgid "Delete selected menu template" 13032msgstr "Seçili menü şablonunu sil" 13033 13034#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems 13035msgid "Delete this item and its subitems?" 13036msgstr "Bu öğe ve alt öğeler silinsin mi?" 13037 13038#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu 13039msgid "Display preview as &Popup menu" 13040msgstr "Açılır &menü önizlemesini görüntüle" 13041 13042#: lazarusidestrconsts.lismenueditoreditcaption 13043msgid "Edit &Caption" 13044msgstr "&Başlığı düzenle" 13045 13046#: lazarusidestrconsts.lismenueditoreditingcaptionofs 13047#, object-pascal-format 13048msgid "Editing Caption of %s" 13049msgstr "%s Başlığını Düzenleme" 13050 13051#: lazarusidestrconsts.lismenueditoreditingsdots 13052#, object-pascal-format 13053msgid "To resolve conflict edit %s.%s" 13054msgstr "Çakışmayı çözmek için %s.%s" 13055 13056#: lazarusidestrconsts.lismenueditoreditingsfors 13057#, object-pascal-format 13058msgid "Editing %s for %s" 13059msgstr "%s için %s düzenleme" 13060 13061#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected 13062#, object-pascal-format 13063msgid "Editing %s.%s - no menuitem selected" 13064msgstr "%s.%s düzenleniyor - menü öğesi seçilmedi" 13065 13066#: lazarusidestrconsts.lismenueditorenteramenudescription 13067msgid "Enter a menu &Description:" 13068msgstr "Bir menü &açıklaması girin:" 13069 13070#: lazarusidestrconsts.lismenueditorenteranewshortcutfors 13071#, object-pascal-format 13072msgid "Enter a new ShortCut for %s" 13073msgstr "%s için yeni bir kısayol girin" 13074 13075#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors 13076#, object-pascal-format 13077msgid "Enter a new ShortCutKey2 for %s" 13078msgstr "%s için yeni bir Kısyoltuşu2 girin" 13079 13080#: lazarusidestrconsts.lismenueditorexistingsavedtemplates 13081msgid "Existing saved templates" 13082msgstr "Mevcut kaydedilmiş şablonlar" 13083 13084#: lazarusidestrconsts.lismenueditorfurthershortcutconflict 13085msgid "Further shortcut conflict" 13086msgstr "Daha fazla kısayol çakışması" 13087 13088#: lazarusidestrconsts.lismenueditorgethelptousethiseditor 13089msgid "Get help to use this editor" 13090msgstr "Bu editörü kullanmak için yardım alın" 13091 13092#: lazarusidestrconsts.lismenueditorgrabkey 13093msgid "&Grab key" 13094msgstr "&Tutma tuşu" 13095 13096#: lazarusidestrconsts.lismenueditorgroupindexd 13097#, object-pascal-format 13098msgid "GroupIndex: %d" 13099msgstr "GroupIndex: %d" 13100 13101#: lazarusidestrconsts.lismenueditorgroupindexvaluess 13102#, object-pascal-format 13103msgid "Values in use: %s" 13104msgstr "Kullanılan değerler: %s" 13105 13106#: lazarusidestrconsts.lismenueditorinadequatedescription 13107msgid "Inadequate Description" 13108msgstr "Yetersiz Açıklama" 13109 13110#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs 13111#, object-pascal-format 13112msgid "Insert menu template into root of %s" 13113msgstr "Menü şablonunu %s köküne ekle" 13114 13115#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate 13116msgid "Insert selected menu template" 13117msgstr "Seçili menü şablonunu ekle" 13118 13119#: lazarusidestrconsts.lismenueditorisnotassigned 13120msgid "is not assigned" 13121msgstr "atanmamış" 13122 13123#: lazarusidestrconsts.lismenueditoritemswithicons 13124#, object-pascal-format 13125msgid "Items with icon: %s" 13126msgstr "Simgeli öğeler: %s" 13127 13128#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators 13129#, object-pascal-format 13130msgid "List shortcuts and &accelerators for %s ..." 13131msgstr "%s için kısayolları ve &hızlandırıcıları listele ..." 13132 13133#: lazarusidestrconsts.lismenueditorlistshortcutsfors 13134#, object-pascal-format 13135msgid "List shortcuts for %s ..." 13136msgstr "%s kısayollarını listele ..." 13137 13138#: lazarusidestrconsts.lismenueditormenueditor 13139msgid "Menu Editor" 13140msgstr "Menü Düzenleyici" 13141 13142#: lazarusidestrconsts.lismenueditormenuitemactions 13143msgid "Menu Item actions" 13144msgstr "Menü Öğesi eylemleri" 13145 13146#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins 13147#, object-pascal-format 13148msgid "Menuitem shortcut conflicts in %s" 13149msgstr "%s içindeki menü öğesi kısayolu çakışıyor" 13150 13151#: lazarusidestrconsts.lismenueditormovedown 13152msgid "Move Down (or right)" 13153msgstr "Aşağı Taşı (veya sağa)" 13154 13155#: lazarusidestrconsts.lismenueditormoveitemdown 13156msgid "Mo&ve item down" 13157msgstr "Aşağı taşı" 13158 13159#: lazarusidestrconsts.lismenueditormoveitemleft 13160msgid "&Move item left" 13161msgstr "Sola taşı" 13162 13163#: lazarusidestrconsts.lismenueditormoveitemright 13164msgid "Mo&ve item right" 13165msgstr "Sağa taşı" 13166 13167#: lazarusidestrconsts.lismenueditormoveitemup 13168msgid "&Move item up" 13169msgstr "Yukarı taşı" 13170 13171#: lazarusidestrconsts.lismenueditormoveselecteditemdown 13172msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown" 13173msgid "Move selected item down" 13174msgstr "Seçili öğeyi aşağı taşı" 13175 13176#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft 13177msgid "Move selected item to the left" 13178msgstr "Seçili öğeyi sola taşı" 13179 13180#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright 13181msgid "Move selected item to the right" 13182msgstr "Seçili öğeyi sağa taşı" 13183 13184#: lazarusidestrconsts.lismenueditormoveselecteditemup 13185msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup" 13186msgid "Move selected item up" 13187msgstr "Seçili öğeyi yukarı taşı" 13188 13189#: lazarusidestrconsts.lismenueditormoveup 13190msgid "Move Up (or left)" 13191msgstr "Yukarı Taşı (veya Sola)" 13192 13193#: lazarusidestrconsts.lismenueditorna 13194msgid "n/a" 13195msgstr "n/a" 13196 13197#: lazarusidestrconsts.lismenueditornomenuselected 13198msgid "(no menu selected)" 13199msgstr "(menü seçilmedi)" 13200 13201#: lazarusidestrconsts.lismenueditornone 13202msgid "<none>" 13203msgstr "<yok>" 13204 13205#: lazarusidestrconsts.lismenueditornonenone 13206msgid "<none>,<none>" 13207msgstr "<yok>,<yok>" 13208 13209#: lazarusidestrconsts.lismenueditornoshortcutconflicts 13210msgid "<no shortcut conflicts>" 13211msgstr "<kısayol çakışması yok>" 13212 13213#: lazarusidestrconsts.lismenueditornousersavedtemplates 13214msgid "No user-saved templates" 13215msgstr "Kullanıcının kaydettiği şablon yok" 13216 13217#: lazarusidestrconsts.lismenueditorpickaniconfroms 13218#, object-pascal-format 13219msgid "Pick an icon from %s" 13220msgstr "%s öğesinden bir simge seçin" 13221 13222#: lazarusidestrconsts.lismenueditorpopupassignmentss 13223#, object-pascal-format 13224msgid "Popup assignments: %s" 13225msgstr "Popup atamaları:%s" 13226 13227#: lazarusidestrconsts.lismenueditorradioitem 13228msgid "RadioItem" 13229msgstr "Radioögesi" 13230 13231#: lazarusidestrconsts.lismenueditorremainingconflictss 13232#, object-pascal-format 13233msgid "Remaining conflicts: %s" 13234msgstr "Kalan çakışmalar: %s" 13235 13236#: lazarusidestrconsts.lismenueditorremoveallseparators 13237msgid "&Remove all separators" 13238msgstr "&Tüm ayırıcıları kaldır" 13239 13240#: lazarusidestrconsts.lismenueditorresolvedconflictss 13241#, object-pascal-format 13242msgid "Resolved conflicts: %s" 13243msgstr "Çözülen çakışmalar:%s" 13244 13245#: lazarusidestrconsts.lismenueditorresolveselectedconflict 13246msgid "Resolve selected conflict" 13247msgstr "Seçili çakışmaları çöz" 13248 13249#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts 13250msgid "&Resolve shortcut conflicts ..." 13251msgstr "Kısayol çakışma&larını çöz ..." 13252 13253#: lazarusidestrconsts.lismenueditorsavedtemplates 13254msgid "Saved templates" 13255msgstr "Şablonlar kaydedildi" 13256 13257#: lazarusidestrconsts.lismenueditorsavemenuasatemplate 13258msgid "&Save menu as a template ..." 13259msgstr "&Menüyü şablon olarak kaydet..." 13260 13261#: lazarusidestrconsts.lismenueditorsavemenuastemplate 13262msgid "Save menu as template" 13263msgstr "Menüyü şablon olarak kaydet" 13264 13265#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse 13266msgid "Save menu as template for future use" 13267msgstr "Menüyü ileride kullanmak üzere şablon olarak kaydet" 13268 13269#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate 13270msgid "Save menu shown as a new template" 13271msgstr "Yeni şablon olarak gösterilen menüyü kaydet" 13272 13273#: lazarusidestrconsts.lismenueditorsconflictswiths 13274#, object-pascal-format 13275msgid "%s conflicts with %s" 13276msgstr "%s ile %s çakışıyor" 13277 13278#: lazarusidestrconsts.lismenueditorseparators 13279msgid "Se¶tors" 13280msgstr "&Ayırıcılar" 13281 13282#: lazarusidestrconsts.lismenueditorshortcutitemss 13283#, object-pascal-format 13284msgid "Shortcut items: %s" 13285msgstr "Kısayol ögeleri: %s" 13286 13287#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged 13288msgid "Shortcut not yet changed" 13289msgstr "Kısayol henüz değiştirilmedi" 13290 13291#: lazarusidestrconsts.lismenueditorshortcuts 13292msgid "Shortcuts" 13293msgstr "Kısayollar" 13294 13295#: lazarusidestrconsts.lismenueditorshortcuts2 13296msgid "Shortc&uts" 13297msgstr "&Kısayollar" 13298 13299#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys 13300msgid "Shortcuts and Accelerator keys" 13301msgstr "Kısayollar ve Hızlandırıcı tuşlar" 13302 13303#: lazarusidestrconsts.lismenueditorshortcutsd 13304#, object-pascal-format 13305msgid "Shortcuts (%d)" 13306msgstr "Kısayollar (%d)" 13307 13308#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd 13309#, object-pascal-format 13310msgid "Shortcuts (%d) and Accelerator keys (%d)" 13311msgstr "Kısayollar (%d) ve Hızlandırıcı tuşlar (%d)" 13312 13313#: lazarusidestrconsts.lismenueditorshortcutsourceproperty 13314msgid "Shortcut,Source Property" 13315msgstr "Kısayol, Kaynak Özelliği" 13316 13317#: lazarusidestrconsts.lismenueditorshortcutsusedins 13318#, object-pascal-format 13319msgid "Shortcuts used in %s" 13320msgstr "%s içinde kullanılan kısayollar" 13321 13322#: lazarusidestrconsts.lismenueditorshortcutsusedinsd 13323#, object-pascal-format 13324msgid "Shortcuts used in %s (%d)" 13325msgstr "%s içinde kullanılan kısayollar (%d)" 13326 13327#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil 13328msgid "ShowMenuEditor: TMenu parameter is nil" 13329msgstr "ShowMenuEditor: TMenu parametresi yok" 13330 13331#: lazarusidestrconsts.lismenueditorsins 13332#, object-pascal-format 13333msgid "\"%s\" in %s" 13334msgstr "\"%s\" de %s" 13335 13336#: lazarusidestrconsts.lismenueditorsisalreadyinuse 13337#, object-pascal-format 13338msgid "" 13339"\"%s\" is already in use in %s as a shortcut.\n" 13340"Try a different shortcut." 13341msgstr "" 13342"\"%s\" zaten %s içinde kısayol olarak kullanılıyor.\n" 13343"Farklı bir kısayol deneyin." 13344 13345#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand 13346#, object-pascal-format 13347msgid "Please expand: \"%s\" is not a sufficient Description" 13348msgstr "Lütfen genişletin: \"%s\" açıklama yeterli değil" 13349 13350#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar 13351msgid "Some widgetsets do not allow separators in the main menubar" 13352msgstr "Bazı widget'lar ana menü çubuğunda ayırıcılara izin vermiyor" 13353 13354#: lazarusidestrconsts.lismenueditorsshortcuts 13355#, object-pascal-format 13356msgid "%s: Shortcuts" 13357msgstr "%s: Kısayollar" 13358 13359#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys 13360#, object-pascal-format 13361msgid "%s: Shortcuts and accelerator keys" 13362msgstr "%s: Kısayollar ve hızlandırıcı tuşlar" 13363 13364#: lazarusidestrconsts.lismenueditorsssonclicks 13365#, object-pascal-format 13366msgid "%s.%s.%s - OnClick: %s" 13367msgstr "%s.%s.%s - Tıklama(OnClick): %s" 13368 13369#: lazarusidestrconsts.lismenueditorssubmenu 13370#, object-pascal-format 13371msgid "%s submenu" 13372msgstr "%s altmenu" 13373 13374#: lazarusidestrconsts.lismenueditorstandardtemplates 13375msgid "Standard templates" 13376msgstr "Standart Şablon" 13377 13378#: lazarusidestrconsts.lismenueditortemplatedescription 13379msgid "Template description:" 13380msgstr "Şablon açıklaması:" 13381 13382#: lazarusidestrconsts.lismenueditortemplates 13383msgid "&Templates" 13384msgstr "&Şablon" 13385 13386#: lazarusidestrconsts.lismenueditortemplatesaved 13387msgid "Template saved" 13388msgstr "Şablon kaydedildi" 13389 13390#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates 13391msgid "" 13392"There are no user-saved menu templates.\n" 13393"\n" 13394"Only standard default templates are available." 13395msgstr "" 13396"Kullanıcının kaydettiği menü şablonu yok.\n" 13397"\n" 13398"Yalnızca standart varsayılan şablonlar kullanılabilir." 13399 13400#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis 13401#, object-pascal-format 13402msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" 13403msgstr "TSCList.GetScanListCompName: FScanList için geçersiz %d dizini" 13404 13405#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict 13406#, object-pascal-format 13407msgid "" 13408"You have to change the shortcut from %s\n" 13409"to avoid a conflict" 13410msgstr "" 13411"Anlaşmazlığı önlemek için kısayolu %s konumundan\n" 13412"değiştirmeniz gerekiyor" 13413 13414#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption 13415msgid "You must enter text for the Caption" 13416msgstr "Başlık için metin girmelisiniz" 13417 13418#: lazarusidestrconsts.lismenuencloseinifdef 13419msgid "Enclose in $IFDEF ..." 13420msgstr "$IFDEF dahil et .." 13421 13422#: lazarusidestrconsts.lismenuencloseselection 13423msgid "Enclose Selection ..." 13424msgstr "Seçimi Dahil Et..." 13425 13426#: lazarusidestrconsts.lismenuevaluate 13427msgid "E&valuate/Modify ..." 13428msgstr "&Değerlendir/Değiştir ..." 13429 13430#: lazarusidestrconsts.lismenuexampleprojects 13431msgid "Example Projects ..." 13432msgstr "Örnek Projeler ..." 13433 13434#: lazarusidestrconsts.lismenuextractproc 13435msgid "Extract Procedure ..." 13436msgstr "İşlemi Ayıkla ..." 13437 13438#: lazarusidestrconsts.lismenufile 13439msgid "&File" 13440msgstr "&Dosya" 13441 13442#: lazarusidestrconsts.lismenufind 13443msgid "Find" 13444msgstr "Bul" 13445 13446#: lazarusidestrconsts.lismenufind2 13447msgid "&Find ..." 13448msgstr "&Bul ..." 13449 13450#: lazarusidestrconsts.lismenufindblockotherendofcodeblock 13451msgid "Find Other End of Code Block" 13452msgstr "Kod Bloğunun Diğer Sonu Bul" 13453 13454#: lazarusidestrconsts.lismenufindcodeblockstart 13455msgid "Find Start of Code Block" 13456msgstr "Kod Bloğunun Başlangıcını Bul" 13457 13458#: lazarusidestrconsts.lismenufinddeclarationatcursor 13459msgid "Find Declaration at Cursor" 13460msgstr "İmleçte Bildirimi Bul" 13461 13462#: lazarusidestrconsts.lismenufindidentifierrefs 13463msgid "Find Identifier References ..." 13464msgstr "Tanımlayıcı Referanslarını Bul ..." 13465 13466#: lazarusidestrconsts.lismenufindinfiles 13467msgid "Find &in Files ..." 13468msgstr "&Dosyada Bul..." 13469 13470#: lazarusidestrconsts.lismenufindnext 13471msgid "Find &Next" 13472msgstr "&Sonrakini bul" 13473 13474#: lazarusidestrconsts.lismenufindprevious 13475msgid "Find &Previous" 13476msgstr "Ö&ncekini bul" 13477 13478#: lazarusidestrconsts.lismenufindreferencesofusedunit 13479msgid "Find References Of Used Unit" 13480msgstr "Kullanılmış Birimin Referanslarını Bul" 13481 13482#: lazarusidestrconsts.lismenugeneraloptions 13483msgid "Options ..." 13484msgstr "Seçenekler ..." 13485 13486#: lazarusidestrconsts.lismenugotoincludedirective 13487msgid "Goto Include Directive" 13488msgstr "Yönetmeliğe Git" 13489 13490#: lazarusidestrconsts.lismenugotoline 13491msgid "Goto Line ..." 13492msgstr "Satıra Git ..." 13493 13494#: lazarusidestrconsts.lismenuguessmisplacedifdef 13495msgid "Guess Misplaced IFDEF/ENDIF" 13496msgstr "Sanırım yanlış yerleştirilmiş IFDEF / ENDIF" 13497 13498#: lazarusidestrconsts.lismenuguessunclosedblock 13499msgid "Guess Unclosed Block" 13500msgstr "Sanırım engellenmiş blok" 13501 13502#: lazarusidestrconsts.lismenuhelp 13503msgid "&Help" 13504msgstr "&Yardım" 13505 13506#: lazarusidestrconsts.lismenuideinternals 13507msgid "IDE Internals" 13508msgstr "IDE Dahilileri" 13509 13510#: lazarusidestrconsts.lismenuincrementalfind 13511msgid "Incremental Find" 13512msgstr "Artımlı Bul" 13513 13514#: lazarusidestrconsts.lismenuindentselection 13515msgid "Indent Selection" 13516msgstr "Girinti Seçimi" 13517 13518#: lazarusidestrconsts.lismenuinsertchangelogentry 13519msgid "ChangeLog Entry" 13520msgstr "Değişiklik Girişi" 13521 13522#: lazarusidestrconsts.lismenuinsertcharacter 13523msgid "Insert from Character Map ..." 13524msgstr "Karakter Haritası Ekle ..." 13525 13526#: lazarusidestrconsts.lismenuinsertcvskeyword 13527msgid "Insert CVS Keyword" 13528msgstr "CVS Anahtar Kelimesini Ekle" 13529 13530#: lazarusidestrconsts.lismenuinsertdatetime 13531msgid "Current Date and Time" 13532msgstr "Geçerli Tarih ve Saat" 13533 13534#: lazarusidestrconsts.lismenuinsertfilename 13535msgid "Insert Full Filename ..." 13536msgstr "Tam Dosya Adını Ekle ..." 13537 13538#: lazarusidestrconsts.lismenuinsertgeneral 13539msgid "Insert General" 13540msgstr "Genel Ekle" 13541 13542#: lazarusidestrconsts.lismenuinsertgplnotice 13543msgid "GPL Notice" 13544msgstr "GPL Bildirimi" 13545 13546#: lazarusidestrconsts.lismenuinsertgplnoticetranslated 13547msgid "GPL Notice (translated)" 13548msgstr "GPL Bildirimi (tercüme edildi)" 13549 13550#: lazarusidestrconsts.lismenuinsertlgplnotice 13551msgid "LGPL Notice" 13552msgstr "LGPL Bildirimi" 13553 13554#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated 13555msgid "LGPL Notice (translated)" 13556msgstr "LGPL Bildirimi (tercüme edildi)" 13557 13558#: lazarusidestrconsts.lismenuinsertmitnotice 13559msgid "MIT Notice" 13560msgstr "MIT Bildirimi" 13561 13562#: lazarusidestrconsts.lismenuinsertmitnoticetranslated 13563msgid "MIT Notice (translated)" 13564msgstr "MIT Bildirimi (tercüme edildi)" 13565 13566#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice 13567msgid "Modified LGPL Notice" 13568msgstr "Değiştirilmiş LGPL Bildirimi" 13569 13570#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated 13571msgid "Modified LGPL Notice (translated)" 13572msgstr "Değiştirilmiş LGPL Bildirimi (tercüme edildi)" 13573 13574#: lazarusidestrconsts.lismenuinsertusername 13575msgid "Current Username" 13576msgstr "Geçerli Kullanıcı Adı" 13577 13578#: lazarusidestrconsts.lismenuinspect 13579msgctxt "lazarusidestrconsts.lismenuinspect" 13580msgid "&Inspect ..." 13581msgstr "&Denetle ..." 13582 13583#: lazarusidestrconsts.lismenujumpback 13584msgid "Jump Back" 13585msgstr "Geri Atla" 13586 13587#: lazarusidestrconsts.lismenujumpforward 13588msgid "Jump Forward" 13589msgstr "İleriye Atla" 13590 13591#: lazarusidestrconsts.lismenujumpto 13592msgid "Jump to" 13593msgstr "Atla" 13594 13595#: lazarusidestrconsts.lismenujumptoimplementation 13596msgid "Jump to Implementation" 13597msgstr "Implementation bölümüne atla" 13598 13599#: lazarusidestrconsts.lismenujumptoimplementationuses 13600msgid "Jump to Implementation uses" 13601msgstr "Implementation uses bölümüne atla" 13602 13603#: lazarusidestrconsts.lismenujumptoinitialization 13604msgid "Jump to Initialization" 13605msgstr "Initalization bölümüne atla" 13606 13607#: lazarusidestrconsts.lismenujumptointerface 13608msgid "Jump to Interface" 13609msgstr "Interface bölümüne atla" 13610 13611#: lazarusidestrconsts.lismenujumptointerfaceuses 13612msgid "Jump to Interface uses" 13613msgstr "Uses bölümüne atla" 13614 13615#: lazarusidestrconsts.lismenujumptonextbookmark 13616msgid "Jump to Next Bookmark" 13617msgstr "Sonraki Favorilere Git" 13618 13619#: lazarusidestrconsts.lismenujumptonexterror 13620msgid "Jump to Next Error" 13621msgstr "Sonraki Hataya Git" 13622 13623#: lazarusidestrconsts.lismenujumptoprevbookmark 13624msgid "Jump to Previous Bookmark" 13625msgstr "Önceki Yer İşaretine Git" 13626 13627#: lazarusidestrconsts.lismenujumptopreverror 13628msgid "Jump to Previous Error" 13629msgstr "Önceki Hataya Git" 13630 13631#: lazarusidestrconsts.lismenujumptoprocedurebegin 13632msgid "Jump to Procedure begin" 13633msgstr "Prosedür başlangıcına atla" 13634 13635#: lazarusidestrconsts.lismenujumptoprocedureheader 13636msgid "Jump to Procedure header" 13637msgstr "Prosedür başlığına atla" 13638 13639#: lazarusidestrconsts.lismenulowercaseselection 13640msgid "Lowercase Selection" 13641msgstr "Küçük harf seçimi" 13642 13643#: lazarusidestrconsts.lismenumacrolistview 13644msgid "Editor Macros ..." 13645msgstr "Editör Makroları ..." 13646 13647#: lazarusidestrconsts.lismenumakeresourcestring 13648msgid "Make Resource String ..." 13649msgstr "Kaynak Stringi Oluştur ..." 13650 13651#: lazarusidestrconsts.lismenumultipaste 13652msgid "MultiPaste ..." 13653msgstr "Çoklu Yapıştır..." 13654 13655#: lazarusidestrconsts.lismenunewcomponent 13656msgid "New Component" 13657msgstr "Yeni Bileşen" 13658 13659#: lazarusidestrconsts.lismenunewcustom 13660#, object-pascal-format 13661msgid "New %s" 13662msgstr "Yeni %s" 13663 13664#: lazarusidestrconsts.lismenunewform 13665msgid "New Form" 13666msgstr "Yeni Form" 13667 13668#: lazarusidestrconsts.lismenunewother 13669msgid "New ..." 13670msgstr "Yeni ..." 13671 13672#: lazarusidestrconsts.lismenunewpackage 13673msgid "New Package ..." 13674msgstr "Yeni Paket ..." 13675 13676#: lazarusidestrconsts.lismenunewproject 13677msgid "New Project ..." 13678msgstr "Yeni proje ..." 13679 13680#: lazarusidestrconsts.lismenunewprojectfromfile 13681msgid "New Project from File ..." 13682msgstr "Dosyadan Yeni Proje ..." 13683 13684#: lazarusidestrconsts.lismenunewunit 13685msgctxt "lazarusidestrconsts.lismenunewunit" 13686msgid "New Unit" 13687msgstr "Yeni Birim" 13688 13689#: lazarusidestrconsts.lismenuok 13690msgid "&OK" 13691msgstr "&TAMAM" 13692 13693#: lazarusidestrconsts.lismenuonlinehelp 13694msgid "Online Help" 13695msgstr "Çevrimiçi yardım" 13696 13697#: lazarusidestrconsts.lismenuopen 13698msgid "&Open ..." 13699msgstr "&Aç ..." 13700 13701#: lazarusidestrconsts.lismenuopenfilenameatcursor 13702msgid "Open Filename at Cursor" 13703msgstr "İmleçte Dosya Adını Aç" 13704 13705#: lazarusidestrconsts.lismenuopenfolder 13706msgid "Open Folder ..." 13707msgstr "Klasörü Aç..." 13708 13709#: lazarusidestrconsts.lismenuopenpackage 13710msgid "Open Loaded Package ..." 13711msgstr "Yüklü Paketden Aç ..." 13712 13713#: lazarusidestrconsts.lismenuopenpackagefile 13714msgid "Open Package File (.lpk) ..." 13715msgstr "Paket Dosyasını Aç (.lpk) ..." 13716 13717#: lazarusidestrconsts.lismenuopenpackageofcurunit 13718msgid "Open Package of Current Unit" 13719msgstr "Mevcut Ünitenin Paketini Aç" 13720 13721#: lazarusidestrconsts.lismenuopenproject 13722msgid "Open Project ..." 13723msgstr "Projeyi Aç ..." 13724 13725#: lazarusidestrconsts.lismenuopenrecent 13726msgid "Open &Recent" 13727msgstr "&En son kullanılanı Aç" 13728 13729#: lazarusidestrconsts.lismenuopenrecentpkg 13730msgid "Open Recent Package" 13731msgstr "En son açılan Paketi Aç" 13732 13733#: lazarusidestrconsts.lismenuopenrecentproject 13734msgid "Open Recent Project" 13735msgstr "En son açılan Projeyi Aç" 13736 13737#: lazarusidestrconsts.lismenuopenunit 13738msgid "Open Unit ..." 13739msgstr "Birim aç.." 13740 13741#: lazarusidestrconsts.lismenupackage 13742msgid "Pa&ckage" 13743msgstr "Pa&ket" 13744 13745#: lazarusidestrconsts.lismenupackagegraph 13746msgid "Package Graph" 13747msgstr "Paket Grafiği" 13748 13749#: lazarusidestrconsts.lismenupackagelinks 13750msgid "Package Links ..." 13751msgstr "Paket Bağlantıları ..." 13752 13753#: lazarusidestrconsts.lismenupastefromclipboard 13754msgid "Paste from clipboard" 13755msgstr "Panodan yapıştır" 13756 13757#: lazarusidestrconsts.lismenupkgnewpackagecomponent 13758msgid "New package component" 13759msgstr "Yeni bileşen paketi" 13760 13761#: lazarusidestrconsts.lismenuprocedurelist 13762msgid "Procedure List ..." 13763msgstr "İşlem Listesi ..." 13764 13765#: lazarusidestrconsts.lismenuproject 13766msgid "&Project" 13767msgstr "&Proje" 13768 13769#: lazarusidestrconsts.lismenuprojectinspector 13770msgid "Project Inspector" 13771msgstr "Proje denetçisi" 13772 13773#: lazarusidestrconsts.lismenuprojectoptions 13774msgid "Project Options ..." 13775msgstr "Proje Seçenekleri ..." 13776 13777#: lazarusidestrconsts.lismenuprojectrun 13778msgctxt "lazarusidestrconsts.lismenuprojectrun" 13779msgid "&Run" 13780msgstr "&Çalıştır" 13781 13782#: lazarusidestrconsts.lismenupublishproject 13783msgid "Publish Project ..." 13784msgstr "Projeyi Yayınla ..." 13785 13786#: lazarusidestrconsts.lismenuquickcompile 13787msgid "Quick Compile" 13788msgstr "Hızlı Derle" 13789 13790#: lazarusidestrconsts.lismenuquicksyntaxcheck 13791msgid "Quick Syntax Check" 13792msgstr "Hızlı Sözdizim Kontrolü" 13793 13794#: lazarusidestrconsts.lismenuquicksyntaxcheckok 13795msgid "Quick syntax check OK" 13796msgstr "Hızlı sözdizimi denetimi tamam" 13797 13798#: lazarusidestrconsts.lismenuremovefromproject 13799msgid "Remove from Project ..." 13800msgstr "Projeden Kaldır ..." 13801 13802#: lazarusidestrconsts.lismenurenameidentifier 13803msgid "Rename Identifier ..." 13804msgstr "Tanımlayıcıyı Yeniden Adlandır ..." 13805 13806#: lazarusidestrconsts.lismenureportingbug 13807msgid "Reporting a Bug" 13808msgstr "Hata Bildirme" 13809 13810#: lazarusidestrconsts.lismenuresaveformswithi18n 13811msgid "Resave forms with enabled i18n" 13812msgstr "Etkinleştirilmiş i18n ile formları yeniden kaydet" 13813 13814#: lazarusidestrconsts.lismenurescanfpcsourcedirectory 13815msgid "Rescan FPC Source Directory" 13816msgstr "FPC Kaynak Dizini'ni yeniden tara" 13817 13818#: lazarusidestrconsts.lismenuresetdebugger 13819msgid "Reset Debugger" 13820msgstr "Hata Ayıklayıcıyı Sıfırla" 13821 13822#: lazarusidestrconsts.lismenurevert 13823msgid "Revert" 13824msgstr "Geri Dön" 13825 13826#: lazarusidestrconsts.lismenurun 13827msgctxt "lazarusidestrconsts.lismenurun" 13828msgid "&Run" 13829msgstr "&Çalıştır" 13830 13831#: lazarusidestrconsts.lismenurunfile 13832msgid "Run File" 13833msgstr "Dosyayı Çalıştır" 13834 13835#: lazarusidestrconsts.lismenurunparameters 13836msgid "Run &Parameters ..." 13837msgstr "&Parametreleri Çalıştır..." 13838 13839#: lazarusidestrconsts.lismenuruntocursor 13840#, fuzzy 13841#| msgid "Step over to &Cursor" 13842msgctxt "lazarusidestrconsts.lismenuruntocursor" 13843msgid "Run to Cursor" 13844msgstr "&Kademeli ve İmleç" 13845 13846#: lazarusidestrconsts.lismenurunwithoutdebugging 13847msgid "Run without Debugging" 13848msgstr "Hata Ayıklamasız Çalıştır" 13849 13850#: lazarusidestrconsts.lismenusave 13851msgid "&Save" 13852msgstr "&Kaydet" 13853 13854#: lazarusidestrconsts.lismenusaveas 13855msgid "Save &As ..." 13856msgstr "&Farklı kaydet ..." 13857 13858#: lazarusidestrconsts.lismenusaveproject 13859msgid "Save Project" 13860msgstr "Projeyi Kaydet" 13861 13862#: lazarusidestrconsts.lismenusaveprojectas 13863msgid "Save Project As ..." 13864msgstr "Projeyi Farklı Kaydet.." 13865 13866#: lazarusidestrconsts.lismenusearch 13867msgid "&Search" 13868msgstr "&Arama" 13869 13870#: lazarusidestrconsts.lismenuselect 13871msgid "Select" 13872msgstr "Seç" 13873 13874#: lazarusidestrconsts.lismenuselectall 13875msgctxt "lazarusidestrconsts.lismenuselectall" 13876msgid "Select All" 13877msgstr "Hepsini seç" 13878 13879#: lazarusidestrconsts.lismenuselectcodeblock 13880msgid "Select Code Block" 13881msgstr "Kod Bloğu Seç" 13882 13883#: lazarusidestrconsts.lismenuselectline 13884msgid "Select Line" 13885msgstr "Satır Seç" 13886 13887#: lazarusidestrconsts.lismenuselectparagraph 13888msgid "Select Paragraph" 13889msgstr "Paragrafı Seç" 13890 13891#: lazarusidestrconsts.lismenuselecttobrace 13892msgid "Select to Brace" 13893msgstr "Ayracı Seç" 13894 13895#: lazarusidestrconsts.lismenuselectword 13896msgid "Select Word" 13897msgstr "Kelimeyi Seç" 13898 13899#: lazarusidestrconsts.lismenusetfreebookmark 13900msgctxt "lazarusidestrconsts.lismenusetfreebookmark" 13901msgid "Set a Free Bookmark" 13902msgstr "Serbest bir Yer İşareti ayarla" 13903 13904#: lazarusidestrconsts.lismenushowexecutionpoint 13905msgid "S&how Execution Point" 13906msgstr "&Yürütme Noktasını göster" 13907 13908#: lazarusidestrconsts.lismenushowsmarthint 13909msgid "Context sensitive smart hint" 13910msgstr "İçerik duyarlı akıllı ipucu" 13911 13912#: lazarusidestrconsts.lismenusortselection 13913msgid "Sort Selection ..." 13914msgstr "Seçimi Sırala ..." 13915 13916#: lazarusidestrconsts.lismenusource 13917msgid "S&ource" 13918msgstr "Ka&ynak" 13919 13920#: lazarusidestrconsts.lismenustepinto 13921msgid "Step In&to" 13922msgstr "İçeri a&dım" 13923 13924#: lazarusidestrconsts.lismenustepintocontext 13925msgid "Step Into (Context)" 13926msgstr "İçeri Gir (Bağlam)" 13927 13928#: lazarusidestrconsts.lismenustepintoinstr 13929msgctxt "lazarusidestrconsts.lismenustepintoinstr" 13930msgid "Step Into Instruction" 13931msgstr "Öğretim adım" 13932 13933#: lazarusidestrconsts.lismenustepintoinstrhint 13934msgctxt "lazarusidestrconsts.lismenustepintoinstrhint" 13935msgid "Step Into Instruction" 13936msgstr "Öğretim adım" 13937 13938#: lazarusidestrconsts.lismenustepout 13939msgid "Step O&ut" 13940msgstr "Dışarı &çıkmak" 13941 13942#: lazarusidestrconsts.lismenustepover 13943msgid "&Step Over" 13944msgstr "&Adım atmak" 13945 13946#: lazarusidestrconsts.lismenustepovercontext 13947msgid "Step Over (Context)" 13948msgstr "Aşama (Bağlam)" 13949 13950#: lazarusidestrconsts.lismenustepoverinstr 13951msgctxt "lazarusidestrconsts.lismenustepoverinstr" 13952msgid "Step Over Instruction" 13953msgstr "Öğretim Aşırı Adım" 13954 13955#: lazarusidestrconsts.lismenustepoverinstrhint 13956msgctxt "lazarusidestrconsts.lismenustepoverinstrhint" 13957msgid "Step Over Instruction" 13958msgstr "Öğretim Aşırı Adım" 13959 13960#: lazarusidestrconsts.lismenusteptocursor 13961msgctxt "lazarusidestrconsts.lismenusteptocursor" 13962msgid "Step over to &Cursor" 13963msgstr "" 13964 13965#: lazarusidestrconsts.lismenuswapcaseselection 13966msgid "Swap Case in Selection" 13967msgstr "Seçimde Takas Yap" 13968 13969#: lazarusidestrconsts.lismenutabstospacesselection 13970msgid "Tabs to Spaces in Selection" 13971msgstr "Seçimdeki Boşluklara Sekmeler" 13972 13973#: lazarusidestrconsts.lismenutemplateabout 13974msgctxt "lazarusidestrconsts.lismenutemplateabout" 13975msgid "About" 13976msgstr "Hakkında" 13977 13978#: lazarusidestrconsts.lismenutogglecomment 13979msgid "Toggle Comment in Selection" 13980msgstr "Seçilen Yorumu Değiştir" 13981 13982#: lazarusidestrconsts.lismenutools 13983msgid "&Tools" 13984msgstr "&Araçlar" 13985 13986#: lazarusidestrconsts.lismenuuncommentselection 13987msgid "Uncomment Selection" 13988msgstr "Seçimi Kaldır" 13989 13990#: lazarusidestrconsts.lismenuunindentselection 13991msgid "Unindent Selection" 13992msgstr "Devam Eden Seçim" 13993 13994#: lazarusidestrconsts.lismenuuppercaseselection 13995msgid "Uppercase Selection" 13996msgstr "Büyük Harf Seçimi" 13997 13998#: lazarusidestrconsts.lismenuuseunit 13999msgid "Add Unit to Uses Section ..." 14000msgstr "Birimi Uses e Ekle..." 14001 14002#: lazarusidestrconsts.lismenuview 14003msgid "&View" 14004msgstr "&Görünüm" 14005 14006#: lazarusidestrconsts.lismenuviewanchoreditor 14007msgid "Anchor Editor" 14008msgstr "Çapa Editör" 14009 14010#: lazarusidestrconsts.lismenuviewassembler 14011msgctxt "lazarusidestrconsts.lismenuviewassembler" 14012msgid "Assembler" 14013msgstr "Assembler" 14014 14015#: lazarusidestrconsts.lismenuviewbreakpoints 14016msgid "BreakPoints" 14017msgstr "Kırılma noktaları" 14018 14019#: lazarusidestrconsts.lismenuviewcallstack 14020msgid "Call Stack" 14021msgstr "Çağrı yığını" 14022 14023#: lazarusidestrconsts.lismenuviewcodebrowser 14024msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" 14025msgid "Code Browser" 14026msgstr "Kod Tarayıcı" 14027 14028#: lazarusidestrconsts.lismenuviewcodeexplorer 14029msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" 14030msgid "Code Explorer" 14031msgstr "Kod Explorer" 14032 14033#: lazarusidestrconsts.lismenuviewcomponentpalette 14034msgid "Component Palette" 14035msgstr "Bileşen Paleti" 14036 14037#: lazarusidestrconsts.lismenuviewcomponents 14038msgid "&Components" 14039msgstr "&Bileşenler" 14040 14041#: lazarusidestrconsts.lismenuviewdebugevents 14042msgctxt "lazarusidestrconsts.lismenuviewdebugevents" 14043msgid "Event Log" 14044msgstr "Olay günlüğü" 14045 14046#: lazarusidestrconsts.lismenuviewdebugoutput 14047msgid "Debug Output" 14048msgstr "Çıktıyı Hata Ayıkla" 14049 14050#: lazarusidestrconsts.lismenuviewforms 14051msgid "Forms ..." 14052msgstr "Formlar..." 14053 14054#: lazarusidestrconsts.lismenuviewhistory 14055msgctxt "lazarusidestrconsts.lismenuviewhistory" 14056msgid "History" 14057msgstr "Geçmiş" 14058 14059#: lazarusidestrconsts.lismenuviewjumphistory 14060msgctxt "lazarusidestrconsts.lismenuviewjumphistory" 14061msgid "Jump History" 14062msgstr "Geçmişe atla" 14063 14064#: lazarusidestrconsts.lismenuviewlocalvariables 14065msgctxt "lazarusidestrconsts.lismenuviewlocalvariables" 14066msgid "Local Variables" 14067msgstr "Yerel değişkenler" 14068 14069#: lazarusidestrconsts.lismenuviewmessages 14070msgctxt "lazarusidestrconsts.lismenuviewmessages" 14071msgid "Messages" 14072msgstr "Mesajlar" 14073 14074#: lazarusidestrconsts.lismenuviewobjectinspector 14075msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" 14076msgid "Object Inspector" 14077msgstr "Nesne(Bileşen) Özellikleri" 14078 14079#: lazarusidestrconsts.lismenuviewprojectsource 14080msgid "&View Project Source" 14081msgstr "&Projenin Kaynaklarını Görüntüle" 14082 14083#: lazarusidestrconsts.lismenuviewpseudoterminal 14084msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal" 14085msgid "Console In/Output" 14086msgstr "Terminal giriş/çıkışı" 14087 14088#: lazarusidestrconsts.lismenuviewregisters 14089msgctxt "lazarusidestrconsts.lismenuviewregisters" 14090msgid "Registers" 14091msgstr "Kayıtlar" 14092 14093#: lazarusidestrconsts.lismenuviewrestrictionbrowser 14094msgid "Restriction Browser" 14095msgstr "Kısıtlama Tarayıcısı" 14096 14097#: lazarusidestrconsts.lismenuviewsearchresults 14098msgid "Search Results" 14099msgstr "Arama sonuçları" 14100 14101#: lazarusidestrconsts.lismenuviewsourceeditor 14102msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" 14103msgid "Source Editor" 14104msgstr "Kaynak Düzenleyici" 14105 14106#: lazarusidestrconsts.lismenuviewtaborder 14107msgid "Tab Order" 14108msgstr "Sekme Sırası" 14109 14110#: lazarusidestrconsts.lismenuviewthreads 14111msgctxt "lazarusidestrconsts.lismenuviewthreads" 14112msgid "Threads" 14113msgstr "Konular" 14114 14115#: lazarusidestrconsts.lismenuviewtoggleformunit 14116msgid "Toggle Form/Unit View" 14117msgstr "Form/Birim Görüntüle" 14118 14119#: lazarusidestrconsts.lismenuviewunitdependencies 14120msgctxt "lazarusidestrconsts.lismenuviewunitdependencies" 14121msgid "Unit Dependencies" 14122msgstr "Birim Bağımlılıkları" 14123 14124#: lazarusidestrconsts.lismenuviewunitinfo 14125msgid "Unit Information ..." 14126msgstr "Birim Bilgisi ..." 14127 14128#: lazarusidestrconsts.lismenuviewunits 14129msgid "Units ..." 14130msgstr "Birimler ..." 14131 14132#: lazarusidestrconsts.lismenuviewwatches 14133msgctxt "lazarusidestrconsts.lismenuviewwatches" 14134msgid "Watches" 14135msgstr "İzlemeler" 14136 14137#: lazarusidestrconsts.lismenuwhatneedsbuilding 14138msgid "What Needs Building" 14139msgstr "Nelere İhtiyacı Var" 14140 14141#: lazarusidestrconsts.lismenuwindow 14142msgid "&Window" 14143msgstr "&Pencere" 14144 14145#: lazarusidestrconsts.lismeother 14146msgid "Other tabs" 14147msgstr "Diğer sekmeler" 14148 14149#: lazarusidestrconsts.lismeprojects 14150msgid "Projects" 14151msgstr "Projeler" 14152 14153#: lazarusidestrconsts.lismessageseditor 14154msgid "Messages Editor" 14155msgstr "Mesajlar Editörü" 14156 14157#: lazarusidestrconsts.lismessageswindow 14158msgid "Messages Window" 14159msgstr "Mesajlar Penceresi" 14160 14161#: lazarusidestrconsts.lismethodclassnotfound 14162msgid "Method class not found" 14163msgstr "Yöntem sınıfı bulunamadı" 14164 14165#: lazarusidestrconsts.lismissingdirectory 14166#, object-pascal-format 14167msgid "missing directory \"%s\"" 14168msgstr "eksik dizin \"%s\"" 14169 14170#: lazarusidestrconsts.lismissingevents 14171msgid "Missing Events" 14172msgstr "Eksik Etkinlikler" 14173 14174#: lazarusidestrconsts.lismissingexecutable 14175#, object-pascal-format 14176msgid "missing executable \"%s\"" 14177msgstr "eksik çalıştırılabilir \"%s\"" 14178 14179#: lazarusidestrconsts.lismissingidentifiers 14180msgid "Missing identifiers" 14181msgstr "Eksik tanımlayıcılar" 14182 14183#: lazarusidestrconsts.lismissingpackages 14184msgid "Missing Packages" 14185msgstr "Eksik Paketler" 14186 14187#: lazarusidestrconsts.lismissingunitschoices 14188msgid "Your choices are:" 14189msgstr "Seçimleriniz şunlar:" 14190 14191#: lazarusidestrconsts.lismissingunitscomment 14192msgid "Comment Out" 14193msgstr "Yorum Yap" 14194 14195#: lazarusidestrconsts.lismissingunitsfordelphi 14196msgid "For Delphi only" 14197msgstr "Sadece Delphi için" 14198 14199#: lazarusidestrconsts.lismissingunitsinfo1 14200msgid "1) Comment out the selected units." 14201msgstr "1) Seçilen birimleri yorumlayın." 14202 14203#: lazarusidestrconsts.lismissingunitsinfo1b 14204msgid "1) Use the units only for Delphi." 14205msgstr "1) Birimleri yalnızca Delphi için kullanın." 14206 14207#: lazarusidestrconsts.lismissingunitsinfo2 14208msgid "2) Search for units. Found paths are added to project settings." 14209msgstr "2) Birimleri arayın. Bulunan yollar proje ayarlarına eklenir." 14210 14211#: lazarusidestrconsts.lismissingunitsinfo3 14212msgid "3) Abort now, install packages or fix paths and try again." 14213msgstr "3) Şimdi iptal edin, paketler yükleyin veya yolları düzeltin ve tekrar deneyin." 14214 14215#: lazarusidestrconsts.lismissingunitssearch 14216msgid "Search Unit Path" 14217msgstr "Birim Yolunu Ara" 14218 14219#: lazarusidestrconsts.lismissingunitsskip 14220msgid "Skip this Unit" 14221msgstr "Bu Birimi Atla" 14222 14223#: lazarusidestrconsts.lismitnotice 14224msgid "" 14225"<description>\n" 14226"\n" 14227"Copyright (c) <year> <copyright holders>\n" 14228"\n" 14229"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" 14230"\n" 14231"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" 14232"\n" 14233"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." 14234msgstr "" 14235"<description>\n" 14236"\n" 14237"Copyright (c) <year> <copyright holders>\n" 14238"\n" 14239"Bu yazılımın ve ilgili dokümantasyon dosyalarının (\"Yazılım\") bir kopyasını alan herhangi bir kişiye, Yazılım'da herhangi bir kısıtlama olmaksızın, kullanım, kopyalama, değiştirme, birleştirme haklarını sınırlandırma olmaksızın da dahil olmak üzere, ücretsiz olarak izin verilir. Yazılımın bir kopyasını yayınlamak, dağıtmak, alt lisans vermek ve / veya satmak ve Yazılımın bu belgeyi sağladığı kişilerin, aşağıdaki koşullara tabi olarak kullanımına izin vermek:\n" 14240"\n" 14241"Yukarıdaki telif hakkı bildirimi ve bu izin bildirimi, Yazılımın tüm kopyalarına veya önemli bölümlerine dahil edilecektir.\n" 14242"\n" 14243"YAZILIM, TİCARİ AMAÇ VE ZIMNİ GİDERME GARANTİSİNE SINIRLANMAMIŞTIR, HİÇBİR GARANTİ, AÇIK veya UYGULANMADI, HERHANGİ BİR TÜR GARANTİ VERMEMEKTEDİR. ETKİLİ OLMAYAN YETKİLİ VEYA TELİF SAHİPLİ TUTUCULAR, SÖZLEŞME, TOR VEYA DİĞER SORUMLULUK, YANLIŞTAN VEYA KULLANIMDAN DOĞRU, TOR VEYA DİĞER BİRLİKTE HİÇBİR ZARAR VEYA DİĞER SORUMLULUK YAZILIM." 14244 14245#: lazarusidestrconsts.lismmadditionsandoverrides 14246msgid "Additions and Overrides" 14247msgstr "İlaveler ve Geçersiz Kılmalar" 14248 14249#: lazarusidestrconsts.lismmaddscustomoptions 14250msgid "Adds custom options:" 14251msgstr "Özel seçenekler ekler:" 14252 14253#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag 14254msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" 14255msgstr "Keyfi fpc seçeneklerini ekleyin, örneğin -O1 -ghtl -dFlag" 14256 14257#: lazarusidestrconsts.lismmapplytoallpackages 14258msgid "Apply to all packages." 14259msgstr "Tüm paketlere uygula." 14260 14261#: lazarusidestrconsts.lismmapplytoallpackagesandprojects 14262msgid "Apply to all packages and projects." 14263msgstr "Tüm paketlere ve projelere uygula." 14264 14265#: lazarusidestrconsts.lismmapplytoallpackagesmatching 14266#, object-pascal-format 14267msgid "Apply to all packages matching name \"%s\"" 14268msgstr "\"%s\" adıyla eşleşen tüm paketlere uygula" 14269 14270#: lazarusidestrconsts.lismmapplytoproject 14271msgid "Apply to project." 14272msgstr "Projeye uygula." 14273 14274#: lazarusidestrconsts.lismmcreateanewgroupofoptions 14275msgid "Create a new group of options" 14276msgstr "Yeni bir grup grubu oluşturun" 14277 14278#: lazarusidestrconsts.lismmcustomoption 14279msgid "Custom Option" 14280msgstr "Özel Seçenek" 14281 14282#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption 14283msgid "Delete the selected target or option" 14284msgstr "Seçilen hedefi veya seçeneği sil" 14285 14286#: lazarusidestrconsts.lismmdoesnotaddcustomoptions 14287msgid "Does not add custom options:" 14288msgstr "Özel seçenek eklemez:" 14289 14290#: lazarusidestrconsts.lismmdoesnothaveidemacro 14291#, object-pascal-format 14292msgid "Does not have IDE Macro %s:=%s" 14293msgstr "IDE Macro %s yok: = %s" 14294 14295#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu 14296msgid "Does not override OutDir (-FU)" 14297msgstr "OutDir (-FU) öğesini geçersiz kılmaz" 14298 14299#: lazarusidestrconsts.lismmexcludeallpackagesmatching 14300#, object-pascal-format 14301msgid "Exclude all packages matching name \"%s\"" 14302msgstr "\"%s\" adıyla eşleşen tüm paketleri hariç tut" 14303 14304#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound 14305#, object-pascal-format 14306msgid "expected \":=\" after macro name but found \"%s\"" 14307msgstr "makro adından sonra beklenen \": =\" ancak \"%s\" bulundu" 14308 14309#: lazarusidestrconsts.lismmexpectedmacronamebutfound 14310#, object-pascal-format 14311msgid "expected macro name but found \"%s\"" 14312msgstr "beklenen makro adı, ancak \"%s\" bulundu" 14313 14314#: lazarusidestrconsts.lismmfromto 14315#, object-pascal-format 14316msgid "From %s to %s" 14317msgstr "%s den %s ye" 14318 14319#: lazarusidestrconsts.lismmidemacro 14320msgid "IDE Macro" 14321msgstr "IDE Makro" 14322 14323#: lazarusidestrconsts.lismmidemacro2 14324#, object-pascal-format 14325msgid "IDE Macro %s:=%s" 14326msgstr "IDE Makro %s: = %s" 14327 14328#: lazarusidestrconsts.lismminvalidcharacterat 14329#, object-pascal-format 14330msgid "invalid character \"%s\" at %s" 14331msgstr "geçersiz karakter \"%s\" %s" 14332 14333#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue 14334#, object-pascal-format 14335msgid "invalid character in macro value \"%s\"" 14336msgstr "makro değerindeki geçersiz karakter \"%s\"" 14337 14338#: lazarusidestrconsts.lismmmissingmacroname 14339msgid "missing macro name" 14340msgstr "makro adı eksik" 14341 14342#: lazarusidestrconsts.lismmmoveselecteditemdown 14343msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown" 14344msgid "Move selected item down" 14345msgstr "Seçili öğeyi aşağı taşı" 14346 14347#: lazarusidestrconsts.lismmmoveselecteditemup 14348msgctxt "lazarusidestrconsts.lismmmoveselecteditemup" 14349msgid "Move selected item up" 14350msgstr "Seçili öğeyi yukarı taşı" 14351 14352#: lazarusidestrconsts.lismmnewtarget 14353msgid "New Target" 14354msgstr "Yeni Hedef" 14355 14356#: lazarusidestrconsts.lismmoverrideoutdirfu 14357#, object-pascal-format 14358msgid "Override OutDir (-FU): %s" 14359msgstr "OutDir'i geçersiz kıl (-FU): %s" 14360 14361#: lazarusidestrconsts.lismmoverrideoutputdirectory 14362msgid "Override output directory (-FU)" 14363msgstr "Çıkış dizinini geçersiz kıl (-FU)" 14364 14365#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget 14366msgid "Override output directory -FU of target" 14367msgstr "Çıkış dizinini geçersiz kıl -HB hedefi" 14368 14369#: lazarusidestrconsts.lismmredolastundotothisgrid 14370msgid "Redo last undo to this grid" 14371msgstr "Bu ızgaraya en son geri al" 14372 14373#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32 14374msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32" 14375msgstr "Bir IDE makrosu ayarlayın, ör. LCLWidgetType: = win32" 14376 14377#: lazarusidestrconsts.lismmsets 14378#, object-pascal-format 14379msgid "Set \"%s\"" 14380msgstr "\"%s\" Ayarla" 14381 14382#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml 14383msgid "Stored in IDE (environmentoptions.xml)" 14384msgstr "Depolanmış IDE (environmentoptions.xml)" 14385 14386#: lazarusidestrconsts.lismmstoredinprojectlpi 14387msgid "Stored in project (.lpi)" 14388msgstr "Projede sakla (.lpi)" 14389 14390#: lazarusidestrconsts.lismmstoredinsessionofprojectlps 14391msgid "Stored in session of project (.lps)" 14392msgstr "Proje oturumunda (.lps) saklanır" 14393 14394#: lazarusidestrconsts.lismmtargets 14395msgid "Targets: " 14396msgstr "Hedefler: " 14397 14398#: lazarusidestrconsts.lismmundolastchangetothisgrid 14399msgid "Undo last change to this grid" 14400msgstr "Bu ızgaraya son değişikliği geri al" 14401 14402#: lazarusidestrconsts.lismmusesystemencoding 14403msgid "Use system encoding" 14404msgstr "Sistem kodlamasını kullan" 14405 14406#: lazarusidestrconsts.lismmusesystemencodinghint 14407msgid "Disable support for UTF-8 default string encoding." 14408msgstr "UTF-8 varsayılan dizge kodlamasının desteğini devre dışı bırak." 14409 14410#: lazarusidestrconsts.lismmvalues 14411#, object-pascal-format 14412msgid "Value \"%s\"" 14413msgstr "Değer \"%s\"" 14414 14415#: lazarusidestrconsts.lismmwas 14416#, object-pascal-format 14417msgid "(was \"%s\")" 14418msgstr "(\"%s\" idi)" 14419 14420#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject 14421msgid "WidgetSet change is available only for LCL projects" 14422msgstr "WidgetSet değişikliği yalnızca LCL projeleri için kullanılabilir" 14423 14424#: lazarusidestrconsts.lismode 14425#, object-pascal-format 14426msgid ", Mode: %s" 14427msgstr ", Mod: %s" 14428 14429#: lazarusidestrconsts.lismodifiedlgplnotice 14430msgid "" 14431"<description>\n" 14432"\n" 14433"Copyright (C) <year> <name of author> <contact>\n" 14434"\n" 14435"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" 14436"\n" 14437"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" 14438"\n" 14439"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 14440"\n" 14441"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 14442msgstr "" 14443"<description> \n" 14444"\n" 14445"Telif Hakkı (C) <yıl> <yazarın adı> <contact> \n" 14446"\n" 14447"Bu kütüphane ücretsiz bir yazılımdır; Özgür Yazılım Vakfı tarafından yayınlanan GNU Kütüphane Genel Kamu Lisansı koşulları altında yeniden dağıtabilir ve / veya değiştirebilirsiniz; ya Lisansın 2. sürümü ya da (isteğe bağlı olarak) aşağıdaki değişiklikle: \n" 14448" \n" 14449"Özel bir istisna olarak, bu kütüphanenin telif hakkı sahipleri, bu bağımsız modüllerin lisans koşullarından bağımsız olarak bir çalıştırılabilir dosya üretmek için bu kitaplığı bağımsız modüllerle bağlamanıza ve elde ettiğiniz yürütülebilir dosyayı seçtiğiniz şartlar altında kopyalayıp dağıtmanıza izin verir. Her bir bağımsız modül için, o modülün lisansının şart ve koşullarını da yerine getirmeniz şartıyla, bağımsız bir modül, bu kütüphaneden türetilmeyen veya bu kütüphaneden türetilmeyen bir modüldür. Bu istisna, kütüphane sürümünüz için geçerlidir, fakat bunu yapmak zorunda değilsiniz. Bunu yapmak istemiyorsanız, bu istisna bildirimini sürümünüzden silin. \n" 14450" \n" 14451"Bu program faydalı olacağı umuduyla dağıtılmıştır, ancak HİÇBİR GARANTİ YOKTUR; HİÇBİR AMAÇLI GARANTİ veya FITNESS zımni garantisi olmadan. Daha fazla bilgi için GNU Kütüphanesi Genel Kamu Lisansına bakın. \n" 14452"\n" 14453"GNU Kütüphanesi Genel Kamu Lisansının bir kopyasını bu kütüphane ile birlikte almış olmalısınız; olmasa da, Özgür Yazılım Vakfı, Inc.'e, 51 Franklin Street - Beşinci Kat, Boston, MA 02110-1335, ABD'ye yazmalısınız." 14454 14455#: lazarusidestrconsts.lismodify 14456msgid "&Modify" 14457msgstr "&Değiştir" 14458 14459#: lazarusidestrconsts.lismore 14460msgctxt "lazarusidestrconsts.lismore" 14461msgid "More" 14462msgstr "Daha fazla" 14463 14464#: lazarusidestrconsts.lismoresub 14465msgctxt "lazarusidestrconsts.lismoresub" 14466msgid "More" 14467msgstr "Daha fazla" 14468 14469#: lazarusidestrconsts.lismove 14470msgid "Move" 14471msgstr "Taşı" 14472 14473#: lazarusidestrconsts.lismovedown 14474msgid "Move Down" 14475msgstr "Aşağı taşı" 14476 14477#: lazarusidestrconsts.lismovefiles 14478msgid "Move Files" 14479msgstr "Dosyaları Taşı" 14480 14481#: lazarusidestrconsts.lismovefiles2 14482msgid "Move files?" 14483msgstr "Dosyaları taşı?" 14484 14485#: lazarusidestrconsts.lismovefilesfromtothedirectoryof 14486#, object-pascal-format 14487msgid "Move %s file(s) from %s to the directory%s%s%sof %s?" 14488msgstr "%s dosyaları, %s klasöründen %s%s%s %s klasörüne taşısın mı?" 14489 14490#: lazarusidestrconsts.lismoveonepositiondown 14491#, object-pascal-format 14492msgid "Move \"%s\" one position down" 14493msgstr "\"%s\" bir konum aşağı taşı" 14494 14495#: lazarusidestrconsts.lismoveonepositionup 14496#, object-pascal-format 14497msgid "Move \"%s\" one position up" 14498msgstr "\"%s\" bir konum yukarı taşı" 14499 14500#: lazarusidestrconsts.lismoveorcopyfiles 14501msgid "Move or Copy files?" 14502msgstr "Dosyaları Taşı veya Kopyala?" 14503 14504#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage 14505#, object-pascal-format 14506msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?" 14507msgstr "%s %s dosyalarını %s dizininden %s%s%s dizine taşı ya da kopyala.?" 14508 14509#: lazarusidestrconsts.lismovepage 14510msgid "Move Page" 14511msgstr "Sayfayı Taşı" 14512 14513#: lazarusidestrconsts.lismoveselecteddown 14514msgid "Move selected item down (Ctrl+Down)" 14515msgstr "Seçili öğeyi aşağıya taşı (Ctrl + Aşağı)" 14516 14517#: lazarusidestrconsts.lismoveselectedup 14518msgid "Move selected item up (Ctrl+Up)" 14519msgstr "Seçili öğeyi yukarı taşı (Ctrl + Yukarı)" 14520 14521#: lazarusidestrconsts.lismoveto 14522msgid "Move to: " 14523msgstr "Taşı : " 14524 14525#: lazarusidestrconsts.lismoveup 14526msgid "Move Up" 14527msgstr "Yukarı Taşı" 14528 14529#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa 14530msgid "Moving these units will break their uses sections. See Messages window for details." 14531msgstr "Bu birimlerin taşınması kullanım alanlarını kıracaktır. Ayrıntılar için Mesajlar penceresine bakın." 14532 14533#: lazarusidestrconsts.lismpcstyle 14534msgid "C style: \" => \\\"" 14535msgstr "C sitili: \" => \\\"" 14536 14537#: lazarusidestrconsts.lismpescapequotes 14538msgid "Escape "es" 14539msgstr "Çıkış tırnakları" 14540 14541#: lazarusidestrconsts.lismpmultipaste 14542msgctxt "lazarusidestrconsts.lismpmultipaste" 14543msgid "MultiPaste" 14544msgstr "Çoklu Yapıştır" 14545 14546#: lazarusidestrconsts.lismppascalstyle 14547msgid "Pascal style: ' => ''" 14548msgstr "Pascal Tarzı: ' => ''" 14549 14550#: lazarusidestrconsts.lismppasteoptions 14551msgid "Paste &options" 14552msgstr "Yapıştırma &seçenekleri" 14553 14554#: lazarusidestrconsts.lismppreview 14555msgid "&Preview" 14556msgstr "&Önizleme" 14557 14558#: lazarusidestrconsts.lismptextaftereachline 14559msgid "Text &after each line" 14560msgstr "Metin ve &her satırdan sonra" 14561 14562#: lazarusidestrconsts.lismptextbeforeeachline 14563msgid "Text &before each line" 14564msgstr "&Metin ve her satırdan önce" 14565 14566#: lazarusidestrconsts.lismptrimclipboardcontents 14567msgid "&Trim clipboard contents" 14568msgstr "&Pano içeriğini kırp" 14569 14570#: lazarusidestrconsts.lisms 14571msgid "(ms)" 14572msgstr "(ms)" 14573 14574#: lazarusidestrconsts.lismsgcolors 14575msgid "Message colors" 14576msgstr "Mesaj renkleri" 14577 14578#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons 14579msgid "Multiple directories are separated with semicolons" 14580msgstr "Birden çok dizin noktalı virgül ile ayrılır" 14581 14582#: lazarusidestrconsts.lismultiplepack 14583msgid ", multiple packages: " 14584msgstr ", Birden çok paket: " 14585 14586#: lazarusidestrconsts.lismvsavemessagestofiletxt 14587msgid "Save messages to file (*.txt)" 14588msgstr "Mesajları dosyaya kaydet (*.txt)" 14589 14590#: lazarusidestrconsts.lisname 14591msgctxt "lazarusidestrconsts.lisname" 14592msgid "Name" 14593msgstr "Ad" 14594 14595#: lazarusidestrconsts.lisnameconflict 14596msgid "Name conflict" 14597msgstr "İsim çakışması" 14598 14599#: lazarusidestrconsts.lisnameofactivebuildmode 14600msgid "Name of active build mode" 14601msgstr "Etkin yapı modunun adı" 14602 14603#: lazarusidestrconsts.lisnameofnewprocedure 14604msgid "Name of new procedure" 14605msgstr "Yeni prosedürün adı" 14606 14607#: lazarusidestrconsts.lisnever 14608msgctxt "lazarusidestrconsts.lisnever" 14609msgid "Never" 14610msgstr "Asla" 14611 14612#: lazarusidestrconsts.lisnew 14613msgid "New" 14614msgstr "Yeni" 14615 14616#: lazarusidestrconsts.lisnewclass 14617msgid "New Class" 14618msgstr "Yeni Sınıf" 14619 14620#: lazarusidestrconsts.lisnewconsoleapplication 14621msgid "New console application" 14622msgstr "Yeni konsol uygulaması" 14623 14624#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype 14625#, object-pascal-format 14626msgid "Create a new editor file.%sChoose a type." 14627msgstr "Yeni bir editör dosyası oluşturun.%sBir tür seçin." 14628 14629#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile 14630msgid "Create a new empty text file." 14631msgstr "Yeni bir boş metin dosyası oluştur." 14632 14633#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype 14634#, object-pascal-format 14635msgid "Create a new project.%sChoose a type." 14636msgstr "Yeni bir proje oluşturun.%sBir tür seçin." 14637 14638#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun 14639#, object-pascal-format 14640msgid "Create a new standard package.%sA package is a collection of units and components." 14641msgstr "Yeni bir standart paket oluşturun.%s Paket, birimler ve bileşenler koleksiyonudur." 14642 14643#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule 14644msgid "Create a new unit with a datamodule." 14645msgstr "Veri modülüyle yeni bir birim oluşturun." 14646 14647#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe 14648msgid "Create a new unit with a frame." 14649msgstr "Çerçeveli yeni bir birim oluşturun." 14650 14651#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform 14652msgid "Create a new unit with a LCL form." 14653msgstr "LCL formuyla yeni bir birim oluşturun." 14654 14655#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent 14656msgid "Inherit from a project form or component" 14657msgstr "Bir proje formundan veya bileşenden devralın" 14658 14659#: lazarusidestrconsts.lisnewdlgnoitemselected 14660msgid "No item selected" 14661msgstr "Hiçbir öğe seçilmedi" 14662 14663#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst 14664msgid "Please select an item first." 14665msgstr "Lütfen önce bir öğe seçin." 14666 14667#: lazarusidestrconsts.lisnewencoding 14668msgid "New encoding:" 14669msgstr "Yeni kodlama:" 14670 14671#: lazarusidestrconsts.lisnewmacroname 14672#, object-pascal-format 14673msgid "Macro %d" 14674msgstr "Makro %d" 14675 14676#: lazarusidestrconsts.lisnewmacroname2 14677msgid "New Macroname" 14678msgstr "Yeni Macroname" 14679 14680#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting 14681msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order." 14682msgstr "Bu sınıfın mevcut yöntemleri arasına yeni yöntem uygulamaları eklenir. Alfabetik olarak ya da en son ya da beyan sırasına göre." 14683 14684#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd 14685msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last." 14686msgstr "Sınıftaki yeni yöntem ve üye bildirimleri ... son bölümler alfabetik olarak eklenir veya en son eklenir." 14687 14688#: lazarusidestrconsts.lisnewpage 14689msgid "New page" 14690msgstr "Yeni sayfa" 14691 14692#: lazarusidestrconsts.lisnewproject 14693msgid "(new project)" 14694msgstr "(yeni proje)" 14695 14696#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved 14697msgid "New recorded macros. Not to be saved" 14698msgstr "Yeni kaydedilen makrolar, kaydedilmeyecek" 14699 14700#: lazarusidestrconsts.lisnewunitsareaddedtousessections 14701msgid "New units are added to uses sections" 14702msgstr "Uses bölümüne yeni birimler eklenirken" 14703 14704#: lazarusidestrconsts.lisno 14705msgid "No" 14706msgstr "Hayır" 14707 14708#: lazarusidestrconsts.lisnoautosaveactivedesktop 14709msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually." 14710msgstr "'Etkin masaüstünü otomatik kaydet' seçeneği kapalı, mevcut masaüstünü manuel olarak kaydetmeniz gerekecek." 14711 14712#: lazarusidestrconsts.lisnobackupfiles 14713msgid "No backup files" 14714msgstr "Yedekleme yapma" 14715 14716#: lazarusidestrconsts.lisnobuildprofilesselected 14717msgid "No profiles are selected to be built." 14718msgstr "Oluşturulacak profil seçilmedi." 14719 14720#: lazarusidestrconsts.lisnochange 14721msgid "No change" 14722msgstr "Değişiklik yok" 14723 14724#: lazarusidestrconsts.lisnocodeselected 14725msgid "No code selected" 14726msgstr "Kod seçilmedi" 14727 14728#: lazarusidestrconsts.lisnocompileroptionsinherited 14729msgid "No compiler options inherited." 14730msgstr "Herhangi bir derleyici seçeneği devralınmadı." 14731 14732#: lazarusidestrconsts.lisnofppkgprefix 14733msgid "empty Free Pascal compiler prefix." 14734msgstr "boş Free Pascal derleyici öneki." 14735 14736#: lazarusidestrconsts.lisnohints 14737msgid "no hints" 14738msgstr "ipucu yok" 14739 14740#: lazarusidestrconsts.lisnoidewindowselected 14741msgid "No IDE window selected" 14742msgstr "IDE penceresi seçilmedi" 14743 14744#: lazarusidestrconsts.lisnolfmfile 14745msgid "No LFM file" 14746msgstr "LFM dosyası değil" 14747 14748#: lazarusidestrconsts.lisnomacroselected 14749msgid "No macro selected" 14750msgstr "Makro seçilmedi" 14751 14752#: lazarusidestrconsts.lisnomessageselected 14753msgid "(no message selected)" 14754msgstr "(Mesaj seçilmedi)" 14755 14756#: lazarusidestrconsts.lisnoname 14757msgid "noname" 14758msgstr "isimsiz" 14759 14760#: lazarusidestrconsts.lisnone 14761#, object-pascal-format 14762msgid "%snone" 14763msgstr "%syok" 14764 14765#: lazarusidestrconsts.lisnoneclicktochooseone 14766msgid "none, click to choose one" 14767msgstr "hiçbiri, birini seçmek için tıkla" 14768 14769#: lazarusidestrconsts.lisnoneselected 14770msgid "(None selected)" 14771msgstr "(Hiçbiri seçilmedi)" 14772 14773#: lazarusidestrconsts.lisnonodeselected 14774msgid "no node selected" 14775msgstr "hiçbir düğüm seçilmedi" 14776 14777#: lazarusidestrconsts.lisnopascalfile 14778msgid "No Pascal file" 14779msgstr "Pascal dosyası yok" 14780 14781#: lazarusidestrconsts.lisnoprogramfilesfound 14782#, object-pascal-format 14783msgid "No program file \"%s\" found." 14784msgstr "\"%s\" program dosyası bulunamadı." 14785 14786#: lazarusidestrconsts.lisnoresourcestringsectionfound 14787msgid "No ResourceString Section found" 14788msgstr "ResourceString Bölümü bulunamadı" 14789 14790#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta 14791msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" 14792msgstr "Normalde filtre normal bir ifadedir. Basit sözdiziminde a. normal bir karakter, a * bir şeyin kısaltmasıdır, a? herhangi bir karakteri temsil eder ve virgül ve noktalı virgül alternatifleri ayırır. Örneğin: Basit sözdizimi * .pas; *. Pp ^(.*\\.pas|.*\\.pp)$" 14793 14794#: lazarusidestrconsts.lisnostringconstantfound 14795msgid "No string constant found" 14796msgstr "Srtring sabiti bulunamadı" 14797 14798#: lazarusidestrconsts.lisnotadesigntimepackage 14799msgid "Not a designtime package" 14800msgstr "Tasarım zamanı paketi değil" 14801 14802#: lazarusidestrconsts.lisnotaninstallpackage 14803msgid "Not an install package" 14804msgstr "Yükleme paketi değil" 14805 14806#: lazarusidestrconsts.lisnotavalidfppkgprefix 14807msgid "Free Pascal compiler not found at the given prefix." 14808msgstr "Free Pascal derleyicisi verilen önekte bulunamadı." 14809 14810#: lazarusidestrconsts.lisnotavalidpascalidentifier 14811msgid "Not a valid Pascal identifier" 14812msgstr "Geçerli bir Pascal tanımlayıcı değil" 14813 14814#: lazarusidestrconsts.lisnote 14815msgctxt "lazarusidestrconsts.lisnote" 14816msgid "Note" 14817msgstr "Not" 14818 14819#: lazarusidestrconsts.lisnotebooktabposbottom 14820msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" 14821msgid "Bottom" 14822msgstr "Alt" 14823 14824#: lazarusidestrconsts.lisnotebooktabposleft 14825msgctxt "lazarusidestrconsts.lisnotebooktabposleft" 14826msgid "Left" 14827msgstr "Sol" 14828 14829#: lazarusidestrconsts.lisnotebooktabposright 14830msgctxt "lazarusidestrconsts.lisnotebooktabposright" 14831msgid "Right" 14832msgstr "Sağ" 14833 14834#: lazarusidestrconsts.lisnotebooktabpostop 14835msgctxt "lazarusidestrconsts.lisnotebooktabpostop" 14836msgid "Top" 14837msgstr "Üst" 14838 14839#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal 14840msgid "NOTE: Could not create Define Template for Free Pascal Sources" 14841msgstr "NOT: Free Pascal Kaynakları için Şablon Tanımlama Oluşturulamadı" 14842 14843#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources 14844msgid "NOTE: Could not create Define Template for Lazarus Sources" 14845msgstr "NOT: Lazarus Kaynakları için Şablon Tanımlama Oluşturulamadı" 14846 14847#: lazarusidestrconsts.lisnotemplateselected 14848msgid "no template selected" 14849msgstr "şablon seçilmedi" 14850 14851#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated 14852#, object-pascal-format 14853msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated." 14854msgstr "%s satırında %s satırında %s sütununda bulunamadı.%s%s Mesaj güncelliğini yitirebilir." 14855 14856#: lazarusidestrconsts.lisnotimplemented 14857msgid "Not implemented" 14858msgstr "Uygulanmadı" 14859 14860#: lazarusidestrconsts.lisnotimplementedyet 14861#, object-pascal-format 14862msgid "Not implemented yet:%s%s" 14863msgstr "Henüz uygulanmadı: %s %s" 14864 14865#: lazarusidestrconsts.lisnotinstalled 14866msgid "not installed" 14867msgstr "yüklü değil" 14868 14869#: lazarusidestrconsts.lisnotinstalledpackages 14870msgid "Not installed packages" 14871msgstr "Paketler Yüklenmemiş" 14872 14873#: lazarusidestrconsts.lisnotnow 14874msgid "Not now" 14875msgstr "Şimdi değil" 14876 14877#: lazarusidestrconsts.lisnowloadedscheme 14878msgid "Now loaded: " 14879msgstr "Şimdi yüklendi: " 14880 14881#: lazarusidestrconsts.lisnpcreate 14882msgid "Create" 14883msgstr "Oluştur" 14884 14885#: lazarusidestrconsts.lisnpcreateanewproject 14886msgid "Create a new project" 14887msgstr "Yeni bir proje oluştur" 14888 14889#: lazarusidestrconsts.lisnumberoffilestoconvert 14890#, object-pascal-format 14891msgid "Number of files to convert: %s" 14892msgstr "Dönüştürülecek dosya sayısı: %s" 14893 14894#: lazarusidestrconsts.lisobjectinspectorbecomesvisible 14895msgid "Object Inspector becomes visible when components are selected in designer." 14896msgstr "Nesne Denetçisi, tasarımcılarda bileşenler seçildiğinde görünür hale gelir." 14897 14898#: lazarusidestrconsts.lisobjectpascaldefault 14899msgid "Object Pascal - default" 14900msgstr "Object Pascal - varsayılan" 14901 14902#: lazarusidestrconsts.lisobjectpath 14903msgid "object path" 14904msgstr "nesne yolu" 14905 14906#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab 14907msgid "Switch to Object Inspector Favorites tab" 14908msgstr "Nesne Denetleyicisi Sık Kullanılanları sekmesine geç" 14909 14910#: lazarusidestrconsts.lisoff 14911msgid "? (Off)" 14912msgstr "? (Kapat)" 14913 14914#: lazarusidestrconsts.lisofpackage 14915#, object-pascal-format 14916msgid " of package %s" 14917msgstr " %s paketinin" 14918 14919#: lazarusidestrconsts.lisoftheprojectinspector 14920msgid " of the Project Inspector" 14921msgstr " Proje denetleyicisinin" 14922 14923#: lazarusidestrconsts.lisoifaddtofavoriteproperties 14924msgid "Add to favorite properties" 14925msgstr "Favori özelliklere ekle" 14926 14927#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty 14928#, object-pascal-format 14929msgid "Choose a base class for the favorite property \"%s\"." 14930msgstr "Favori özellik \"%s\" için bir temel sınıf seçin." 14931 14932#: lazarusidestrconsts.lisoifclassnotfound 14933#, object-pascal-format 14934msgid "Class \"%s\" not found." 14935msgstr "Sınıf \"%s\" bulunamadı." 14936 14937#: lazarusidestrconsts.lisoifremovefromfavoriteproperties 14938msgid "Remove from favorite properties" 14939msgstr "Favori özelliklerden kaldır" 14940 14941#: lazarusidestrconsts.lisoipautoinstalldynamic 14942msgid "auto install dynamic" 14943msgstr "otomatik yükle dinamik" 14944 14945#: lazarusidestrconsts.lisoipautoinstallstatic 14946msgid "auto install static" 14947msgstr "otomatik yükle statik" 14948 14949#: lazarusidestrconsts.lisoipdescription 14950msgid "Description: " 14951msgstr "Açıklama: " 14952 14953#: lazarusidestrconsts.lisoipdescriptiondescription 14954#, object-pascal-format 14955msgid "%sDescription: %s" 14956msgstr "%sAçıklama: %s" 14957 14958#: lazarusidestrconsts.lisoipfilename 14959#, object-pascal-format 14960msgid "Filename: %s" 14961msgstr "Dosya adı: %s" 14962 14963#: lazarusidestrconsts.lisoipinstalleddynamic 14964msgid "installed dynamic" 14965msgstr "kurulu dinamik" 14966 14967#: lazarusidestrconsts.lisoipinstalledstatic 14968msgid "installed static" 14969msgstr "kurulu statik" 14970 14971#: lazarusidestrconsts.lisoiplicenselicense 14972#, object-pascal-format 14973msgid "%sLicense: %s" 14974msgstr "%sLisans: %s" 14975 14976#: lazarusidestrconsts.lisoipmissing 14977msgid "missing" 14978msgstr "eksik" 14979 14980#: lazarusidestrconsts.lisoipmodified 14981msgid "modified" 14982msgstr "değiştirilmiş" 14983 14984#: lazarusidestrconsts.lisoipopenloadedpackage 14985msgid "Open Loaded Package" 14986msgstr "Yüklü Paketi Aç" 14987 14988#: lazarusidestrconsts.lisoippackagename 14989msgid "Package Name" 14990msgstr "Paket ismi" 14991 14992#: lazarusidestrconsts.lisoippleaseselectapackage 14993msgid "Please select a package" 14994msgstr "Lütfen bir paket seçin" 14995 14996#: lazarusidestrconsts.lisoipreadonly 14997msgid "readonly" 14998msgstr "sadece okunur" 14999 15000#: lazarusidestrconsts.lisoipstate 15001msgctxt "lazarusidestrconsts.lisoipstate" 15002msgid "State" 15003msgstr "Durum" 15004 15005#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound 15006#, object-pascal-format 15007msgid "%sThis package is installed but the lpk file was not found" 15008msgstr "%s Bu paket kuruldu, ancak lpk dosyası bulunamadı" 15009 15010#: lazarusidestrconsts.lisok 15011msgid "OK" 15012msgstr "TAMAM" 15013 15014#: lazarusidestrconsts.lisoldclass 15015msgid "Old Class" 15016msgstr "Eski sınıf" 15017 15018#: lazarusidestrconsts.lison 15019msgid "? (On)" 15020msgstr "?(Aç)" 15021 15022#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey 15023msgid "On break line (i.e. return or enter key)" 15024msgstr "Kesme çizgisinde (örn. Dönüş veya enter tuşu)" 15025 15026#: lazarusidestrconsts.lisonlinepackage 15027msgid "available in the main repository" 15028msgstr "ana depoda mevcut" 15029 15030#: lazarusidestrconsts.lisonly32bit 15031msgid "only 32bit" 15032msgstr "sadece 32bit" 15033 15034#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden 15035msgid "Only available on Windows. Run the tool hidden." 15036msgstr "Sadece Windows'ta kullanılabilir.Gizli aracı çalıştır." 15037 15038#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole 15039msgid "Only available on Windows. Run tool in a new console." 15040msgstr "Sadece Windows'ta kullanılabilir. Aracı yeni bir konsolda çalıştır." 15041 15042#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression 15043msgid "Only messages fitting this regular expression:" 15044msgstr "Sadece bu normal ifadeye uyan mesajlar:" 15045 15046#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated 15047msgid "Only messages with these FPC IDs (comma separated):" 15048msgstr "Yalnızca bu FPC kimliklerine sahip olan iletiler (virgülle ayrılmış):" 15049 15050#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild 15051msgid "Only register the Lazarus package files (.lpk). Do not build." 15052msgstr "Sadece Lazarus paket dosyalarını (.lpk) kaydedin. İnşa etmeyin." 15053 15054#: lazarusidestrconsts.lisonlysearchforwholewords 15055msgid "Only search for whole words" 15056msgstr "Yalnızca tüm kelimeleri ara" 15057 15058#: lazarusidestrconsts.lisonpastefromclipboard 15059msgid "On paste from clipboard" 15060msgstr "Panodan yapıştır" 15061 15062#: lazarusidestrconsts.lisopen 15063msgid "Open" 15064msgstr "Aç" 15065 15066#: lazarusidestrconsts.lisopenasxmlfile 15067msgid "Open as XML file" 15068msgstr "XML dosyası olarak aç" 15069 15070#: lazarusidestrconsts.lisopendesigneronopenunit 15071msgid "Open designer on open unit" 15072msgstr "Açık ünitede açık tasarımcı" 15073 15074#: lazarusidestrconsts.lisopendesigneronopenunithint 15075msgid "Form is loaded in designer always when source unit is opened." 15076msgstr "Form her zaman kaynak birimi açıldığında tasarımcıya yüklenir." 15077 15078#: lazarusidestrconsts.lisopenexistingfile 15079msgid "Open existing file" 15080msgstr "Varolan dosyayı aç" 15081 15082#: lazarusidestrconsts.lisopenfile 15083msgid "Open File" 15084msgstr "Dosyayı Aç" 15085 15086#: lazarusidestrconsts.lisopenfile2 15087msgid "Open file" 15088msgstr "Dosyayı Aç" 15089 15090#: lazarusidestrconsts.lisopenfileatcursor 15091msgid "Open file at cursor" 15092msgstr "İmleçteki dosyayı aç" 15093 15094#: lazarusidestrconsts.lisopeninfileman 15095msgid "Open in file manager" 15096msgstr "Dosya yöneticisini aç" 15097 15098#: lazarusidestrconsts.lisopeninfilemanhint 15099msgid "Open destination directory in file manager" 15100msgstr "Hedef dizini dosya yöneticisinde aç" 15101 15102#: lazarusidestrconsts.lisopenlfm 15103#, object-pascal-format 15104msgid "Open %s" 15105msgstr "%s aç" 15106 15107#: lazarusidestrconsts.lisopenpackage 15108msgid "Open Package?" 15109msgstr "Paket Açılsın mı?" 15110 15111#: lazarusidestrconsts.lisopenpackage2 15112#, object-pascal-format 15113msgid "Open package %s" 15114msgstr "Paketi Aç %s" 15115 15116#: lazarusidestrconsts.lisopenpackagefile 15117msgid "Open Package File" 15118msgstr "Paket Dosyasını Aç" 15119 15120#: lazarusidestrconsts.lisopenproject 15121msgid "Open Project?" 15122msgstr "Proje Açılsın mı?" 15123 15124#: lazarusidestrconsts.lisopenproject2 15125msgid "Open project" 15126msgstr "Projeyi Aç" 15127 15128#: lazarusidestrconsts.lisopenprojectagain 15129msgid "Open project again" 15130msgstr "Projeyi tekrar Aç" 15131 15132#: lazarusidestrconsts.lisopenprojectfile 15133msgid "Open Project File" 15134msgstr "Proje Dosyasını Aç" 15135 15136#: lazarusidestrconsts.lisopensymlink 15137msgid "Open symlink" 15138msgstr "Sembolik bağı aç" 15139 15140#: lazarusidestrconsts.lisopentarget 15141msgid "Open target" 15142msgstr "Hedefi Aç" 15143 15144#: lazarusidestrconsts.lisopenthefileasnormalsource 15145msgid "Open the file as normal source" 15146msgstr "Dosyayı normal kaynak olarak aç" 15147 15148#: lazarusidestrconsts.lisopenthepackage 15149#, object-pascal-format 15150msgid "Open the package %s?" 15151msgstr "%s paketi açılsın mı?" 15152 15153#: lazarusidestrconsts.lisopentheproject 15154#, object-pascal-format 15155msgid "Open the project %s?" 15156msgstr "%s projesi açılsın mı?" 15157 15158#: lazarusidestrconsts.lisopentooloptions 15159msgid "Open Tool Options" 15160msgstr "Araç Seçeneklerini Aç" 15161 15162#: lazarusidestrconsts.lisopenunit 15163msgid "Open Unit" 15164msgstr "Birim Aç" 15165 15166#: lazarusidestrconsts.lisopenurl 15167msgid "Open URL" 15168msgstr "URL Aç" 15169 15170#: lazarusidestrconsts.lisopenxml 15171msgid "Open XML" 15172msgstr "XML Aç" 15173 15174#: lazarusidestrconsts.lisoptions 15175msgctxt "lazarusidestrconsts.lisoptions" 15176msgid "Options" 15177msgstr "Seçenekler" 15178 15179#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb 15180msgid "Options changed, recompiling clean with -B" 15181msgstr "Seçenekler değişti, -B ile temiz yeniden derlendi" 15182 15183#: lazarusidestrconsts.lisoptionvalueignored 15184msgid "ignored" 15185msgstr "yoksay" 15186 15187#: lazarusidestrconsts.lisor 15188msgid "or" 15189msgstr "veya" 15190 15191#: lazarusidestrconsts.lisos 15192#, object-pascal-format 15193msgid ", OS: %s" 15194msgstr ", OS: %s" 15195 15196#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa 15197#, object-pascal-format 15198msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path." 15199msgstr "\"%s\" paketinin diğer kaynaklar yolu, zaten birim arama yolunda bulunan \"%s\" dizinini içeriyor." 15200 15201#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource 15202#, object-pascal-format 15203msgid "output directory of %s contains Pascal unit source \"%s\"" 15204msgstr "%s çıktı dizini \"%s\" Pascal birim kaynağını içeriyor" 15205 15206#: lazarusidestrconsts.lisoutputfilenameofproject 15207msgid "Output filename of project" 15208msgstr "Projenin çıktı dosya adı" 15209 15210#: lazarusidestrconsts.lisoverridelanguage 15211msgid "Override language. For example --language=de. For possible values see files in the languages directory." 15212msgstr "Dili geçersiz kıl. Örneğin --language = de. Olası değerler için dil dizinindeki dosyalara bakınız." 15213 15214#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype 15215msgid "Override function result string types with the first parameter expression type" 15216msgstr "İlk parametre ifadesi türüyle işlev sonuç dizesi türlerini geçersiz kıl" 15217 15218#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd 15219#, object-pascal-format 15220msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" 15221msgstr "%s varsayılan derleyiciyi geçersiz kılar. Örneğin ppc386 ppcx64 ppcppc vb. Varsayılan ortamda depolanı environmentoptions.xml" 15222 15223#: lazarusidestrconsts.lisoverridetheprojectbuildmode 15224#, object-pascal-format 15225msgid "%soverride the project or IDE build mode." 15226msgstr "%s proje veya IDE derleme modunu geçersiz kılar." 15227 15228#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 15229#, object-pascal-format 15230msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" 15231msgstr "%s proje işlemcisini geçersiz kılar. Örneğin. i386 x86_64 powerpc powerpc_64 vb varsayılan:%s" 15232 15233#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau 15234#, object-pascal-format 15235msgid "%soverride the project operating system. e.g. win32 linux. default: %s" 15236msgstr "%s proje işletim sistemini geçersiz kıl.örneğin win32 linux varsayılan: %s" 15237 15238#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond 15239#, object-pascal-format 15240msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" 15241msgstr "%s proje pencere setini geçersiz kılar. Örneğin. gtk gtk2 qt win32 karbon. varsayılan:%s" 15242 15243#: lazarusidestrconsts.lisoverwritefile 15244msgid "Overwrite file?" 15245msgstr "Dosyanın üzerine yazılsın mı?" 15246 15247#: lazarusidestrconsts.lisoverwritefileondisk 15248msgid "Overwrite file on disk" 15249msgstr "Diskdeki dosya üzerine yaz" 15250 15251#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot 15252msgid "'Owner' is already used by TReader/TWriter. Please choose another name." 15253msgstr "'Sahibi' zaten TReader / TWriter tarafından kullanılıyor, lütfen başka bir ad seçin." 15254 15255#: lazarusidestrconsts.lispackage 15256msgid "Package" 15257msgstr "Paket" 15258 15259#: lazarusidestrconsts.lispackage2 15260#, object-pascal-format 15261msgid "package %s" 15262msgstr "paket %s" 15263 15264#: lazarusidestrconsts.lispackage3 15265#, object-pascal-format 15266msgid ", package %s" 15267msgstr ", paket %s" 15268 15269#: lazarusidestrconsts.lispackageinfo 15270msgid "Package info" 15271msgstr "Paket bilgisi" 15272 15273#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint 15274#, object-pascal-format 15275msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages." 15276msgstr "\"%s\" paketi sadece tasarım zamanıdır, bu yüzden proje ayarları ile değil sadece IDE'de derlenmelidir.%s Lütfen IDE paketlerini oluşturmak için \"Yükle\" veya \"Araçlar/Lazarus Derle\" yi kullanın." 15277 15278#: lazarusidestrconsts.lispackagenamebeginswith 15279msgid "Package name begins with ..." 15280msgstr "Paket adı ile başlar ..." 15281 15282#: lazarusidestrconsts.lispackagenamecontains 15283msgid "Package name contains ..." 15284msgstr "Paket adı içeriyor ..." 15285 15286#: lazarusidestrconsts.lispackageneedsanoutputdirectory 15287msgid "Package needs an output directory." 15288msgstr "Paket bir çıkış dizinine ihtiyaç duyar." 15289 15290#: lazarusidestrconsts.lispackageneedsinstallation 15291msgid "Package needs installation" 15292msgstr "Paketin kurulum ihtiyacı var" 15293 15294#: lazarusidestrconsts.lispackageoption 15295#, object-pascal-format 15296msgid "Package \"%s\" Option" 15297msgstr "Paket \"%s\" Seçenekleri" 15298 15299#: lazarusidestrconsts.lispackageoutputdirectories 15300msgid "Package output directories" 15301msgstr "Paket çıktı dizinleri" 15302 15303#: lazarusidestrconsts.lispackagesourcedirectories 15304msgid "Package source directories" 15305msgstr "Paket kaynak dizinleri" 15306 15307#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes 15308#, object-pascal-format 15309msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s" 15310msgstr "paketler=%s/%s birimler=%s/%s tanımlayıcılar=%s/%s satırlar=%s baytlar=%s" 15311 15312#: lazarusidestrconsts.lispackageunit 15313msgid "package unit" 15314msgstr "paket birimi" 15315 15316#: lazarusidestrconsts.lispage 15317msgctxt "lazarusidestrconsts.lispage" 15318msgid "Page" 15319msgstr "Sayfa" 15320 15321#: lazarusidestrconsts.lispagename 15322msgid "Page name" 15323msgstr "Sayfa adı" 15324 15325#: lazarusidestrconsts.lispagenamealreadyexists 15326#, object-pascal-format 15327msgid "Page name \"%s\" already exists. Not added." 15328msgstr "Sayfa adı \"%s\" zaten var, eklenmedi." 15329 15330#: lazarusidestrconsts.lispanic 15331msgctxt "lazarusidestrconsts.lispanic" 15332msgid "Panic" 15333msgstr "Panik" 15334 15335#: lazarusidestrconsts.lisparsed 15336msgid ", parsed " 15337msgstr ", ayrıştırılmış " 15338 15339#: lazarusidestrconsts.lisparser 15340#, object-pascal-format 15341msgid "parser \"%s\": %s" 15342msgstr "ayrıştırıcı \"%s\": %s" 15343 15344#: lazarusidestrconsts.lisparsers 15345msgid "Parsers:" 15346msgstr "Ayrıştırma:" 15347 15348#: lazarusidestrconsts.lispasscount 15349msgid "Pass Count" 15350msgstr "Geçiş Sayısı" 15351 15352#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues 15353#, object-pascal-format 15354msgid "passing compiler define \"%s\" twice with different values" 15355msgstr "derleyiciyi geçerek \"%s\" tanımını farklı değerlerle iki kez tanımlayın" 15356 15357#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues 15358#, object-pascal-format 15359msgid "passing compiler option -%s twice with different values" 15360msgstr "derleyici seçeneğinin geçilmesi - farklı değerlerle iki kez %s" 15361 15362#: lazarusidestrconsts.lispaste 15363msgctxt "lazarusidestrconsts.lispaste" 15364msgid "Paste" 15365msgstr "Yapıştır" 15366 15367#: lazarusidestrconsts.lispasteclipboard 15368msgid "paste clipboard" 15369msgstr "panoya yapıştır" 15370 15371#: lazarusidestrconsts.lispastefromclipboard 15372msgid "Paste from clipboard." 15373msgstr "Panodan yapıştır." 15374 15375#: lazarusidestrconsts.lispastelcolors 15376msgid "Pastel Colors" 15377msgstr "Pastel renkler" 15378 15379#: lazarusidestrconsts.lispath 15380msgid "Path" 15381msgstr "Yol" 15382 15383#: lazarusidestrconsts.lispatheditbrowse 15384msgctxt "lazarusidestrconsts.lispatheditbrowse" 15385msgid "Browse" 15386msgstr "Gözat" 15387 15388#: lazarusidestrconsts.lispatheditdeleteinvalidpaths 15389msgid "Delete Invalid Paths" 15390msgstr "Geçersiz Yolları Sil" 15391 15392#: lazarusidestrconsts.lispatheditmovepathdown 15393msgid "Move path down (Ctrl+Down)" 15394msgstr "Yolu aşağı taşı (Ctrl + Aşağı)" 15395 15396#: lazarusidestrconsts.lispatheditmovepathup 15397msgid "Move path up (Ctrl+Up)" 15398msgstr "Yolu yukarı taşı (Ctrl + Yukarı)" 15399 15400#: lazarusidestrconsts.lispatheditoraddhint 15401msgid "Add new path to the list" 15402msgstr "Listeye yeni yol ekle" 15403 15404#: lazarusidestrconsts.lispatheditordeletehint 15405msgid "Delete the selected path" 15406msgstr "Seçili yolu sil" 15407 15408#: lazarusidestrconsts.lispatheditordeleteinvalidhint 15409msgid "Remove non-existent (gray) paths from the list" 15410msgstr "Varolmayan (gri) yolları listeden kaldır" 15411 15412#: lazarusidestrconsts.lispatheditorreplacehint 15413msgid "Replace the selected path with a new path" 15414msgstr "Seçili yolu yeni bir yolla değiştir" 15415 15416#: lazarusidestrconsts.lispatheditortempladdhint 15417msgid "Add template to the list" 15418msgstr "Listeye şablon ekle" 15419 15420#: lazarusidestrconsts.lispatheditpathtemplates 15421msgid "Path templates" 15422msgstr "Yol şablonları" 15423 15424#: lazarusidestrconsts.lispatheditsearchpaths 15425msgid "Search paths:" 15426msgstr "Arama yolları:" 15427 15428#: lazarusidestrconsts.lispathisnodirectory 15429msgid "is not a directory" 15430msgstr "bir dizin değil" 15431 15432#: lazarusidestrconsts.lispathoftheinstantfpccache 15433msgid "path of the instantfpc cache" 15434msgstr "anlık önbellek yolunun yolu" 15435 15436#: lazarusidestrconsts.lispathofthemakeutility 15437msgid "Path of the make utility" 15438msgstr "Make programının yolu" 15439 15440#: lazarusidestrconsts.lispathtoinstance 15441msgid "Path to failed Instance:" 15442msgstr "Başarısız Örnek için Yol:" 15443 15444#: lazarusidestrconsts.lispause 15445msgid "Pause" 15446msgstr "Duraklat" 15447 15448#: lazarusidestrconsts.lispckcleartousethepackagename 15449msgid "Clear to use the package name" 15450msgstr "Paket adını kullanmak için temizle" 15451 15452#: lazarusidestrconsts.lispckdisablei18noflfm 15453msgid "Disable I18N of lfm" 15454msgstr "Lfm'in I18N'sini devre dışı bırak" 15455 15456#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem 15457msgid "Add Files from File System" 15458msgstr "Dosyaları Dosya Sisteminden Ekle" 15459 15460#: lazarusidestrconsts.lispckeditaddotheritems 15461msgid "Add other items" 15462msgstr "Diğer öğeleri ekle" 15463 15464#: lazarusidestrconsts.lispckeditaddtoproject 15465msgid "Add to Project" 15466msgstr "Projeye Ekle" 15467 15468#: lazarusidestrconsts.lispckeditapplychanges 15469msgid "Apply changes" 15470msgstr "Değişiklikleri uygula" 15471 15472#: lazarusidestrconsts.lispckeditavailableonline 15473msgid "(available online)" 15474msgstr "(mevcut çevrimiçi)" 15475 15476#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit 15477#, object-pascal-format 15478msgid "Call %sRegister%s procedure of selected unit" 15479msgstr "Seçilen ünitenin %sRegister%s prosedürünü çağır" 15480 15481#: lazarusidestrconsts.lispckeditcheckavailabilityonline 15482msgid "Check availability online" 15483msgstr "" 15484 15485#: lazarusidestrconsts.lispckeditcleanupdependencies 15486msgid "Clean up dependencies ..." 15487msgstr "Bağımlılıkları temizle ..." 15488 15489#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency 15490msgid "Clear default/preferred filename of dependency" 15491msgstr "Varsayılan / tercih edilen dosya adı bağımlılığını temizle" 15492 15493#: lazarusidestrconsts.lispckeditcommonoptions 15494msgid "Common" 15495msgstr "Ortak" 15496 15497#: lazarusidestrconsts.lispckeditcompileeverything 15498msgid "Compile everything?" 15499msgstr "Komple derle?" 15500 15501#: lazarusidestrconsts.lispckeditcompilepackage 15502msgid "Compile package" 15503msgstr "Paketi Derle" 15504 15505#: lazarusidestrconsts.lispckeditcompileroptionsforpackage 15506#, object-pascal-format 15507msgid "Compiler Options for Package %s" 15508msgstr "Paket %s için Derleyici Seçenekleri" 15509 15510#: lazarusidestrconsts.lispckeditcreatefpmakefile 15511msgid "Create fpmake.pp" 15512msgstr "Fpmake.pp Oluştur" 15513 15514#: lazarusidestrconsts.lispckeditcreatemakefile 15515msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" 15516msgid "Create Makefile" 15517msgstr "Makefile Oluştur" 15518 15519#: lazarusidestrconsts.lispckeditdefault 15520#, object-pascal-format 15521msgid "%s, default: %s" 15522msgstr "%s, varsayılan: %s" 15523 15524#: lazarusidestrconsts.lispckeditdependencyproperties 15525msgid "Dependency Properties" 15526msgstr "Bağımlılık Özellikleri" 15527 15528#: lazarusidestrconsts.lispckediteditgeneraloptions 15529msgid "Edit general options" 15530msgstr "Genel seçenekleri düzenle" 15531 15532#: lazarusidestrconsts.lispckeditfileproperties 15533msgid "File Properties" 15534msgstr "Dosya Özellikleri" 15535 15536#: lazarusidestrconsts.lispckeditfpmakepackage 15537msgid "(fpmake)" 15538msgstr "(fpmake)" 15539 15540#: lazarusidestrconsts.lispckeditinstall 15541msgid "Install" 15542msgstr "Yükle" 15543 15544#: lazarusidestrconsts.lispckeditinvalidmaximumversion 15545msgid "Invalid maximum version" 15546msgstr "Geçersiz maksimum sürümü" 15547 15548#: lazarusidestrconsts.lispckeditinvalidminimumversion 15549msgid "Invalid minimum version" 15550msgstr "Geçersiz minimum sürüm" 15551 15552#: lazarusidestrconsts.lispckeditmaximumversion 15553msgid "Maximum Version:" 15554msgstr "Maksimum Sürüm:" 15555 15556#: lazarusidestrconsts.lispckeditminimumversion 15557msgid "Minimum Version:" 15558msgstr "Minimum Sürüm:" 15559 15560#: lazarusidestrconsts.lispckeditmodified 15561#, object-pascal-format 15562msgid "Modified: %s" 15563msgstr "Değiştirildi: %s" 15564 15565#: lazarusidestrconsts.lispckeditmovedependencydown 15566msgid "Move dependency down" 15567msgstr "Bağımlılığı aşağıya kaydır" 15568 15569#: lazarusidestrconsts.lispckeditmovedependencyup 15570msgid "Move dependency up" 15571msgstr "Bağımlılığı yukarı taşı" 15572 15573#: lazarusidestrconsts.lispckeditpackage 15574#, object-pascal-format 15575msgid "Package %s" 15576msgstr "Paket %s" 15577 15578#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage 15579#, object-pascal-format 15580msgid "Package \"%s\" has changed.%sSave package?" 15581msgstr "Paket \"%s\" değişti %sPaketi kaydet?" 15582 15583#: lazarusidestrconsts.lispckeditpackagenotsaved 15584#, object-pascal-format 15585msgid "package %s not saved" 15586msgstr "paket %s kaydedilmedi" 15587 15588#: lazarusidestrconsts.lispckeditpage 15589#, object-pascal-format 15590msgid "%s, Page: %s" 15591msgstr "%s, Sayfa: %s" 15592 15593#: lazarusidestrconsts.lispckeditreadddependency 15594msgid "Re-Add dependency" 15595msgstr "Yeniden bağımlılık ekle" 15596 15597#: lazarusidestrconsts.lispckeditreaddfile 15598msgid "Re-Add file" 15599msgstr "Dosyayı yeniden ekle" 15600 15601#: lazarusidestrconsts.lispckeditreadonly 15602#, object-pascal-format 15603msgid "Read Only: %s" 15604msgstr "Salt Okunur: %s" 15605 15606#: lazarusidestrconsts.lispckeditrecompileallrequired 15607msgid "Recompile All Required" 15608msgstr "Gerekli Tüm Yeniden Derle" 15609 15610#: lazarusidestrconsts.lispckeditrecompileclean 15611msgid "Recompile Clean" 15612msgstr "Temizle Yeniden Derle" 15613 15614#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages 15615msgid "Re-Compile this and all required packages?" 15616msgstr "Bu ve gereken tüm paketleri yeniden derleyin?" 15617 15618#: lazarusidestrconsts.lispckeditregisteredplugins 15619msgid "Registered plugins" 15620msgstr "Kayıtlı eklentiler" 15621 15622#: lazarusidestrconsts.lispckeditregisterunit 15623msgid "Register unit" 15624msgstr "Kayıt birimi" 15625 15626#: lazarusidestrconsts.lispckeditremovedependency 15627msgid "Remove dependency" 15628msgstr "Bağımlılığı kaldır" 15629 15630#: lazarusidestrconsts.lispckeditremovedependency2 15631msgid "Remove Dependency?" 15632msgstr "Bağımlılığı Kaldır?" 15633 15634#: lazarusidestrconsts.lispckeditremovedependencyfrompackage 15635#, object-pascal-format 15636msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" 15637msgstr "\"%s\" paketindeki \"%s\"%s bağımlılıkları kaldırılsın mı?" 15638 15639#: lazarusidestrconsts.lispckeditremovedfiles 15640msgid "Removed Files" 15641msgstr "Çıkarılan Dosyalar" 15642 15643#: lazarusidestrconsts.lispckeditremovedrequiredpackages 15644msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages" 15645msgid "Removed required packages" 15646msgstr "Gerekli paketler kaldırıldı" 15647 15648#: lazarusidestrconsts.lispckeditremovefile 15649msgid "Remove file" 15650msgstr "Dosyayı kaldır" 15651 15652#: lazarusidestrconsts.lispckeditremovefile2 15653msgid "Remove file?" 15654msgstr "Dosya kaldırılsın mı?" 15655 15656#: lazarusidestrconsts.lispckeditremovefilefrompackage 15657#, object-pascal-format 15658msgid "Remove file \"%s\"%sfrom package \"%s\"?" 15659msgstr "\"%s\"%s paketinden \"%s\" dosyası kaldırılsın mı?" 15660 15661#: lazarusidestrconsts.lispckeditremoveselecteditem 15662msgid "Remove selected item" 15663msgstr "Seçili öğeyi kaldır" 15664 15665#: lazarusidestrconsts.lispckeditrequiredpackages 15666msgid "Required Packages" 15667msgstr "Gerekli Paketler" 15668 15669#: lazarusidestrconsts.lispckeditsavepackage 15670msgid "Save Package" 15671msgstr "Paket Kaydet" 15672 15673#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency 15674msgid "Store file name as default for this dependency" 15675msgstr "Bu bağımlılık için dosya adı varsayılan olarak sakla" 15676 15677#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency 15678msgid "Store file name as preferred for this dependency" 15679msgstr "Bu bağımlılık için dosya adını tercih ettiğiniz gibi sakla" 15680 15681#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion 15682#, object-pascal-format 15683msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 15684msgstr "\"%s\" maksimum sürümü geçerli bir paket sürümü değil %s (iyi örnek 1.2.3.4)" 15685 15686#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion 15687#, object-pascal-format 15688msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 15689msgstr "\"%s\" minimum sürümü geçerli bir paket sürümü değil %s (iyi örnek 1.2.3.4)" 15690 15691#: lazarusidestrconsts.lispckedituninstall 15692msgid "Uninstall" 15693msgstr "Kaldır" 15694 15695#: lazarusidestrconsts.lispckeditviewpackagesource 15696msgid "View Package Source" 15697msgstr "Paket Kaynağını Görüntüle" 15698 15699#: lazarusidestrconsts.lispckexplbase 15700msgid "Base, cannot be uninstalled" 15701msgstr "Temel, kaldırılamaz" 15702 15703#: lazarusidestrconsts.lispckexplinstalled 15704msgctxt "lazarusidestrconsts.lispckexplinstalled" 15705msgid "Installed" 15706msgstr "Yüklü" 15707 15708#: lazarusidestrconsts.lispckexplinstallonnextstart 15709msgid "Install on next start" 15710msgstr "Bir sonraki başlatmada yükle" 15711 15712#: lazarusidestrconsts.lispckexplstate 15713#, object-pascal-format 15714msgid "%sState: " 15715msgstr "%sDurum: " 15716 15717#: lazarusidestrconsts.lispckexpluninstallonnextstart 15718msgid "Uninstall on next start (unless needed by an installed package)" 15719msgstr "Bir sonraki başlatmada kaldır (kurulu pakete ihtiyaç duyulmadığı sürece)" 15720 15721#: lazarusidestrconsts.lispckexpluninstallpackage 15722#, object-pascal-format 15723msgid "Uninstall package %s" 15724msgstr "%s paketini kaldır" 15725 15726#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects 15727msgid "Add options to dependent packages and projects" 15728msgstr "Bağımlı paketlere ve projelere seçenek ekleme" 15729 15730#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects 15731msgid "Add paths to dependent packages/projects" 15732msgstr "Bağımlı paketlere / projelere yol ekle" 15733 15734#: lazarusidestrconsts.lispckoptsauthor 15735msgid "Author" 15736msgstr "Yazar" 15737 15738#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded 15739msgid "Automatically rebuild as needed" 15740msgstr "Gerektiği gibi otomatik olarak yeniden oluşturun" 15741 15742#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall 15743msgid "Auto rebuild when rebuilding all" 15744msgstr "Hepsini yeniden derlenirken otomatik derle" 15745 15746#: lazarusidestrconsts.lispckoptscustom 15747msgid "Custom" 15748msgstr "Özel" 15749 15750#: lazarusidestrconsts.lispckoptsdescriptionabstract 15751msgid "Description / Abstract" 15752msgstr "Açıklama / Özet" 15753 15754#: lazarusidestrconsts.lispckoptsdesigntime 15755msgid "Designtime" 15756msgstr "Tasarımzamanı" 15757 15758#: lazarusidestrconsts.lispckoptsdesigntimeandruntime 15759msgid "Designtime and runtime" 15760msgstr "Tasarımzamanı ve çalışma zamanı" 15761 15762#: lazarusidestrconsts.lispckoptsideintegration 15763msgid "IDE Integration" 15764msgstr "IDE Entegrasyonu" 15765 15766#: lazarusidestrconsts.lispckoptsinclude 15767msgid "Include" 15768msgstr "Dahil" 15769 15770#: lazarusidestrconsts.lispckoptsinvalidpackagetype 15771msgid "Invalid package type" 15772msgstr "Geçersiz paket türü" 15773 15774#: lazarusidestrconsts.lispckoptslibrary 15775msgid "Library" 15776msgstr "Kütüphane" 15777 15778#: lazarusidestrconsts.lispckoptslicense 15779msgid "License" 15780msgstr "Lisans" 15781 15782#: lazarusidestrconsts.lispckoptslinker 15783msgid "Linker" 15784msgstr "Bağlayıcı" 15785 15786#: lazarusidestrconsts.lispckoptsmajor 15787msgid "Major" 15788msgstr "Ana" 15789 15790#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically 15791msgid "Manual compilation (never automatically)" 15792msgstr "Manuel derleme (otomatik olarak asla)" 15793 15794#: lazarusidestrconsts.lispckoptsminor 15795msgid "Minor" 15796msgstr "En küçük" 15797 15798#: lazarusidestrconsts.lispckoptsobject 15799msgid "Object" 15800msgstr "Nesne" 15801 15802#: lazarusidestrconsts.lispckoptspackagefileoptions 15803msgid "Additional Package File Options" 15804msgstr "Ek Paket Dosya Seçenekleri" 15805 15806#: lazarusidestrconsts.lispckoptspackageoptions 15807msgid "Package Options" 15808msgstr "Paket Seçenekleri" 15809 15810#: lazarusidestrconsts.lispckoptspackagetype 15811msgid "Package type" 15812msgstr "Paket Tipi" 15813 15814#: lazarusidestrconsts.lispckoptsprovides 15815msgid "Provides" 15816msgstr "Sağlar" 15817 15818#: lazarusidestrconsts.lispckoptsrelease 15819msgid "Release" 15820msgstr "Serbest bırak" 15821 15822#: lazarusidestrconsts.lispckoptsruntime 15823msgid "Runtime" 15824msgstr "Çalışmazamanı" 15825 15826#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans 15827#, object-pascal-format 15828msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." 15829msgstr "Paket \"%s\"otomatik kurulum bayrağı var.%sBu, IDE'ye yükleneceği anlamına geliyor.%sKurulum paketleri designtime paketleri olmalı." 15830 15831#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages 15832msgid "This package provides the same as the following packages:" 15833msgstr "Bu pakette aşağıdaki paketler aynıdır:" 15834 15835#: lazarusidestrconsts.lispckoptsupdaterebuild 15836msgid "Update / Rebuild" 15837msgstr "Güncelle/Yeniden Oluştur" 15838 15839#: lazarusidestrconsts.lispckoptsusage 15840msgid "Usage" 15841msgstr "Kullanım" 15842 15843#: lazarusidestrconsts.lispckpackage 15844msgid "Package:" 15845msgstr "Paket:" 15846 15847#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa 15848msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon." 15849msgstr "Fpdoc xml dosyaları için arama yolları: Birden fazla yol, noktalı virgülle ayrılmış olmalıdır." 15850 15851#: lazarusidestrconsts.lispckshowunneededdependencies 15852msgid "Show unneeded dependencies" 15853msgstr "Gereksiz bağımlılıkları göster" 15854 15855#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring 15856msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked." 15857msgstr "Form kaydedildiğinde, IDE tüm TTranslateString özelliklerini paket po dosyasına kaydedebilir. Bunun için bu paket için I18N'yi etkinleştirmeniz, bir po çıktı dizini sağlamanız ve bu seçeneği işaretlemeden bırakmanız gerekir." 15858 15859#: lazarusidestrconsts.lispdabort 15860msgctxt "lazarusidestrconsts.lispdabort" 15861msgid "Abort" 15862msgstr "İptal" 15863 15864#: lazarusidestrconsts.lispdprogress 15865msgid "Progress" 15866msgstr "İlerleme" 15867 15868#: lazarusidestrconsts.lispecollapsedirectory 15869msgid "Collapse directory" 15870msgstr "Dizini daralt" 15871 15872#: lazarusidestrconsts.lispeconflictfound 15873msgid "Conflict found" 15874msgstr "Çakışma bulundu" 15875 15876#: lazarusidestrconsts.lispeeditvirtualunit 15877msgid "Edit Virtual Unit" 15878msgstr "Sanal Birimi Düzenle" 15879 15880#: lazarusidestrconsts.lispeexpanddirectory 15881msgid "Expand directory" 15882msgstr "Dizini genişlet" 15883 15884#: lazarusidestrconsts.lispefilename 15885msgid "Filename:" 15886msgstr "Dosya adı:" 15887 15888#: lazarusidestrconsts.lispefixfilescase 15889msgid "Fix Files Case" 15890msgstr "Dosyaları Düzelt" 15891 15892#: lazarusidestrconsts.lispeinvalidunitfilename 15893msgid "Invalid unit filename" 15894msgstr "Geçersiz birim dosya adı" 15895 15896#: lazarusidestrconsts.lispeinvalidunitname 15897msgid "Invalid unitname" 15898msgstr "Geçersiz birim adı" 15899 15900#: lazarusidestrconsts.lispemissingfilesofpackage 15901#, object-pascal-format 15902msgid "Missing files of package %s" 15903msgstr "%s paketinin eksik dosyaları" 15904 15905#: lazarusidestrconsts.lispendingon 15906msgid "Pending (On)" 15907msgstr "Bekleniyor (Açık)" 15908 15909#: lazarusidestrconsts.lispenewfilenotinincludepath 15910msgid "New file not in include path" 15911msgstr "Yeni dosya yolunda değil" 15912 15913#: lazarusidestrconsts.lispenofilesmissingallfilesexist 15914msgid "No files missing. All files exist." 15915msgstr "Eksik dosya yok. Tüm dosyalar var." 15916 15917#: lazarusidestrconsts.lisperemovefiles 15918msgid "Remove files" 15919msgstr "Dosyaları kaldır" 15920 15921#: lazarusidestrconsts.lisperevertpackage 15922msgid "Revert Package" 15923msgstr "Paketi geri al" 15924 15925#: lazarusidestrconsts.lispesavepackageas 15926msgid "Save Package As ..." 15927msgstr "Paketi Farklı Kaydet ..." 15928 15929#: lazarusidestrconsts.lispeshowdirectoryhierarchy 15930msgid "Show directory hierarchy" 15931msgstr "Dizin hiyerarşisini göster" 15932 15933#: lazarusidestrconsts.lispeshowmissingfiles 15934msgid "Show Missing Files" 15935msgstr "Eksik Dosyaları Göster" 15936 15937#: lazarusidestrconsts.lispesortfiles 15938msgid "Sort Files Permanently" 15939msgstr "Dosyaları Kalıcı Olarak Sırala" 15940 15941#: lazarusidestrconsts.lispesortfilesalphabetically 15942msgid "Sort files alphabetically" 15943msgstr "Dosyaları alfabetik olarak sırala" 15944 15945#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea 15946#, object-pascal-format 15947msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" 15948msgstr "\"%s\" dosyası şu anda paketin dahil etme yolunda değil.%s \"%s\" dahil et yolu eklensin mi?" 15949 15950#: lazarusidestrconsts.lispeunitname 15951msgid "Unitname:" 15952msgstr "Birimadı:" 15953 15954#: lazarusidestrconsts.lispeuseallunitsindirectory 15955msgid "Use all units in directory" 15956msgstr "Dizindeki tüm birimleri kullan" 15957 15958#: lazarusidestrconsts.lispeusenounitsindirectory 15959msgid "Use no units in directory" 15960msgstr "Dizinde hiçbir birim kullanma" 15961 15962#: lazarusidestrconsts.lispkgcleanuppackagedependencies 15963msgid "Clean up package dependencies" 15964msgstr "Paket bağımlılıklarını temizle" 15965 15966#: lazarusidestrconsts.lispkgclearselection 15967msgid "Clear Selection" 15968msgstr "Seçimi Temizle" 15969 15970#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition 15971msgid "CompiledSrcPath addition" 15972msgstr "CompiledSrcPath eklentisi" 15973 15974#: lazarusidestrconsts.lispkgdefsnamespaces 15975msgid "Namespaces" 15976msgstr "Alanadı" 15977 15978#: lazarusidestrconsts.lispkgdefsoutputdirectory 15979msgid "Output directory" 15980msgstr "Çıkış dizini" 15981 15982#: lazarusidestrconsts.lispkgdefssrcdirmark 15983msgid "Package Source Directory Mark" 15984msgstr "Paket Kaynak Dizini İşareti" 15985 15986#: lazarusidestrconsts.lispkgdefsunitpath 15987msgid "Unit Path" 15988msgstr "Birim Yolu" 15989 15990#: lazarusidestrconsts.lispkgdeletedependencies 15991msgid "Delete dependencies" 15992msgstr "Bağımlılıkları sil" 15993 15994#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand 15995#, object-pascal-format 15996msgid "Do you really want to forget all changes to package %s and reload it from file?" 15997msgstr "%s paketindeki tüm değişiklikleri yok saymak ve dosyayı yeniden yüklemek istiyor musunuz?" 15998 15999#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath 16000msgid "New unit not in unitpath" 16001msgstr "Yeni birim ünite yolunda değil" 16002 16003#: lazarusidestrconsts.lispkgeditpublishpackage 16004msgid "Publish Package" 16005msgstr "Paketi Yayınla" 16006 16007#: lazarusidestrconsts.lispkgeditrevertpackage 16008msgid "Revert package?" 16009msgstr "Paketi geri al?" 16010 16011#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage 16012#, object-pascal-format 16013msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?" 16014msgstr "\"%s\" %s dosyası şu anda paketin birim yolunda değil.%s \"%s\" birim yolu eklensin mi?" 16015 16016#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage 16017msgid "More functions for the package" 16018msgstr "Paket için daha fazla fonksiyon" 16019 16020#: lazarusidestrconsts.lispkgfiletypebinary 16021msgctxt "lazarusidestrconsts.lispkgfiletypebinary" 16022msgid "Binary" 16023msgstr "İkili" 16024 16025#: lazarusidestrconsts.lispkgfiletypeinclude 16026msgid "Include file" 16027msgstr "Dosyayı dahil et" 16028 16029#: lazarusidestrconsts.lispkgfiletypeissues 16030msgid "Issues xml file" 16031msgstr "Sorun xml dosyası" 16032 16033#: lazarusidestrconsts.lispkgfiletypelfm 16034msgid "LFM - Lazarus form text" 16035msgstr "LFM - Lazarus metin dosyası" 16036 16037#: lazarusidestrconsts.lispkgfiletypelrs 16038msgid "LRS - Lazarus resource" 16039msgstr "LRS - Lazarus kaynak dosyası" 16040 16041#: lazarusidestrconsts.lispkgfiletypemainunit 16042msgid "Main Unit" 16043msgstr "Ana Birim" 16044 16045#: lazarusidestrconsts.lispkgfiletypetext 16046msgctxt "lazarusidestrconsts.lispkgfiletypetext" 16047msgid "Text" 16048msgstr "Metin" 16049 16050#: lazarusidestrconsts.lispkgfiletypevirtualunit 16051msgid "Virtual Unit" 16052msgstr "Sanal Birim" 16053 16054#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid 16055msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16056msgstr "Paket dizini.Parametresi paket kimliğidir, örneğin \"İsim\" veya \"İsim 1.0\"" 16057 16058#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid 16059msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16060msgstr "Paket, dosya arama yolunu içerir. Parametre paket kimliğidir, örneğin \"İsim\" veya \"İsim 1.0\"" 16061 16062#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid 16063msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16064msgstr "Paket adı. Parametre paket kimliğidir, örneğin \"İsim\" veya \"İsim 1.0\"" 16065 16066#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid 16067msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16068msgstr "Paket çıkış dizini.Parametresi paket kimliğidir, örneğin \"İsim\" veya \"İsim 1.0\"\"" 16069 16070#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid 16071msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16072msgstr "Paket kaynağı arama yolu. Parametre paket kimliğidir, örneğin \" İsim\" veya \"İsim 1.0\"" 16073 16074#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid 16075msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16076msgstr "Paket birimi arama yolu. Parametre paket kimliğidir, örneğin \"İsim\" veya \"İsim 1.0\"" 16077 16078#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage 16079#, object-pascal-format 16080msgid "%sAdding new Dependency for package %s: package %s" 16081msgstr "%sPaket %s için yeni bağımlılık ekleme: paket %s" 16082 16083#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage 16084#, object-pascal-format 16085msgid "%sAdding new Dependency for project %s: package %s" 16086msgstr "%sProje %s için yeni Bağımlılık ekleme: paket %s" 16087 16088#: lazarusidestrconsts.lispkgmangaddunittousesclause 16089msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." 16090msgstr "Uses bölümüne paket ana dosyasının birim ekleyin. Bunu yalnızca her durumda derlenmemesi gereken birimler için devre dışı bırakın." 16091 16092#: lazarusidestrconsts.lispkgmangambiguousunitsfound 16093msgid "Ambiguous units found" 16094msgstr "Belirsiz birimler bulundu" 16095 16096#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages 16097msgid "Automatically installed packages" 16098msgstr "Otomatik olarak yüklenen paketler" 16099 16100#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu 16101#, object-pascal-format 16102msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." 16103msgstr "%sHer iki paket de bağlı. Bunun anlamı, bir paket diğerini kullanır veya her ikisi de üçüncü bir paket tarafından kullanılır." 16104 16105#: lazarusidestrconsts.lispkgmangbrokendependency 16106msgid "Broken dependency" 16107msgstr "Bozuk bağımlılık" 16108 16109#: lazarusidestrconsts.lispkgmangcirculardependencies 16110msgid "Circular dependencies found" 16111msgstr "Dairesel bağımlılıklar bulundu" 16112 16113#: lazarusidestrconsts.lispkgmangcompilepackage 16114#, object-pascal-format 16115msgid "Compile package %s" 16116msgstr "%s paketini derle" 16117 16118#: lazarusidestrconsts.lispkgmangdeletefailed 16119msgid "Delete failed" 16120msgstr "Silinemedi" 16121 16122#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile 16123msgid "Delete Old Package File?" 16124msgstr "Eski Paket Dosyasını Silsin mi?" 16125 16126#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 16127#, object-pascal-format 16128msgid "Delete old package file \"%s\"?" 16129msgstr "Eski paket dosyasını \"%s\" silinsin mi?" 16130 16131#: lazarusidestrconsts.lispkgmangdependencywithoutowner 16132#, object-pascal-format 16133msgid "Dependency without Owner: %s" 16134msgstr "Sahibi Olmayan Bağımlılık: %s" 16135 16136#: lazarusidestrconsts.lispkgmangerrorreadingfile 16137msgid "Error reading file" 16138msgstr "Dosya okunurken hata oluştu" 16139 16140#: lazarusidestrconsts.lispkgmangerrorreadingpackage 16141msgid "Error Reading Package" 16142msgstr "Paket Okuma Hatası" 16143 16144#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage 16145#, object-pascal-format 16146msgid "Error: updating po files failed for package %s" 16147msgstr "Hata: po dosyalarının güncellenmesi %s paketinde başarısız oldu" 16148 16149#: lazarusidestrconsts.lispkgmangerrorwritingfile 16150msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" 16151msgid "Error writing file" 16152msgstr "Dosya yazarken hata oluştu" 16153 16154#: lazarusidestrconsts.lispkgmangerrorwritingpackage 16155msgid "Error Writing Package" 16156msgstr "Paket Yazma Hatası" 16157 16158#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage 16159msgid "File is already in package" 16160msgstr "Dosya zaten pakette" 16161 16162#: lazarusidestrconsts.lispkgmangfileisinproject 16163msgid "File is in Project" 16164msgstr "Dosya Projede" 16165 16166#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename 16167msgid "Filename differs from Packagename" 16168msgstr "Dosya adı Packagename'den farklı" 16169 16170#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage 16171msgid "Filename is used by other package" 16172msgstr "Dosya adı başka bir paket tarafından kullanılıyor" 16173 16174#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject 16175msgid "Filename is used by project" 16176msgstr "Dosya adı proje tarafından kullanılıyor" 16177 16178#: lazarusidestrconsts.lispkgmangfilenotfound 16179#, object-pascal-format 16180msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" 16181msgid "File \"%s\" not found." 16182msgstr "Dosya \"%s\" bulunamadı." 16183 16184#: lazarusidestrconsts.lispkgmangfilenotsaved 16185msgid "File not saved" 16186msgstr "Dosya kaydedilmedi" 16187 16188#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac 16189#, object-pascal-format 16190msgid "Installing the package %s will automatically install the package:" 16191msgstr "%s paketinin kurulması otomatik olarak şu paketi yükleyecek:" 16192 16193#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 16194#, object-pascal-format 16195msgid "Installing the package %s will automatically install the packages:" 16196msgstr "%s paketinin kurulması otomatik olarak şu paketleri yükleyecek:" 16197 16198#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename 16199msgid "invalid Compiler filename" 16200msgstr "geçersiz Derleyici dosya adı" 16201 16202#: lazarusidestrconsts.lispkgmanginvalidfileextension 16203msgid "Invalid file extension" 16204msgstr "Geçersiz dosya uzantısı" 16205 16206#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension 16207msgid "Invalid package file extension" 16208msgstr "Geçersiz paket dosya uzantısı" 16209 16210#: lazarusidestrconsts.lispkgmanginvalidpackagefilename 16211msgid "Invalid package filename" 16212msgstr "Geçersiz paket dosya adı" 16213 16214#: lazarusidestrconsts.lispkgmanginvalidpackagename 16215msgid "Invalid package name" 16216msgstr "Geçersiz paket adı" 16217 16218#: lazarusidestrconsts.lispkgmanginvalidpackagename2 16219msgid "Invalid Package Name" 16220msgstr "Geçersiz Paket Adı" 16221 16222#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage 16223#, object-pascal-format 16224msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" 16225msgstr "%s dosyası yükleniyor, %s%s dosyası %s dosyasından olacak.%s eski paket değiştirildi.%s Eski paketi kaydetsin mi %s?" 16226 16227#: lazarusidestrconsts.lispkgmangpackage 16228#, object-pascal-format 16229msgid "Package: %s" 16230msgstr "Paket: %s" 16231 16232#: lazarusidestrconsts.lispkgmangpackageconflicts 16233msgid "Package conflicts" 16234msgstr "Paket çakışmaları" 16235 16236#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage 16237msgid "Package is not a designtime package" 16238msgstr "Paket bir tasarım zamanı paketi değil" 16239 16240#: lazarusidestrconsts.lispkgmangpackageisrequired 16241msgid "Package is required" 16242msgstr "Paket gerekiyor" 16243 16244#: lazarusidestrconsts.lispkgmangpackagemainsourcefile 16245msgid "package main source file" 16246msgstr "paket ana kaynak dosyası" 16247 16248#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists 16249msgid "Package name already exists" 16250msgstr "Paket adı zaten var" 16251 16252#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk 16253msgid "Packages must have the extension .lpk" 16254msgstr "Paketlerin uzantısı .lpk olmalıdır" 16255 16256#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst 16257msgid "Please compile the package first." 16258msgstr "Lütfen önce paketi derleyin." 16259 16260#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage 16261msgid "Please save the file before adding it to a package." 16262msgstr "Dosyayı bir pakete eklemeden önce kaydedin." 16263 16264#: lazarusidestrconsts.lispkgmangproject 16265#, object-pascal-format 16266msgid "Project: %s" 16267msgstr "Proje: %s" 16268 16269#: lazarusidestrconsts.lispkgmangrebuildlazarus 16270msgid "Rebuild Lazarus?" 16271msgstr "Lazarus'u yeniden derle?" 16272 16273#: lazarusidestrconsts.lispkgmangrenamefilelowercase 16274msgid "Rename File lowercase?" 16275msgstr "Dosya küçük harfini yeniden adlandırın?" 16276 16277#: lazarusidestrconsts.lispkgmangreplaceexistingfile 16278#, object-pascal-format 16279msgid "Replace existing file \"%s\"?" 16280msgstr "Varolan dosyayı değiştir \"%s\"?" 16281 16282#: lazarusidestrconsts.lispkgmangreplacefile 16283msgid "Replace File" 16284msgstr "Dosyayı Değiştir" 16285 16286#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound 16287msgid "One or more required packages were not found. See package graph for details." 16288msgstr "Gerekli bir veya daha fazla paket bulunamadı. Ayrıntılar için paket grafiğine bakın." 16289 16290#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage 16291#, object-pascal-format 16292msgid "" 16293"The package %s is already open in the IDE.\n" 16294"You cannot save a package with the same name." 16295msgstr "" 16296"%s paketi IDE'de zaten açık.\n" 16297"Aynı ada sahip bir paketi kaydedemezsiniz.." 16298 16299#: lazarusidestrconsts.lispkgmangsavepackage 16300msgid "Save package?" 16301msgstr "Paket Kaydedilsin mi?" 16302 16303#: lazarusidestrconsts.lispkgmangsavepackagelpk 16304#, object-pascal-format 16305msgid "Save Package %s (*.lpk)" 16306msgstr "Paket Kaydet %s (* .lpk)" 16307 16308#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto 16309#, object-pascal-format 16310msgid "Should the file be renamed lowercase to%s\"%s\"?" 16311msgstr "Dosya küçük harfe yeniden adlandırılsın mı?%s\"%s\"?" 16312 16313#: lazarusidestrconsts.lispkgmangskipthispackage 16314msgid "Skip this package" 16315msgstr "Bu paketi atla" 16316 16317#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile 16318msgid "static packages config file" 16319msgstr "statik paketler yapılandırma dosyası" 16320 16321#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable 16322#, object-pascal-format 16323msgid "The compiler file for package %s is not a valid executable:%s%s" 16324msgstr "%s paketinin derleyici dosyası geçerli bir yürütülebilir değil: %s %s" 16325 16326#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage 16327#, object-pascal-format 16328msgid "The file \"%s\"%sis already in the package %s." 16329msgstr "\"%s\"%s dosyası zaten %s paketinde bulunuyor." 16330 16331#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage 16332#, object-pascal-format 16333msgid "The file \"%s\" is not a Lazarus package." 16334msgstr "\"%s\" dosyası bir Lazarus paketi değil." 16335 16336#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage 16337#, object-pascal-format 16338msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" 16339msgstr "\"%s\" dosya adı, dosyadaki \"%s\" paket adıyla uyuşmuyor.%sPaket adı değiştirilsin mi \"%s\"?" 16340 16341#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject 16342#, object-pascal-format 16343msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." 16344msgstr "Dosya adı \"%s\" geçerli projenin bir parçası.%sProjeler ve Paketler dosya paylaşmamalıdır." 16345 16346#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile 16347#, object-pascal-format 16348msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." 16349msgstr "\"%s\" dosya ismi \"%s\" tarafından \"%s\"%s %s dosyasında kullanılıyor." 16350 16351#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound 16352#, object-pascal-format 16353msgid "The file \"%s\" of package %s was not found." 16354msgstr "%s paketinin \"%s\" dosyası bulunamadı." 16355 16356#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload 16357msgid "The following package failed to load:" 16358msgstr "Aşağıdaki paket yüklenemedi:" 16359 16360#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload 16361msgid "The following packages failed to load:" 16362msgstr "Aşağıdaki paketler yüklenemedi:" 16363 16364#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof 16365#, object-pascal-format 16366msgid "%sThe following units will be added to the uses section of%s%s:%s%s" 16367msgstr "%sBunların %s%s uses bölümüne eklenecek: %s%s" 16368 16369#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati 16370#, object-pascal-format 16371msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?" 16372msgstr "\"%s\" paketi derlenemedi.%s Yükleme listesinden çıkarılsın mı?" 16373 16374#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename 16375#, object-pascal-format 16376msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." 16377msgstr "%s \"%s\" içindeki \"%s\" paket dosyasının adı geçerli bir Lazarus paket adı değil." 16378 16379#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages 16380#, object-pascal-format 16381msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." 16382msgstr "%s paketi yalnızca bir çalışma zamanı paketi.%s Çalışma zamanı paketleri IDE'ye yüklenemez." 16383 16384#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec 16385#, object-pascal-format 16386msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies." 16387msgstr "\"%s\" paketi otomatik olarak derlenir ve çıktı dizini, derleyicinin varsayılan birim arama yolundaki \"%s\" şeklindedir. Paket, derleyicinin varsayılan birim aramasını da kullanan diğer paketleri kullanır. Bu sonsuz bir döngü oluşturur.%s Bu yolu, derleyici config'nizden (örneğin, fpc.cfg)%s yolunu kaldırarak veya bu paketin otomatik güncellemesini devre dışı bırakarak veya bağımlılıkları kaldırarak düzeltebilirsiniz." 16388 16389#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound 16390#, object-pascal-format 16391msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?" 16392msgstr "\"%s\" paketi kurulum için işaretlendi, ancak bulunamıyor.%s Bağımlılıklar paket listesinden kaldırılsın mı?" 16393 16394#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation 16395#, object-pascal-format 16396msgid "The package %s is required by %s which is marked for installation.%sSee package graph." 16397msgstr "%s paketi kurulum için işaretlenmiş %s tarafından isteniyor.%sPaket grafiğini göster." 16398 16399#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean 16400#, object-pascal-format 16401msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" 16402msgstr "\"%s\" paket adı geçerli bir paket adı değil%sLütfen başka bir ad seçin (örneğin, paket1.lpk)" 16403 16404#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid 16405#, object-pascal-format 16406msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." 16407msgstr "\"%s\" adlı paket adı%s \"%s\" dosyasının adı geçersiz." 16408 16409#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus 16410#, object-pascal-format 16411msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 16412msgstr "\"%s\" paketi işaretlendi.%s Şu anda Lazarus yalnızca statik bağlantılı paketleri destekliyor. Bileşenin kaldırılması için Lazarus'un yeniden derlenmesi ve yeniden başlatılması gerekiyor.%s Lazarus'u şimdi yeniden derlemek ister misiniz?" 16413 16414#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus 16415#, object-pascal-format 16416msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 16417msgstr "\"%s\" paketi kurulum için işaretlendi.%s Şu anda Lazarus yalnızca statik bağlantılı paketleri destekliyor. Bileşenin kurulması için Lazarus un derlenmesi ve yeniden başlatılması gerekiyor.%s Lazarus'u şimdi yeniden derlemek ister misiniz?" 16418 16419#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound 16420#, object-pascal-format 16421msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." 16422msgstr "Proje \"%s\" paketini gerektiriyor.%s Ancak bulunamadı. Bkz. Proje -> Proje Denetçisi." 16423 16424#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from 16425#, object-pascal-format 16426msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" 16427msgstr "Aynı ada sahip iki birim var: %s1. \"%s\" %s den %s2. \"%s\" %s" 16428 16429#: lazarusidestrconsts.lispkgmangthereisacirculardependency 16430msgid "There is a circular dependency in the packages. See package graph." 16431msgstr "Paketlerde dairesel bir bağımlılık var. Paket grafiğine bakın." 16432 16433#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage 16434#, object-pascal-format 16435msgid "There is a FPC unit with the same name as a package:%s\"%s\"" 16436msgstr "Paket olarak aynı ada sahip bir FPC birimi var: %s \"%s\"" 16437 16438#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom 16439#, object-pascal-format 16440msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" 16441msgstr "Aynı adla aynı adda bir FPC birimi var:%s'dan%s \"%s\"" 16442 16443#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename 16444#, object-pascal-format 16445msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" 16446msgstr "\"%s\" adında zaten başka bir paket var.%s Çakışma paketi: \"%s\"%s Dosya: \"%s\"" 16447 16448#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile 16449#, object-pascal-format 16450msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." 16451msgstr "Zaten bir paket var \"%s\" %s \"%s\" dosyasından yüklendi.%s Bkz. Paket -> Paket Grafiği.%s Değiştirmek imkansız." 16452 16453#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages 16454msgid "There is an unsaved package in the required packages. See package graph." 16455msgstr "Gerekli paketlerde kaydedilmemiş bir paket var, bkz. Paket grafiği." 16456 16457#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 16458#, object-pascal-format 16459msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" 16460msgstr "Bir paket olarak aynı adı taşıyan bir birim var: %s1. \"%s\" %s %s2. \"%s\"" 16461 16462#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe 16463msgid "This is a virtual package. It has no source yet. Please save the package first." 16464msgstr "Bu sanal bir paket, henüz kaynağı yok, lütfen önce paketi kaydedin." 16465 16466#: lazarusidestrconsts.lispkgmangunabletocreatedirectory 16467msgid "Unable to create directory" 16468msgstr "Dizin oluşturulamadı" 16469 16470#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage 16471#, object-pascal-format 16472msgid "Unable to create output directory \"%s\"%sfor package %s." 16473msgstr "Paket %s için \"%s\" %s çıktı klasörü oluşturulamadı." 16474 16475#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage 16476#, object-pascal-format 16477msgid "Unable to create package source directory \"%s\"%sfor package %s." 16478msgstr "Paket kaynağı klasörü \"%s\" %s için %s oluşturulamadı." 16479 16480#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus 16481#, object-pascal-format 16482msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." 16483msgstr "Lazarus için hedef klasör oluşturulamadı: %s\"%s\".%sBu klasör, özel paketlerinizle birlikte değiştirilen yeni Lazarus IDE için gereklidir." 16484 16485#: lazarusidestrconsts.lispkgmangunabletodeletefile 16486#, object-pascal-format 16487msgid "Unable to delete file \"%s\"." 16488msgstr "Dosya \"%s\" silinemiyor." 16489 16490#: lazarusidestrconsts.lispkgmangunabletodeletefilename 16491msgid "Unable to delete file" 16492msgstr "Dosya silinemiyor" 16493 16494#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage 16495#, object-pascal-format 16496msgid "Unable to delete old state file \"%s\"%sfor package %s." 16497msgstr "Eski durum dosyasını silemiyor \"%s\" %s paket %s için." 16498 16499#: lazarusidestrconsts.lispkgmangunabletoloadpackage 16500msgid "Unable to load package" 16501msgstr "Paket yüklenemiyor" 16502 16503#: lazarusidestrconsts.lispkgmangunabletoopenthepackage 16504#, object-pascal-format 16505msgid "Unable to open the package \"%s\".%sThis package was marked for installation." 16506msgstr "Paket \"%s\" açılamıyor.%sBu paket kurulum için işaretlendi." 16507 16508#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror 16509#, object-pascal-format 16510msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s" 16511msgstr "%s durum dosyasını okunamıyor \"%s\" paketi %s.%sHata: %s" 16512 16513#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror 16514#, object-pascal-format 16515msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" 16516msgstr "\"%s\"%s paketi \"%s\" dosyasına yazılamıyor.%s Hata:%s" 16517 16518#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror 16519#, object-pascal-format 16520msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s" 16521msgstr "Durum dosyası yazılamıyor \"%s\"%s paketinin %s.%s Hata:%s" 16522 16523#: lazarusidestrconsts.lispkgmanguninstallpackage 16524msgid "Uninstall package?" 16525msgstr "Paketi kaldır?" 16526 16527#: lazarusidestrconsts.lispkgmanguninstallpackage2 16528#, object-pascal-format 16529msgid "Uninstall package %s?" 16530msgstr "Paket %s kaldırılsın mı?" 16531 16532#: lazarusidestrconsts.lispkgmangunsavedpackage 16533msgid "Unsaved package" 16534msgstr "Kaydedilmemiş paket" 16535 16536#: lazarusidestrconsts.lispkgmanguseunit 16537msgid "Use unit" 16538msgstr "Birimi kullan" 16539 16540#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject 16541#, object-pascal-format 16542msgid "Warning: The file \"%s\"%sbelongs to the current project." 16543msgstr "Uyarı: Dosya \"%s\"%s mevcut projeye ait." 16544 16545#: lazarusidestrconsts.lispkgmgrkeep 16546msgid "keep" 16547msgstr "duracak" 16548 16549#: lazarusidestrconsts.lispkgmgrnew 16550msgid "new" 16551msgstr "yeni" 16552 16553#: lazarusidestrconsts.lispkgmgrremove 16554msgid "remove" 16555msgstr "kaldırılacak" 16556 16557#: lazarusidestrconsts.lispkgselectapackage 16558msgid "Select a package" 16559msgstr "Bir paket seçin" 16560 16561#: lazarusidestrconsts.lispkgsinstalled 16562msgctxt "lazarusidestrconsts.lispkgsinstalled" 16563msgid "Installed" 16564msgstr "Yüklü" 16565 16566#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit 16567msgid "Cannot register components without unit" 16568msgstr "Birim olmayan bileşenler kaydedilemiyor" 16569 16570#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined 16571#, object-pascal-format 16572msgid "Component Class \"%s\" already defined" 16573msgstr "Bileşen Sınıfı \"%s\" zaten tanımlandı" 16574 16575#: lazarusidestrconsts.lispkgsysfilename 16576#, object-pascal-format 16577msgid "%s%sFile Name: \"%s\"" 16578msgstr "%s%sDosya Adı: \"%s\"" 16579 16580#: lazarusidestrconsts.lispkgsysinvalidcomponentclass 16581msgid "Invalid component class" 16582msgstr "Geçersiz bileşen sınıfı" 16583 16584#: lazarusidestrconsts.lispkgsysinvalidunitname 16585#, object-pascal-format 16586msgid "Invalid Unitname: %s" 16587msgstr "Geçersiz Birim Adı: %s" 16588 16589#: lazarusidestrconsts.lispkgsyslpkfilename 16590#, object-pascal-format 16591msgid "%s%slpk file: \"%s\"" 16592msgstr "%s%slpk dosyası: \"%s\"" 16593 16594#: lazarusidestrconsts.lispkgsyspackagefilenotfound 16595msgid "Package file not found" 16596msgstr "Paket dosyası bulunamadı" 16597 16598#: lazarusidestrconsts.lispkgsyspackageregistrationerror 16599msgid "Package registration error" 16600msgstr "Paket kaydı hatası" 16601 16602#: lazarusidestrconsts.lispkgsysregisterprocedureisnil 16603msgid "Register procedure is nil" 16604msgstr "Kayıt prosedürü sıfır" 16605 16606#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering 16607msgid "RegisterUnit was called but no package is registering." 16608msgstr "RegisterUnit çağrıldı, ancak hiçbir paket kayıt yapmıyor." 16609 16610#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound 16611#, object-pascal-format 16612msgid "%s%sThe lpk file was not found." 16613msgstr "%s%sLpk dosyası bulunamadı." 16614 16615#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound 16616#, object-pascal-format 16617msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created." 16618msgstr "\"%s\" paketi kuruldu, ancak geçerli bir paket dosyası (.lpk) bulunamadı.%s Bozuk bir sahte paket oluşturuldu." 16619 16620#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents 16621msgid "This is the default package. Used only for components without a package. These components are outdated." 16622msgstr "Bu varsayılan paket. Sadece paketi olmayan bileşenler için kullanılır. Bu bileşenler eski." 16623 16624#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound 16625msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this." 16626msgstr "Bu paket yüklü ancak lpk dosyası bulunamadı. Tüm bileşenleri devre dışı bırakıldı. Lütfen bunu düzeltin." 16627 16628#: lazarusidestrconsts.lispkgsysunitname 16629#, object-pascal-format 16630msgid "%s%sUnit Name: \"%s\"" 16631msgstr "%s%sBirim Adı: \"%s\"" 16632 16633#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn 16634#, object-pascal-format 16635msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit." 16636msgstr "Birim \"%s\" lpk dosyasında bulunamadı. %s Muhtemelen bu lpk dosyası bu IDE'yi oluşturmak için kullanılmadı. Veya paket, RegisterUnit prosedürünü kötüye kullanır." 16637 16638#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk 16639#, object-pascal-format 16640msgid "Unit \"%s\" was removed from package (lpk)" 16641msgstr "Birim \"%s\" paketten kaldırıldı (lpk)" 16642 16643#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau 16644msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies." 16645msgstr "Paket bağımlılıklar arasındaki otomatik geçiş nedeniyle aşağıdaki bağımlılıklar gerekli değildir." 16646 16647#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin 16648#, object-pascal-format 16649msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s" 16650msgstr "Proje, aşağıdaki paketlerin çıktı dizinini geçersiz kılar.%s Bkz. Proje / Proje Seçenekleri (derleyici seçenekleri bölümü) / Eklemeler ve Geçersiz Kılmalar%s%s" 16651 16652#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage 16653msgid "This file is not in any loaded package." 16654msgstr "Bu dosya yüklü bir pakette değil." 16655 16656#: lazarusidestrconsts.lispkgtransitivity 16657msgid "Transitivity" 16658msgstr "Geçişlilik" 16659 16660#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror 16661#, object-pascal-format 16662msgid "Unable to read package file \"%s\".%sError: %s" 16663msgstr "Paket dosyası \"%s\" okunamadı %sHata: %s" 16664 16665#: lazarusidestrconsts.lisplay 16666msgid "Play" 16667msgstr "Oynat" 16668 16669#: lazarusidestrconsts.lispldglobal 16670msgctxt "lazarusidestrconsts.lispldglobal" 16671msgid "Global" 16672msgstr "Küresel" 16673 16674#: lazarusidestrconsts.lispldonline 16675msgid "Online" 16676msgstr "Çevrimiçi" 16677 16678#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted 16679msgid "Online packages cannot be deleted" 16680msgstr "Çevrimiçi paketler silinemez" 16681 16682#: lazarusidestrconsts.lispldpackagelinks 16683msgid "Package Links" 16684msgstr "Paket Bağlantıları" 16685 16686#: lazarusidestrconsts.lispldshowgloballinksin 16687msgid "Show global links in " 16688msgstr "Küresel bağlantıları göster " 16689 16690#: lazarusidestrconsts.lispldshowonlinelinks 16691msgid "Show online links" 16692msgstr "Çevrimiçi linkleri göster" 16693 16694#: lazarusidestrconsts.lispldshowuserlinksin 16695msgid "Show user links in " 16696msgstr "Kullanıcı bağlantılarını göster " 16697 16698#: lazarusidestrconsts.lispldsomepackagescannotbedeleted 16699msgid "Some packages cannot be deleted" 16700msgstr "Bazı paketler silinemez" 16701 16702#: lazarusidestrconsts.lisplduser 16703msgid "User" 16704msgstr "Kullanıcı" 16705 16706#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow 16707msgid "Please fix the error shown in the message window which is normally below the source editor." 16708msgstr "Lütfen normalde kaynak düzenleyicinin altında olan mesaj penceresinde gösterilen hatayı düzeltin." 16709 16710#: lazarusidestrconsts.lispleaseopenaunitbeforerun 16711msgid "Please open a unit before run." 16712msgstr "Lütfen çalıştırmadan önce bir ünite açın." 16713 16714#: lazarusidestrconsts.lispleaseselectatleastonebuildmode 16715msgid "Please select at least one build mode." 16716msgstr "Lütfen en az bir yapım modu seçin." 16717 16718#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod 16719msgid "Please select some code to extract a new procedure/method." 16720msgstr "Lütfen yeni bir prosedür / yöntem çıkarmak için bazı kodları seçin." 16721 16722#: lazarusidestrconsts.lisplistall 16723msgctxt "lazarusidestrconsts.lisplistall" 16724msgid "<All>" 16725msgstr "<Tüm>" 16726 16727#: lazarusidestrconsts.lisplistchangefont 16728msgid "Change Font" 16729msgstr "Yazı Tipini Değiştir" 16730 16731#: lazarusidestrconsts.lisplistcopymethodtoclipboard 16732msgid "Copy method name to the clipboard" 16733msgstr "Yöntem adını panoya kopyala" 16734 16735#: lazarusidestrconsts.lisplistfilterany 16736msgid "Filter by matching any part of method" 16737msgstr "Metodun herhangi bir parçasını eşleyerek filtreleme" 16738 16739#: lazarusidestrconsts.lisplistfilterstart 16740msgid "Filter by matching with start of method" 16741msgstr "Yöntemin başlangıcıyla eşleşen filtreleme" 16742 16743#: lazarusidestrconsts.lisplistjumptoselection 16744msgid "Jump To Selection" 16745msgstr "Seçime Git" 16746 16747#: lazarusidestrconsts.lisplistnone 16748msgid "<None>" 16749msgstr "<Yok>" 16750 16751#: lazarusidestrconsts.lisplistobjects 16752msgid "&Objects" 16753msgstr "&Nesneler" 16754 16755#: lazarusidestrconsts.lisplistprocedurelist 16756msgid "Procedure List" 16757msgstr "İşlem Listesi" 16758 16759#: lazarusidestrconsts.lisplisttype 16760msgctxt "lazarusidestrconsts.lisplisttype" 16761msgid "Type" 16762msgstr "Tür" 16763 16764#: lazarusidestrconsts.lispochoosepofiledirectory 16765msgid "Choose .po file directory" 16766msgstr ".po dosya dizini seçin" 16767 16768#: lazarusidestrconsts.lispodonotsaveanysessioninfo 16769msgid "Do not save any session info" 16770msgstr "Herhangi bir oturum bilgisi kaydetme" 16771 16772#: lazarusidestrconsts.lispointer 16773msgid "Pointer" 16774msgstr "Işaretçi" 16775 16776#: lazarusidestrconsts.lisposaveinideconfigdirectory 16777msgid "Save in .lps file in IDE config directory" 16778msgstr ".lps dosyasını IDE yapılandırma dizinine kaydedin" 16779 16780#: lazarusidestrconsts.lisposaveinlpifil 16781msgid "Save in .lpi file" 16782msgstr ".lpi dosyasına kaydet" 16783 16784#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory 16785msgid "Save in .lps file in project directory" 16786msgstr ".lps dosyasını proje dizinine kaydedin" 16787 16788#: lazarusidestrconsts.lisposavesessioninformationin 16789msgid "Save session information in" 16790msgstr "Oturum bilgisini içine kaydet" 16791 16792#: lazarusidestrconsts.lisposavesessioninformationinhint 16793msgid ".lpi is the project main info file, .lps is a separate file for session data only." 16794msgstr ".lpi proje ana bilgi dosyasıdır, .lps sadece oturum verileri için ayrı bir dosyadır." 16795 16796#: lazarusidestrconsts.lisposition 16797msgid "Position" 16798msgstr "Konum" 16799 16800#: lazarusidestrconsts.lispositionoutsideofsource 16801#, object-pascal-format 16802msgid "%s (position outside of source)" 16803msgstr "%s (kaynak dışındaki konum)" 16804 16805#: lazarusidestrconsts.lisppuinwrongdirectory 16806#, object-pascal-format 16807msgid "ppu in wrong directory=%s." 16808msgstr "ppu yanlış dizinde = %s." 16809 16810#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg 16811#, object-pascal-format 16812msgid "%s.ppu not found. Check your fpc.cfg." 16813msgstr "%s .ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin." 16814 16815#: lazarusidestrconsts.lisprecedingword 16816msgid "Preceding word" 16817msgstr "Önceden geçen kelime" 16818 16819#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig 16820msgid "primary config directory where Lazarus stores its config files. Default is " 16821msgstr "lazarus'un yapılandırma dosyalarını depoladığı birincil yapılandırma dizini.Varsayılan değer " 16822 16823#: lazarusidestrconsts.lisprimaryconfigpath 16824msgid "Primary config path" 16825msgstr "Birincil yapılandırma yolu" 16826 16827#: lazarusidestrconsts.lisprior 16828#, object-pascal-format 16829msgid "prior %s" 16830msgstr "önceki %s" 16831 16832#: lazarusidestrconsts.lispriority 16833msgctxt "lazarusidestrconsts.lispriority" 16834msgid "Priority" 16835msgstr "Öncelikli" 16836 16837#: lazarusidestrconsts.lisprivate 16838msgid "Private" 16839msgstr "Özel" 16840 16841#: lazarusidestrconsts.lisprivatemethod 16842msgid "Private Method" 16843msgstr "Özel Yöntem" 16844 16845#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti 16846#, object-pascal-format 16847msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first." 16848msgstr "Muhtemelen devam etmeden önce bazı paketleri kurmanız gerekir.%s Uyarı:%s Proje, tasarımcının formunu açmak için gerekli olabilecek aşağıdaki tasarım zaman paketlerini kullanır. Devam ederseniz, eksik bileşenlerle ilgili hatalar alabilirsiniz ve form yükleme muhtemelen çok hoş sonuçlar doğurur.%s Önce bu paketleri iptal etmeniz ve yüklemeniz önerilir." 16849 16850#: lazarusidestrconsts.lisprocedure 16851msgctxt "lazarusidestrconsts.lisprocedure" 16852msgid "Procedure" 16853msgstr "Prosedür" 16854 16855#: lazarusidestrconsts.lisprocedurewithinterface 16856msgid "Procedure with interface" 16857msgstr "Arabirimli Prosedür" 16858 16859#: lazarusidestrconsts.lisprogram 16860msgctxt "lazarusidestrconsts.lisprogram" 16861msgid "Program" 16862msgstr "Program" 16863 16864#: lazarusidestrconsts.lisprogramdetected 16865msgid "Program detected" 16866msgstr "Program tespit edildi" 16867 16868#: lazarusidestrconsts.lisprogramprogramdescriptor 16869msgid "A Free Pascal command line program with some useful settings added." 16870msgstr "Bazı yararlı ayarlarla birlikte bir Free Pascal komut satırı programı eklendi." 16871 16872#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp 16873msgid "Program source must have a Pascal extension like .pas, .pp or .lpr" 16874msgstr "Program kaynağı, .pas, .pp veya .lpr gibi bir Pascal uzantısına sahip olmalıdır" 16875 16876#: lazarusidestrconsts.lisprojadddependencyalreadyexists 16877msgid "Dependency already exists" 16878msgstr "Bağımlılık zaten var" 16879 16880#: lazarusidestrconsts.lisprojaddeditorfile 16881msgid "Add Editor Files" 16882msgstr "Editör Dosyalarını Ekle" 16883 16884#: lazarusidestrconsts.lisprojaddinvalidminmaxversion 16885msgid "Invalid Min-Max version" 16886msgstr "Geçersiz Min-Max sürümü" 16887 16888#: lazarusidestrconsts.lisprojaddinvalidversion 16889msgid "Invalid version" 16890msgstr "Geçersiz sürüm" 16891 16892#: lazarusidestrconsts.lisprojaddlocalpkg 16893#, object-pascal-format 16894msgid "Local (%s)" 16895msgstr "Yerel (%s)" 16896 16897#: lazarusidestrconsts.lisprojaddmaximumversionoptional 16898msgid "Maximum Version (optional):" 16899msgstr "Maksimum Sürüm (isteğe bağlı):" 16900 16901#: lazarusidestrconsts.lisprojaddminimumversionoptional 16902msgid "Minimum Version (optional):" 16903msgstr "Minimum Sürüm (isteğe bağlı):" 16904 16905#: lazarusidestrconsts.lisprojaddnewfpmakerequirement 16906msgid "New FPMake Requirement" 16907msgstr "Yeni FPMake Gereksinimi" 16908 16909#: lazarusidestrconsts.lisprojaddnewrequirement 16910msgid "New Requirement" 16911msgstr "Yeni Gereksinim" 16912 16913#: lazarusidestrconsts.lisprojaddonlinepkg 16914#, object-pascal-format 16915msgid "Online (%s)" 16916msgstr "Çevrimçi (%s)" 16917 16918#: lazarusidestrconsts.lisprojaddpackagename 16919msgid "Package Name:" 16920msgstr "Paket ismi:" 16921 16922#: lazarusidestrconsts.lisprojaddpackagenotfound 16923msgid "Package not found" 16924msgstr "Paket bulunamadı" 16925 16926#: lazarusidestrconsts.lisprojaddpackagetype 16927msgid "Package Type:" 16928msgstr "Paket tipi:" 16929 16930#: lazarusidestrconsts.lisprojaddthedependencywasnotfound 16931#, object-pascal-format 16932msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." 16933msgstr "Bağımlılık \"%s\" bulunamadı %sLütfen mevcut bir paketi seçin." 16934 16935#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid 16936#, object-pascal-format 16937msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" 16938msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 16939msgstr "\"%s\" Maksimum Sürümü geçersiz.%s Lütfen major.minor.release.build%s biçimini kullanın. Örneğin: 1.0.20.10" 16940 16941#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion 16942msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" 16943msgid "The Maximum Version is lower than the Minimim Version." 16944msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür." 16945 16946#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid 16947#, object-pascal-format 16948msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" 16949msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 16950msgstr "\"%s\" Minimum Sürümü geçersiz.%s Lütfen major.minor.release.build%s biçimini kullanın. Örneğin: 1.0.20.10" 16951 16952#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency 16953#, object-pascal-format 16954msgid "The project has already a dependency for the package \"%s\"." 16955msgstr "Projenin \"%s\" paketi için zaten bir bağımlılığı var." 16956 16957#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject 16958#, object-pascal-format 16959msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." 16960msgstr "\"%s\" birim adı %s projesinde zaten var: \"%s\"." 16961 16962#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection 16963#, object-pascal-format 16964msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." 16965msgstr "\"%s\" birim ismi %s seçiminde zaten var: \"%s\"." 16966 16967#: lazarusidestrconsts.lisprojaddunitnamealreadyexists 16968msgid "Unit name already exists" 16969msgstr "Birim adı zaten var" 16970 16971#: lazarusidestrconsts.lisproject 16972#, object-pascal-format 16973msgid "Project %s" 16974msgstr "Proje %s" 16975 16976#: lazarusidestrconsts.lisproject2 16977msgid "Project: " 16978msgstr "Proje: " 16979 16980#: lazarusidestrconsts.lisproject3 16981msgid "project" 16982msgstr "proje" 16983 16984#: lazarusidestrconsts.lisprojectchanged 16985msgid "Project changed" 16986msgstr "Proje değiştirildi" 16987 16988#: lazarusidestrconsts.lisprojectchangedondisk 16989msgid "Project changed on disk" 16990msgstr "Proje disk üzerinde değişti" 16991 16992#: lazarusidestrconsts.lisprojectcount 16993#, object-pascal-format 16994msgid "%d projects" 16995msgstr "%d proje" 16996 16997#: lazarusidestrconsts.lisprojectdirectory 16998msgctxt "lazarusidestrconsts.lisprojectdirectory" 16999msgid "Project directory" 17000msgstr "Proje dizini" 17001 17002#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar 17003msgid "Title in taskbar shows also directory path of the project" 17004msgstr "Görev çubuğundaki başlık, projenin dizin yolunu da gösterir" 17005 17006#: lazarusidestrconsts.lisprojectfilename 17007msgid "Project filename" 17008msgstr "Proje dosya adı" 17009 17010#: lazarusidestrconsts.lisprojectincpath 17011msgid "Project Include Path" 17012msgstr "Projeyi yola dahil et" 17013 17014#: lazarusidestrconsts.lisprojectinfofiledetected 17015msgid "Project info file detected" 17016msgstr "Proje bilgi dosyası algılandı" 17017 17018#: lazarusidestrconsts.lisprojectisrunnable 17019msgid "Project is runnable" 17020msgstr "Proje çalıştırılabilir" 17021 17022#: lazarusidestrconsts.lisprojectisrunnablehint 17023msgid "Generates a binary executable which can be run." 17024msgstr "Çalıştırılabilen bir ikili çalıştırılabilir üretir." 17025 17026#: lazarusidestrconsts.lisprojectmacro 17027msgctxt "lazarusidestrconsts.lisprojectmacro" 17028msgid "Project" 17029msgstr "Proje" 17030 17031#: lazarusidestrconsts.lisprojectmacroproperties 17032msgid "Project macro properties" 17033msgstr "Proje makro özellikleri" 17034 17035#: lazarusidestrconsts.lisprojectnamespaces 17036msgid "Project Namespaces" 17037msgstr "Proje alanadı" 17038 17039#: lazarusidestrconsts.lisprojectoption 17040msgid "Project Option" 17041msgstr "Proje Seçenekleri" 17042 17043#: lazarusidestrconsts.lisprojectoutdir 17044msgid "Project Output directory (e.g. the ppu directory)" 17045msgstr "Proje Çıktı dizini (ör. Ppu dizini)" 17046 17047#: lazarusidestrconsts.lisprojectoutputdirectory 17048msgid "Project output directory" 17049msgstr "Proje çıktı dizini" 17050 17051#: lazarusidestrconsts.lisprojectpathhint 17052msgid "Directory where project's main file must be" 17053msgstr "Projenin ana dosyasının olması gereken dizin" 17054 17055#: lazarusidestrconsts.lisprojectsession 17056msgid "Project Session" 17057msgstr "Proje Oturumu" 17058 17059#: lazarusidestrconsts.lisprojectsessionchanged 17060msgid "Project session changed" 17061msgstr "Proje oturumu değişti" 17062 17063#: lazarusidestrconsts.lisprojectsourcedirectories 17064msgid "Project source directories" 17065msgstr "Proje kaynak dizinleri" 17066 17067#: lazarusidestrconsts.lisprojectsraisedexceptionataddress 17068#, object-pascal-format 17069msgid "%0:s%0:s At address %1:x" 17070msgstr "%0:s%0:s Adresinde %1:x" 17071 17072#: lazarusidestrconsts.lisprojectsraisedexceptionclasss 17073#, object-pascal-format 17074msgid "Project %s raised exception class '%s'." 17075msgstr "%s projesinde istisna sınıfı oluştu '%s'." 17076 17077#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess 17078#, object-pascal-format 17079msgid "Project %s raised exception class '%s' with message:%s%s" 17080msgstr "%s projesi istisna sınıfı '%s' mesajını verdi:%s%s" 17081 17082#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress 17083#, object-pascal-format 17084msgid "%0:s%0:s In file '%1:s' at address %2:x" 17085msgstr "%0:s%0:s dosyasında '%1:s' adresinde %2:x" 17086 17087#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline 17088#, object-pascal-format 17089msgid "%0:s%0:s In file '%1:s' at line %2:d" 17090msgstr "%0:s%0:s dosyasında '%1:s' satırında %2:d" 17091 17092#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc 17093#, object-pascal-format 17094msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" 17095msgstr "%0:s%0:s satırındaki %1:s dosyasında: %2:d:%0:s%3:s" 17096 17097#: lazarusidestrconsts.lisprojectsrcpath 17098msgid "Project Src Path" 17099msgstr "Proje Src Yolu" 17100 17101#: lazarusidestrconsts.lisprojectunit 17102msgid "project unit" 17103msgstr "proje birimi" 17104 17105#: lazarusidestrconsts.lisprojectunitpath 17106msgid "Project Unit Path" 17107msgstr "Proje Birimi Yolu" 17108 17109#: lazarusidestrconsts.lisprojectwizard 17110msgid "Project Wizard" 17111msgstr "Proje Sihirbazı" 17112 17113#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency 17114msgid "Confirm deleting dependency" 17115msgstr "Bağımlılığı silmeyi onaylayın" 17116 17117#: lazarusidestrconsts.lisprojinspconfirmremovingfile 17118msgid "Confirm removing file" 17119msgstr "Dosyayı kaldırmayı onayla" 17120 17121#: lazarusidestrconsts.lisprojinspdeletedependencyfor 17122#, object-pascal-format 17123msgid "Delete dependency for %s?" 17124msgstr "%s için bağımlılık silinsin mi?" 17125 17126#: lazarusidestrconsts.lisprojinspprojectinspector 17127#, object-pascal-format 17128msgid "Project Inspector - %s" 17129msgstr "Proje denetçisi - %s" 17130 17131#: lazarusidestrconsts.lisprojinspremovedrequiredpackages 17132msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages" 17133msgid "Removed required packages" 17134msgstr "Gerekli paketler kaldırıldı" 17135 17136#: lazarusidestrconsts.lisprojinspremovefilefromproject 17137#, object-pascal-format 17138msgid "Remove file %s from project?" 17139msgstr "%s dosyası projeden kaldırılsın mı?" 17140 17141#: lazarusidestrconsts.lisprojinspremoveitemsf 17142#, object-pascal-format 17143msgid "Remove %s items from project?" 17144msgstr "%s öğeler projeden kaldırsın mı?" 17145 17146#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror 17147#, object-pascal-format 17148msgid "Unable to read state file %s of project %s%sError: %s" 17149msgstr "%s projesinin %s durumu dosyası okunamıyor. %sHata:%s" 17150 17151#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror 17152#, object-pascal-format 17153msgid "Unable to write state file for project %s%sError: %s" 17154msgstr "%s%sHata: %s projesi için durum dosyası yazılamıyor" 17155 17156#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged 17157msgid "Always build (even if nothing changed)" 17158msgstr "Her zaman derle (hiçbir şey değişmese bile)" 17159 17160#: lazarusidestrconsts.lisprojoptsalwaysbuildhint 17161msgid "May be needed if there is a bug in dependency check, normally not needed." 17162msgstr "Bağımlılık kontrolünde bir hata varsa, normalde gerekli değilse gerekli olabilir." 17163 17164#: lazarusidestrconsts.lisprojoptserror 17165msgctxt "lazarusidestrconsts.lisprojoptserror" 17166msgid "Error" 17167msgstr "Hata" 17168 17169#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist 17170#, object-pascal-format 17171msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." 17172msgstr "Program kaynağındaki otomatik oluşturma form listesini değiştiremiyor %sLütfen önce hataları düzeltin." 17173 17174#: lazarusidestrconsts.lisprojprojectsourcedirectorymark 17175msgid "Project Source Directory Mark" 17176msgstr "Proje Kaynak Dizini İşareti" 17177 17178#: lazarusidestrconsts.lispromptforvalue 17179msgid "Prompt for value" 17180msgstr "Değer isteyin" 17181 17182#: lazarusidestrconsts.lisproperties 17183msgid "Properties (replace or remove)" 17184msgstr "Özellikler (değiştir veya kaldır)" 17185 17186#: lazarusidestrconsts.lisproperty 17187#, object-pascal-format 17188msgid "%s property" 17189msgstr "%s özellikler" 17190 17191#: lazarusidestrconsts.lisprotected 17192msgid "Protected" 17193msgstr "Korumalı" 17194 17195#: lazarusidestrconsts.lisprotectedmethod 17196msgid "Protected Method" 17197msgstr "Korumalı Yöntem" 17198 17199#: lazarusidestrconsts.lispublicmethod 17200msgid "Public Method" 17201msgstr "Genel Yöntem" 17202 17203#: lazarusidestrconsts.lispublishedmethod 17204msgid "Published Method" 17205msgstr "Yayımlanmış Yöntem" 17206 17207#: lazarusidestrconsts.lispublishedto 17208#, object-pascal-format 17209msgid "Published to %s" 17210msgstr "%s yayınlandı" 17211 17212#: lazarusidestrconsts.lispublishmodulenote 17213msgid "Files belonging to project / package will be included automatically." 17214msgstr "Proje/pakete ait dosyalar otomatik olarak eklenecektir." 17215 17216#: lazarusidestrconsts.lispublishprojdir 17217msgid "Publish project directory" 17218msgstr "Proje dizini yayınla" 17219 17220#: lazarusidestrconsts.lispublishproject 17221msgid "Publish Project" 17222msgstr "Projeyi Yayınla" 17223 17224#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory 17225msgid "Save .lrs files in the output directory" 17226msgstr ".lrs dosyalarını çıkış dizinine kaydedin" 17227 17228#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint 17229msgid "The resource will be available for FPC." 17230msgstr "Kaynak FPC için mevcut olacak." 17231 17232#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas 17233msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" 17234msgid "A Pascal unit must have the extension .pp or .pas" 17235msgstr "Bir Pascal biriminin uzantısı .pp veya .pas olmalıdır" 17236 17237#: lazarusidestrconsts.lispvueditvirtualunit 17238msgid "Edit virtual unit" 17239msgstr "Sanal birimi düzenle" 17240 17241#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile 17242#, object-pascal-format 17243msgid "There is already an unit with this name.%sFile: %s" 17244msgstr "Bu ada sahip bir birim zaten var.%s Dosya: %s" 17245 17246#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier 17247msgid "The unitname is not a valid Pascal identifier." 17248msgstr "Birim adı geçerli bir Pascal tanımlayıcısı değil." 17249 17250#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses 17251msgid "The unitname is used when the IDE extends uses clauses" 17252msgstr "IDE, kullanım yan tümcesi genişletirken birim adı kullanılır" 17253 17254#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni 17255#, object-pascal-format 17256msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" 17257msgstr "Birim adı ve dosya adı uyuşmuyor.%s Örneği: unit1.pas ve unit1" 17258 17259#: lazarusidestrconsts.lispwconvertproject 17260msgid "Convert &Delphi Project" 17261msgstr "&Delphi Projesini çevir" 17262 17263#: lazarusidestrconsts.lispwnewproject 17264msgid "&New Project" 17265msgstr "&Yeni proje" 17266 17267#: lazarusidestrconsts.lispwopenproject 17268msgid "&Open Project" 17269msgstr "&Projeyi Aç" 17270 17271#: lazarusidestrconsts.lispwopenrecentproject 17272msgid "Open &Recent Project" 17273msgstr "&En son Projeyi aç" 17274 17275#: lazarusidestrconsts.lispwviewexampleprojects 17276msgid "View &Example Projects" 17277msgstr "&Örnek Projeleri gör" 17278 17279#: lazarusidestrconsts.lisquickfixerror 17280msgid "QuickFix error" 17281msgstr "Hızlı düzeltme hatası" 17282 17283#: lazarusidestrconsts.lisquickfixes 17284msgid "Quick fixes" 17285msgstr "Hızlı düzeltmeler" 17286 17287#: lazarusidestrconsts.lisquickfixremoveunit 17288msgid "Quick fix: Remove unit" 17289msgstr "Hızlı düzeltme: Birimi kaldır" 17290 17291#: lazarusidestrconsts.lisquickfixsearchidentifier 17292msgid "Search identifier" 17293msgstr "Arama tanımlayıcısı" 17294 17295#: lazarusidestrconsts.lisquit 17296msgid "Quit" 17297msgstr "Çıkış" 17298 17299#: lazarusidestrconsts.lisquitlazarus 17300msgid "&Quit Lazarus" 17301msgstr "&Lazarus'tan Çık" 17302 17303#: lazarusidestrconsts.lisrange 17304msgctxt "lazarusidestrconsts.lisrange" 17305msgid "Range" 17306msgstr "Aralık" 17307 17308#: lazarusidestrconsts.lisreaderror 17309msgid "Read Error" 17310msgstr "Okuma hatası" 17311 17312#: lazarusidestrconsts.lisreallydelete 17313msgid "Really delete?" 17314msgstr "Gerçekten silinsin mi?" 17315 17316#: lazarusidestrconsts.lisrecenttabs 17317msgid "Recent tabs" 17318msgstr "Son sekmeler" 17319 17320#: lazarusidestrconsts.lisrecord 17321msgctxt "lazarusidestrconsts.lisrecord" 17322msgid "Record" 17323msgstr "Kayıt" 17324 17325#: lazarusidestrconsts.lisrecordedmacros 17326msgid "Recorded" 17327msgstr "Kaydedilmiş" 17328 17329#: lazarusidestrconsts.lisrecordstruct 17330msgid "Record/Structure" 17331msgstr "Kayıt/Yapı" 17332 17333#: lazarusidestrconsts.lisredo 17334msgid "Redo" 17335msgstr "İleri" 17336 17337#: lazarusidestrconsts.lisregisters 17338msgctxt "lazarusidestrconsts.lisregisters" 17339msgid "Registers" 17340msgstr "Kayıtları" 17341 17342#: lazarusidestrconsts.lisregularexpression 17343msgid "Regular expression" 17344msgstr "Düzenli ifade" 17345 17346#: lazarusidestrconsts.lisrelative 17347msgid "Relative" 17348msgstr "Göreceli" 17349 17350#: lazarusidestrconsts.lisrelativepaths 17351msgid "Relative paths" 17352msgstr "Göreceli yollar" 17353 17354#: lazarusidestrconsts.lisremove 17355msgid "Remove" 17356msgstr "Kaldır" 17357 17358#: lazarusidestrconsts.lisremove2 17359msgid "Remove?" 17360msgstr "Kaldır?" 17361 17362#: lazarusidestrconsts.lisremoveallinvalidproperties 17363msgid "Remove all invalid properties" 17364msgstr "Geçersiz tüm özellikleri kaldır" 17365 17366#: lazarusidestrconsts.lisremoveallmessagetypefilters 17367msgid "Remove all message type filters" 17368msgstr "Tüm mesaj türü filtrelerini kaldır" 17369 17370#: lazarusidestrconsts.lisremoveallunits 17371msgid "Remove all units" 17372msgstr "Tüm birimleri kaldır" 17373 17374#: lazarusidestrconsts.lisremovecompileroptionhidemessage 17375msgid "Remove Compiler Option Hide Message" 17376msgstr "Derleyici Seçeneğini Gizle Mesajını Kaldır" 17377 17378#: lazarusidestrconsts.lisremovedependenciesfrompackage 17379#, object-pascal-format 17380msgid "Remove %s dependencies from package \"%s\"?" 17381msgstr "%s bağımlılıklarını \"%s\" paketinden kaldırsın mı?" 17382 17383#: lazarusidestrconsts.lisremovedpropertys 17384#, object-pascal-format 17385msgid "Removed property \"%s\"." 17386msgstr "\"%s\" özelliği kaldırıldı." 17387 17388#: lazarusidestrconsts.lisremovefilesfrompackage 17389#, object-pascal-format 17390msgid "Remove %s files from package \"%s\"?" 17391msgstr "%s dosyalarını \"%s\" paketinden kaldır?" 17392 17393#: lazarusidestrconsts.lisremovefrominstalllist 17394msgid "Remove from install list" 17395msgstr "Kurulum listesinden kaldır" 17396 17397#: lazarusidestrconsts.lisremovefromproject 17398msgid "Remove from Project" 17399msgstr "Projeden Kaldır" 17400 17401#: lazarusidestrconsts.lisremovefromsearchpath 17402msgid "Remove from search path" 17403msgstr "Arama yolundan kaldır" 17404 17405#: lazarusidestrconsts.lisremoveincludepath 17406msgid "Remove include path?" 17407msgstr "Dahili yol kaldırılsın mı?" 17408 17409#: lazarusidestrconsts.lisremovelocalvariable 17410#, object-pascal-format 17411msgid "Remove local variable %s" 17412msgstr "%s yerel değişkeni kaldır" 17413 17414#: lazarusidestrconsts.lisremovelocalvariable3 17415#, object-pascal-format 17416msgid "Remove local variable \"%s\"" 17417msgstr "Yerel değişkeni \"%s\" kaldır" 17418 17419#: lazarusidestrconsts.lisremovemessagetypefilter 17420msgid "Remove Message Type Filter" 17421msgstr "Mesaj Türü Filtresini Kaldır" 17422 17423#: lazarusidestrconsts.lisremovenonexistingfiles 17424msgid "Remove nonexistent files" 17425msgstr "Varolmayan dosyaları kaldırma" 17426 17427#: lazarusidestrconsts.lisremoveselectedunits 17428msgid "Remove selected units" 17429msgstr "Seçilen birimleri kaldır" 17430 17431#: lazarusidestrconsts.lisremovethem 17432msgid "Remove them" 17433msgstr "Kendiilerini kaldır" 17434 17435#: lazarusidestrconsts.lisremovethepathsfromothersources 17436msgid "Remove the paths from \"Other sources\"" 17437msgstr "Diğer kaynaklardan yolları kaldırın" 17438 17439#: lazarusidestrconsts.lisremoveunitpath 17440msgid "Remove unit path?" 17441msgstr "Birim yolunu kaldır?" 17442 17443#: lazarusidestrconsts.lisremoveuses 17444#, object-pascal-format 17445msgid "Remove uses \"%s\"" 17446msgstr "Uses den kaldır \"%s\"" 17447 17448#: lazarusidestrconsts.lisrename 17449msgctxt "lazarusidestrconsts.lisrename" 17450msgid "Rename" 17451msgstr "Yeniden Adlandır" 17452 17453#: lazarusidestrconsts.lisrename2 17454msgid "Rename ..." 17455msgstr "Yeniden Adlandır ..." 17456 17457#: lazarusidestrconsts.lisrenamefile 17458msgid "Rename file?" 17459msgstr "Dosyayı yeniden adlandır?" 17460 17461#: lazarusidestrconsts.lisrenamefilefailed 17462msgid "Rename file failed" 17463msgstr "Dosya yeniden adlandırılamadı" 17464 17465#: lazarusidestrconsts.lisrenameshowresult 17466msgid "Show list of renamed Identifiers" 17467msgstr "Yeniden adlandırılmış Tanımlayıcıların listesini göster" 17468 17469#: lazarusidestrconsts.lisrenameto 17470#, object-pascal-format 17471msgid "Rename to %s" 17472msgstr "%s için yeniden adlandır" 17473 17474#: lazarusidestrconsts.lisrenametolowercase 17475msgid "Rename to lowercase" 17476msgstr "Küçük harfe yeniden adlandır" 17477 17478#: lazarusidestrconsts.lisreopenproject 17479msgid "Reopen project" 17480msgstr "Projeyi tekrar aç" 17481 17482#: lazarusidestrconsts.lisreopenwithanotherencoding 17483msgid "Reopen with another encoding" 17484msgstr "Başka bir kodlamayla tekrar aç" 17485 17486#: lazarusidestrconsts.lisrepeat 17487msgctxt "lazarusidestrconsts.lisrepeat" 17488msgid "Repeat" 17489msgstr "Tekrar et" 17490 17491#: lazarusidestrconsts.lisrepeatcount 17492msgid "Repeat Count:" 17493msgstr "Tekrarlama Sayısı:" 17494 17495#: lazarusidestrconsts.lisreplace 17496msgid "Replace" 17497msgstr "Değiştir" 17498 17499#: lazarusidestrconsts.lisreplacedpropertyswiths 17500#, object-pascal-format 17501msgid "Replaced property \"%s\" with \"%s\"." 17502msgstr "\"%s\" ile \"%s\" değiştirildi." 17503 17504#: lazarusidestrconsts.lisreplacedtypeswiths 17505#, object-pascal-format 17506msgid "Replaced type \"%s\" with \"%s\"." 17507msgstr "\"%s\" ile \"%s\" değiştirildi." 17508 17509#: lazarusidestrconsts.lisreplacement 17510msgid "Replacement" 17511msgstr "Değiştirme" 17512 17513#: lazarusidestrconsts.lisreplacementfuncs 17514msgid "Replacement functions" 17515msgstr "Değiştirme işlevleri" 17516 17517#: lazarusidestrconsts.lisreplacements 17518msgid "Replacements" 17519msgstr "Değiştirmeler" 17520 17521#: lazarusidestrconsts.lisreplaceremoveunknown 17522msgid "Fix unknown properties and types" 17523msgstr "Bilinmeyen özellikleri ve türleri düzelt" 17524 17525#: lazarusidestrconsts.lisreplacewholeidentifier 17526msgid "Replace whole identifier" 17527msgstr "Tüm tanımlayıcıyı değiştir" 17528 17529#: lazarusidestrconsts.lisreplacingselectionfailed 17530msgid "Replacing selection failed." 17531msgstr "Seçimi değiştirme başarısız oldu." 17532 17533#: lazarusidestrconsts.lisreportingbugurl 17534msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" 17535msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" 17536 17537#: lazarusidestrconsts.lisrescan 17538msgid "Rescan" 17539msgstr "Yeniden tara" 17540 17541#: lazarusidestrconsts.lisreset 17542msgctxt "lazarusidestrconsts.lisreset" 17543msgid "Reset" 17544msgstr "Sıfırla" 17545 17546#: lazarusidestrconsts.lisresetallfilefilterstodefaults 17547msgid "Reset all file filters to defaults?" 17548msgstr "Tüm dosya filtrelerini varsayılanlara sıfırla mu?" 17549 17550#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir 17551msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?" 17552msgstr "Seçili bileşenlerin sol, üst, en ve genişliği varsaylıan değerlerine sıfırlansın mı?" 17553 17554#: lazarusidestrconsts.lisresourcenamemustbeunique 17555msgid "Resource name must be unique." 17556msgstr "Kaynak adı benzersiz olmalıdır." 17557 17558#: lazarusidestrconsts.lisresourcesaveerror 17559msgid "Resource save error" 17560msgstr "Kaynak kaydetme hatası" 17561 17562#: lazarusidestrconsts.lisresourcetypeofnewfiles 17563msgid "Resource type of project" 17564msgstr "Projenin kaynak türü" 17565 17566#: lazarusidestrconsts.lisrestart 17567msgid "Restart" 17568msgstr "Tekrar başlat" 17569 17570#: lazarusidestrconsts.lisresult2 17571msgid "Result:" 17572msgstr "Sonuç:" 17573 17574#: lazarusidestrconsts.lisreturnparameterindexedword 17575msgid "" 17576"Return parameter-indexed word from the current line preceding cursor position.\n" 17577"\n" 17578"Words in a line are numbered 1,2,3,... from left to right, but the last word\n" 17579"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" 17580"is always the current macro.\n" 17581"\n" 17582"Example line:\n" 17583"i 0 count-1 forb|\n" 17584"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" 17585"\n" 17586"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+" 17587msgstr "" 17588"Parametre dizine alınmış sözcüğü imleç konumundan önceki geçerli satırdan döndür. \n" 17589"\n" 17590"Satırdaki sözcükler 1,2,3, ... soldan sağa, ancak son sözcük olanher zaman genişletilecek bir makro komutu olan 0 numaraya sahiptir, bu yüzden $ PrevWord (0) \n" 17591"her zaman geçerli makrodur. \n" 17592"\n" 17593"Örnek satır: \n" 17594"i 0 count-1 forb | \n" 17595"Burada $ PrevWord (0) = forb, $ PrevWord (1) = i, $ PrevWord (2) = 0, $ PrevWord (3) = count-1 \n" 17596"\n" 17597"Şablonunuzun sonunda, boş bir dizeye genişleyen, ancak bulunan $ PrevWords'ün tümünü silmek için önemli bir işlem gerçekleştiren $ PrevWord (-1) kullanın. Ayrıca, buradaki kelimeleri tespit etmek için kullanılan bir regexp. makro: [\\ w \\ - + * \\ (\\) \\ [\\]. ^ @] +" 17598 17599#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria 17600msgid "" 17601"Return the list of all values of case variable in front of variable.\n" 17602"\n" 17603"Optional Parameters (comma separated):\n" 17604"WithoutExtraIndent // the case list will be generated without extra indentation" 17605msgstr "" 17606"Case değişkeninin tüm değerlerinin listesini değişkenin önünde döndür.\n" 17607"\n" 17608"İsteğe bağlı Parametreler (virgülle ayrılmış):\n" 17609"WithoutExtraIndent // case listesi fazladan girinti olmadan oluşturulur" 17610 17611#: lazarusidestrconsts.lisrevertfailed 17612msgid "Revert failed" 17613msgstr "Geri döndürme başarısız" 17614 17615#: lazarusidestrconsts.lisrevision 17616msgid "Revision: " 17617msgstr "" 17618 17619#: lazarusidestrconsts.lisright 17620msgctxt "lazarusidestrconsts.lisright" 17621msgid "Right" 17622msgstr "Sağ" 17623 17624#: lazarusidestrconsts.lisrightanchoring 17625msgid "Right anchoring" 17626msgstr "Sağ çapa" 17627 17628#: lazarusidestrconsts.lisrightborderspacespinedithint 17629msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." 17630msgstr "Sağ kenarlık Bu değer taban sınırına eklenir ve kontrol hakkı için kullanılır." 17631 17632#: lazarusidestrconsts.lisrightsiblingcomboboxhint 17633msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 17634msgstr "Bu, sağ tarafın tutturulduğu kardeş kontrolüdür. Ankraj için Delphi stilinde tutturma için boş bırakın (BorderSpacing ve ReferenceSide önemli değil)." 17635 17636#: lazarusidestrconsts.lisrightsides 17637msgid "Right sides" 17638msgstr "Sağ taraflar" 17639 17640#: lazarusidestrconsts.lisrightspaceequally 17641msgid "Right space equally" 17642msgstr "Sağ alan eşit" 17643 17644#: lazarusidestrconsts.lisroot 17645msgid "Root" 17646msgstr "Kök" 17647 17648#: lazarusidestrconsts.lisrootdirectory 17649msgid "Root Directory" 17650msgstr "Kök dizini" 17651 17652#: lazarusidestrconsts.lisrun 17653msgctxt "lazarusidestrconsts.lisrun" 17654msgid "Run" 17655msgstr "Çalıştır" 17656 17657#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations 17658msgid "\"Run and Design time\" packages have no limitations." 17659msgstr "\"Çalıştırma ve Tasarım zamanı\" paketlerinde herhangi bir sınırlama yoktur." 17660 17661#: lazarusidestrconsts.lisrunbuttonhint 17662msgctxt "lazarusidestrconsts.lisrunbuttonhint" 17663msgid "Run" 17664msgstr "Çalıştır" 17665 17666#: lazarusidestrconsts.lisrunning 17667#, object-pascal-format 17668msgid "%s (running ...)" 17669msgstr "%s (çalışıyor ...)" 17670 17671#: lazarusidestrconsts.lisrunparamsfilenotexecutable 17672msgid "File not executable" 17673msgstr "Dosya yürütülebilir değil" 17674 17675#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable 17676#, object-pascal-format 17677msgid "The host application \"%s\" is not executable." 17678msgstr "Sunucu uygulaması \"%s\" çalıştırılabilir değil." 17679 17680#: lazarusidestrconsts.lisrunstage 17681msgctxt "lazarusidestrconsts.lisrunstage" 17682msgid "Run" 17683msgstr "Çalıştır" 17684 17685#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide 17686msgid "Runtime only, cannot be installed in IDE" 17687msgstr "Yalnızca çalışma zamanı, IDE'ye yüklenemez" 17688 17689#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei 17690msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly." 17691msgstr "\" Yalnızca çalışma zamanı\" paketleri yalnızca projeler içindir. IDE'ye yüklenemez." 17692 17693#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst 17694msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them." 17695msgstr "\" Çalıştırma zamanı\" paketleri projeler tarafından kullanılabilir. Bazı tasarım zaman paketleri gerektirmedikçe IDE'ye yüklenemezler." 17696 17697#: lazarusidestrconsts.lisruntofailed 17698msgid "Run-to failed" 17699msgstr "Çalıştırma başarısız oldu" 17700 17701#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden 17702msgid "Abstract Methods - not yet overridden" 17703msgstr "Özet Yöntemler - henüz geçersiz kılınmadı" 17704 17705#: lazarusidestrconsts.lissamabstractmethodsof 17706#, object-pascal-format 17707msgid "Abstract methods of %s" 17708msgstr "Özet metotların %s" 17709 17710#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration 17711msgid "Cursor is not in a class declaration" 17712msgstr "İmleç sınıf bildirgesinde değil" 17713 17714#: lazarusidestrconsts.lissamideisbusy 17715msgid "IDE is busy" 17716msgstr "IDE meşgul" 17717 17718#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods 17719#, object-pascal-format 17720msgid "%s is an abstract class, it has %s abstract methods." 17721msgstr "%s soyut bir sınıf, %s soyut yöntemleri var." 17722 17723#: lazarusidestrconsts.lissamnoabstractmethodsfound 17724msgid "No abstract methods found" 17725msgstr "Soyut yöntem bulunamadı" 17726 17727#: lazarusidestrconsts.lissamoverrideallselected 17728msgid "Override all selected" 17729msgstr "Seçilenlerin tümünü geçersiz kıl" 17730 17731#: lazarusidestrconsts.lissamoverridefirstselected 17732msgid "Override first selected" 17733msgstr "İlk seçilenleri geçersiz kıl" 17734 17735#: lazarusidestrconsts.lissamselectnone 17736msgid "Select none" 17737msgstr "Hiçbir şey seçilmedi" 17738 17739#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf 17740#, object-pascal-format 17741msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" 17742msgstr "%s geçersiz kılacak soyut metotlar var%s, saplamaların oluşturulması gereken metotları seçer:" 17743 17744#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride 17745msgid "There are no abstract methods left to override." 17746msgstr "Geçersiz kılınacak soyut yöntem yoktur." 17747 17748#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth 17749msgid "This method can not be overridden because it is defined in the current class" 17750msgstr "Geçerli yöntemde tanımlandığı için bu yöntem geçersiz kılınamaz" 17751 17752#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus 17753msgid "Unable to show abstract methods of the current class, because" 17754msgstr "Geçerli sınıfın soyut yöntemlerini gösteremiyor, çünkü" 17755 17756#: lazarusidestrconsts.lissave 17757msgid "Save" 17758msgstr "Kaydet" 17759 17760#: lazarusidestrconsts.lissaveall 17761msgid "Save All" 17762msgstr "Hepsini kaydet" 17763 17764#: lazarusidestrconsts.lissaveallchecked 17765msgid "Save All Checked" 17766msgstr "Hepsini Kaydet" 17767 17768#: lazarusidestrconsts.lissaveallmodified 17769msgid "Save all modified files" 17770msgstr "Değiştirilen tüm dosyaları kaydet" 17771 17772#: lazarusidestrconsts.lissavealloriginalmessagestofile 17773msgid "Save All/Original Messages to File ..." 17774msgstr "Tümünü Kaydet/Orijinal İletileri Dosyaya Kaydet ..." 17775 17776#: lazarusidestrconsts.lissaveandexitdialog 17777msgid "Save and exit dialog" 17778msgstr "Kaydet ve dialoğu kapat" 17779 17780#: lazarusidestrconsts.lissaveandrebuildide 17781msgid "Save and rebuild IDE" 17782msgstr "Kaydet ve IDE'yi yeniden oluştur" 17783 17784#: lazarusidestrconsts.lissaveas 17785msgid "Save As" 17786msgstr "Farklı kaydet" 17787 17788#: lazarusidestrconsts.lissavechangedfiles 17789msgid "Save changed files?" 17790msgstr "Değiştirilen dosyaları kaydet?" 17791 17792#: lazarusidestrconsts.lissavechanges 17793msgid "Save changes?" 17794msgstr "Değişiklikleri Kaydet?" 17795 17796#: lazarusidestrconsts.lissavechangestoproject 17797#, object-pascal-format 17798msgid "Save changes to project %s?" 17799msgstr "Değişiklikler %s projesine kaydedilsin mi?" 17800 17801#: lazarusidestrconsts.lissavecurrenteditorfile 17802msgid "Save current editor file" 17803msgstr "Geçerli düzenleyici dosyasını kaydet" 17804 17805#: lazarusidestrconsts.lissavedwithidesettings 17806msgid "Saved with IDE settings" 17807msgstr "IDE ayarları ile kaydedildi" 17808 17809#: lazarusidestrconsts.lissavedwithprojectsession 17810msgid "Saved with project session" 17811msgstr "Proje oturumu ile kaydedildi" 17812 17813#: lazarusidestrconsts.lissavefileas 17814msgid "Save file as" 17815msgstr "Dosyayı farklı kaydet" 17816 17817#: lazarusidestrconsts.lissavefilebeforeclosingform 17818#, object-pascal-format 17819msgid "Save file \"%s\"%sbefore closing form \"%s\"?" 17820msgstr "\"%s\" formunu kapatmadan önce \"%s\"%s dosyasını kaydet?" 17821 17822#: lazarusidestrconsts.lissavemacroas 17823msgid "Save macro as" 17824msgstr "Makroyu farklı kaydet" 17825 17826#: lazarusidestrconsts.lissavemessages 17827msgid "Save messages" 17828msgstr "Mesajları kaydet" 17829 17830#: lazarusidestrconsts.lissaveproject 17831#, object-pascal-format 17832msgid "Save project %s (*%s)" 17833msgstr "Projeyi %s kaydet (*%s)" 17834 17835#: lazarusidestrconsts.lissavesessionchangestoproject 17836#, object-pascal-format 17837msgid "Save session changes to project %s?" 17838msgstr "Oturum değişiklikleri %s projesine kaydedilsin mi?" 17839 17840#: lazarusidestrconsts.lissavesessionfoldstate 17841msgid "Save fold info" 17842msgstr "Katlama bilgisini kaydet" 17843 17844#: lazarusidestrconsts.lissavesessionfoldstatehint 17845msgid "Code editor supports folding (temporarily hiding) blocks of code." 17846msgstr "Kod editörü, blok bloklamayı (geçici olarak gizleme) destekler." 17847 17848#: lazarusidestrconsts.lissavesessionjumphistory 17849msgid "Save jump history" 17850msgstr "Atlama geçmişini kaydet" 17851 17852#: lazarusidestrconsts.lissavesessionjumphistoryhint 17853msgid "Ctrl-Click on an identifier in code editor is stored in jump history." 17854msgstr "Kod düzenleyicisinde bir tanımlayıcıya Ctrl-tıklama atlama geçmişinde saklanır." 17855 17856#: lazarusidestrconsts.lissavesettings 17857msgid "Save Settings" 17858msgstr "Ayarları kaydet" 17859 17860#: lazarusidestrconsts.lissaveshownmessagestofile 17861msgid "Save Shown Messages to File ..." 17862msgstr "Gösterilen Mesajları Dosyaya Kaydet ..." 17863 17864#: lazarusidestrconsts.lissavespace 17865msgid "Save " 17866msgstr "Kaydet " 17867 17868#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn 17869#, object-pascal-format 17870msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s." 17871msgstr "\"%s\" dosyasının \"%s\" olarak kaydedilmesi, %s, %s satırındaki karakterleri kaybeder." 17872 17873#: lazarusidestrconsts.lisscalingfactor 17874msgid "Scaling factor:" 17875msgstr "Ölçekleme faktörü:" 17876 17877#: lazarusidestrconsts.lisscanfilesinparentdir 17878msgid "Scan files in parent directory" 17879msgstr "Üst dizindeki dosyaları tara" 17880 17881#: lazarusidestrconsts.lisscanfilesinparentdirhint 17882msgid "Search for source files in sibling directories (parent directory and its children)" 17883msgstr "Kardeş dizinlerde (üst dizin ve alt öğeleri) kaynak dosyaları ara" 17884 17885#: lazarusidestrconsts.lisscanning 17886msgid "Scanning" 17887msgstr "Taranıyor" 17888 17889#: lazarusidestrconsts.lisscanning2 17890#, object-pascal-format 17891msgid "%s. Scanning ..." 17892msgstr "%s. Taranıyor..." 17893 17894#: lazarusidestrconsts.lisscanparentdir 17895msgid "Scanning parent directory" 17896msgstr "Üst dizini tarıyor" 17897 17898#: lazarusidestrconsts.lissearchpaths2 17899msgid "Search paths" 17900msgstr "Yolları ara" 17901 17902#: lazarusidestrconsts.lissearchunit 17903#, object-pascal-format 17904msgid "Search Unit \"%s\"" 17905msgstr "Birim Ara \"%s\"" 17906 17907#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor 17908msgid "secondary config directory where Lazarus searches for config template files. Default is " 17909msgstr "lazarus'un config şablon dosyalarını aradığı ikincil config dizini. Varsayılan " 17910 17911#: lazarusidestrconsts.lissecondaryconfigpath 17912msgid "Secondary config path" 17913msgstr "İkincil yapılandırma yolu" 17914 17915#: lazarusidestrconsts.lissecondtest 17916msgid "&Second test" 17917msgstr "İkinci test" 17918 17919#: lazarusidestrconsts.lisseemessages 17920msgid "See messages." 17921msgstr "Bakın mesajlar." 17922 17923#: lazarusidestrconsts.lisseeprojectprojectinspector 17924#, object-pascal-format 17925msgid "%sSee Project -> Project Inspector" 17926msgstr "%s Projeyi Göster-> Proje Denetçisi" 17927 17928#: lazarusidestrconsts.lisselectahelpitem 17929msgid "Select a help item:" 17930msgstr "Bir yardım öğesi seçin:" 17931 17932#: lazarusidestrconsts.lisselectanode 17933msgid "Select a node" 17934msgstr "Bir düğüm seçin" 17935 17936#: lazarusidestrconsts.lisselectanotherlclwidgetset 17937msgid "Select another LCL widgetset (macro LCLWidgetType)" 17938msgstr "Başka bir LCL widget'ı seçin (makro LCLWidgetType)" 17939 17940#: lazarusidestrconsts.lisselectdfmfiles 17941msgid "Select Delphi form files (*.dfm)" 17942msgstr "Delphi form dosyalarını seçin (* .dfm)" 17943 17944#: lazarusidestrconsts.lisselected 17945msgid "Selected" 17946msgstr "Seçilmiş" 17947 17948#: lazarusidestrconsts.lisselectedaddition 17949msgid "Selected addition:" 17950msgstr "Seçilen ek:" 17951 17952#: lazarusidestrconsts.lisselectedandchildcontrols 17953msgid "Selected and child controls" 17954msgstr "Seçilmiş ve alt kontroller" 17955 17956#: lazarusidestrconsts.lisselectedbottomneighbour 17957msgid "(selected bottom neighbour)" 17958msgstr "(Alt komşu seçildi)" 17959 17960#: lazarusidestrconsts.lisselectedcommandsmapping 17961msgid "Selected Command's Mapping" 17962msgstr "Seçilmiş Komutun Haritalaması" 17963 17964#: lazarusidestrconsts.lisselectedforinstallation 17965msgid "selected for installation" 17966msgstr "kurulum için seçildi" 17967 17968#: lazarusidestrconsts.lisselectedforuninstallation 17969msgid "selected for uninstallation" 17970msgstr "kaldırma için seçildi" 17971 17972#: lazarusidestrconsts.lisselectedleftneighbour 17973msgid "(selected left neighbour)" 17974msgstr "(Seçili sol komşu)" 17975 17976#: lazarusidestrconsts.lisselectedmessageinmessageswindow 17977msgid "Selected message in messages window:" 17978msgstr "Mesaj penceresinde seçilen mesaj:" 17979 17980#: lazarusidestrconsts.lisselectedmodeswerecompiled 17981#, object-pascal-format 17982msgid "Selected %d modes were successfully compiled." 17983msgstr "Seçilen %d modlar başarıyla derlendi." 17984 17985#: lazarusidestrconsts.lisselectedrightneighbour 17986msgid "(selected right neighbour)" 17987msgstr "(Seçilmiş doğru komşu)" 17988 17989#: lazarusidestrconsts.lisselectedtopneighbour 17990msgid "(selected top neighbour)" 17991msgstr "(Seçkin üst komşu)" 17992 17993#: lazarusidestrconsts.lisselectfile 17994msgid "Select the file" 17995msgstr "Dosyayı seçin" 17996 17997#: lazarusidestrconsts.lisselectfpcpath 17998msgid "Select the path where FPC is installed" 17999msgstr "FPC'nin yüklendiği yolu seçin" 18000 18001#: lazarusidestrconsts.lisselectfpcsourcedirectory 18002msgid "Select FPC source directory" 18003msgstr "FPC kaynak klasörünü seçin" 18004 18005#: lazarusidestrconsts.lisselectframe 18006msgid "Select Frame" 18007msgstr "Çerçeve Seç" 18008 18009#: lazarusidestrconsts.lisselectionexceedsstringconstant 18010msgid "Selection exceeds string constant" 18011msgstr "Seçim dize sabitini aşıyor" 18012 18013#: lazarusidestrconsts.lisselectiontool 18014msgid "Selection tool" 18015msgstr "Seçim aracı" 18016 18017#: lazarusidestrconsts.lisselectlazarussourcedirectory 18018msgid "Select Lazarus source directory" 18019msgstr "Lazarus kaynak klasörü seçin" 18020 18021#: lazarusidestrconsts.lisselectpathto 18022#, object-pascal-format 18023msgid "Select path to %s" 18024msgstr "%s yolunu seç" 18025 18026#: lazarusidestrconsts.lisselecttargetdirectory 18027msgid "Select target directory" 18028msgstr "Hedef klasörü seçin" 18029 18030#: lazarusidestrconsts.lissetallcolors 18031msgid "Set all colors:" 18032msgstr "Tüm renkleri ayarla:" 18033 18034#: lazarusidestrconsts.lissetdefault 18035msgid "Set default" 18036msgstr "Varsayılana ayarla" 18037 18038#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang 18039msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." 18040msgstr "Derleyici mesajlarını başka bir dile çevirmek için bunu ayarlayın (yani İngilizce değil). Örneğin: Almanca: $ (FPCSrcDir) /compiler/msg/errordu.msg." 18041 18042#: lazarusidestrconsts.lissetupdefaultindentation 18043msgid "(Set up default indentation)" 18044msgstr "(Varsayılan girintiyi ayarla)" 18045 18046#: lazarusidestrconsts.lisshort 18047msgid "Short:" 18048msgstr "Kısa:" 18049 18050#: lazarusidestrconsts.lisshortnopath 18051msgid "Short, no path" 18052msgstr "Kısa, yol yok" 18053 18054#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications 18055#, object-pascal-format 18056msgid "Should the component \"%s\" be auto created when the application starts?" 18057msgstr "Uygulama başlatıldığında \"%s\" bileşeni otomatik olarak oluşturulmalı mı?" 18058 18059#: lazarusidestrconsts.lisshow 18060msgid "Show" 18061msgstr "Göster" 18062 18063#: lazarusidestrconsts.lisshowabstractmethodsof 18064#, object-pascal-format 18065msgid "Show abstract methods of \"%s\"" 18066msgstr "Soyut yöntemleri göster \"%s\"" 18067 18068#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector 18069msgid "Show component tree" 18070msgstr "Bileşen ağacını göster" 18071 18072#: lazarusidestrconsts.lisshowconsole 18073msgid "Show console" 18074msgstr "Konsolu göster" 18075 18076#: lazarusidestrconsts.lisshowdeclarationhints 18077msgid "Show declaration hints" 18078msgstr "Bildiri ipuçlarını göster" 18079 18080#: lazarusidestrconsts.lisshowdifferencesbetweenmodes 18081msgid "Show differences between modes ..." 18082msgstr "Modlar arasındaki farkları göster ..." 18083 18084#: lazarusidestrconsts.lisshowemptyunitspackages 18085msgid "Show empty units/packages" 18086msgstr "Boş birimleri/paketleri göster" 18087 18088#: lazarusidestrconsts.lisshowfpcmessagelinescompiled 18089msgid "Show FPC message \"lines compiled\"" 18090msgstr "FPC mesajı \"satırlar derlendi\" yi göster" 18091 18092#: lazarusidestrconsts.lisshowglyphsfor 18093msgid "Show Glyphs for" 18094msgstr "Glifleri Göster" 18095 18096#: lazarusidestrconsts.lisshowgutterinobjectinspector 18097msgid "Show gutter" 18098msgstr "Oluğu göster" 18099 18100#: lazarusidestrconsts.lisshowhelp 18101msgid "Show help" 18102msgstr "Yardımı göster" 18103 18104#: lazarusidestrconsts.lisshowhintsinobjectinspector 18105msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector" 18106msgid "Show hints" 18107msgstr "İpuçlarını göster" 18108 18109#: lazarusidestrconsts.lisshowidentifiers 18110msgid "Show identifiers" 18111msgstr "Tanımlayıcıları göster" 18112 18113#: lazarusidestrconsts.lisshowinfoboxinobjectinspector 18114msgid "Show information box" 18115msgstr "Bilgi kutusunu göster" 18116 18117#: lazarusidestrconsts.lisshowmessagetypeid 18118msgid "Show Message Type ID" 18119msgstr "Mesaj Tip Kimliğini Göster" 18120 18121#: lazarusidestrconsts.lisshowmultiplelines 18122msgid "Show multiple lines" 18123msgstr "Çoklu satırları Göster" 18124 18125#: lazarusidestrconsts.lisshowonlymodified 18126msgid "Show only modified" 18127msgstr "Sadece değişiklikleri göster" 18128 18129#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead 18130msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window." 18131msgstr "Yalnızca görev çubuğunda pencere başına bir yerine tüm IDE için bir düğme gösterin. Cinnamon gibi bazı Linux Pencere Yöneticileri bunu desteklemez ve her zaman pencere başına bir düğme gösterir." 18132 18133#: lazarusidestrconsts.lisshowoutput 18134msgid "Show output" 18135msgstr "Çıktıyı göster" 18136 18137#: lazarusidestrconsts.lisshowoverviewgutter 18138msgid "Show overview gutter" 18139msgstr "Genel bakış oluklarını göster" 18140 18141#: lazarusidestrconsts.lisshowpackages 18142msgid "Show packages" 18143msgstr "Paketleri göster" 18144 18145#: lazarusidestrconsts.lisshowpositionofsourceeditor 18146msgid "Show position of source editor" 18147msgstr "Kaynak düzenleyicinin konumunu göster" 18148 18149#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector 18150msgid "Show property filter" 18151msgstr "Özellik filtresini göster" 18152 18153#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop 18154msgid "Show recently used identifiers at top" 18155msgstr "En son kullanılan tanımlayıcıları en üstte göster" 18156 18157#: lazarusidestrconsts.lisshowrelativepaths 18158msgid "Show relative paths" 18159msgstr "Göreli yolları göster" 18160 18161#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy 18162msgid "Shows all controls in tree hierarchy." 18163msgstr "Tüm kontrolleri ağaç hiyerarşisinde gösterir." 18164 18165#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty 18166msgid "A box at the bottom shows description for the selected property." 18167msgstr "Alttaki kutu, seçili mülk için açıklama gösterir." 18168 18169#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings 18170msgid "Show setup dialog for most important settings" 18171msgstr "En önemli ayarlar için kurulum iletişim kutusunu göster" 18172 18173#: lazarusidestrconsts.lisshowspecialcharacters 18174msgid "Show special characters" 18175msgstr "Özel karakterleri göster" 18176 18177#: lazarusidestrconsts.lisshowstatusbarinobjectinspector 18178msgid "Show statusbar" 18179msgstr "Durum çubuğunu göster" 18180 18181#: lazarusidestrconsts.lisshowunits 18182msgid "Show units" 18183msgstr "Birimleri göster" 18184 18185#: lazarusidestrconsts.lisshowunitswithinitialization 18186msgid "Show units with initialization/finalization sections" 18187msgstr "İnitialization/finalization bölümlerine sahip birimleri göster" 18188 18189#: lazarusidestrconsts.lisshowunitswithinitializationhint 18190msgid "These units may initialize global data used by the program/application. Remove with care." 18191msgstr "Bu birimler, program/uygulama tarafından kullanılan genel verileri başlatabilir. Dikkatli bir şekilde kaldırın." 18192 18193#: lazarusidestrconsts.lisshowunusedunits 18194msgid "Show unused units ..." 18195msgstr "Kullanılmayan birimleri göster ..." 18196 18197#: lazarusidestrconsts.lisshowvaluehintswhiledebugging 18198msgid "Show value hints while debugging" 18199msgstr "Hata ayıklama sırasında değer ipuçlarını göster" 18200 18201#: lazarusidestrconsts.lisshowversionandexit 18202msgid "show version and exit" 18203msgstr "sürümü göster ve çık" 18204 18205#: lazarusidestrconsts.lisshrinktosmal 18206msgid "Shrink to smallest" 18207msgstr "En küçüğe küçült" 18208 18209#: lazarusidestrconsts.lissibling 18210msgid "Sibling" 18211msgstr "Kardeş" 18212 18213#: lazarusidestrconsts.lissimpleprogram 18214msgid "Simple Program" 18215msgstr "Basit Program" 18216 18217#: lazarusidestrconsts.lissimpleprogramprogramdescriptor 18218msgid "A most simple Free Pascal command line program." 18219msgstr "En basit Free Pascal komut satırı programı." 18220 18221#: lazarusidestrconsts.lissimplesyntax 18222msgid "Simple syntax" 18223msgstr "Basit sözdizimi" 18224 18225#: lazarusidestrconsts.lisskiperrors 18226msgid "Skip errors" 18227msgstr "Hataları atla" 18228 18229#: lazarusidestrconsts.lisskipfile 18230msgid "Skip file" 18231msgstr "Dosyayı atla" 18232 18233#: lazarusidestrconsts.lisskipfileandcontinueloading 18234msgid "Skip file and continue loading" 18235msgstr "Dosyayı atla ve yüklemeye devam et" 18236 18237#: lazarusidestrconsts.lisskiploadinglastproject 18238msgid "Skip loading last project" 18239msgstr "Son proje yüklemeyi atla" 18240 18241#: lazarusidestrconsts.lisskipthesewarnings 18242msgid "Skip these warnings" 18243msgstr "Bu uyarıları atla" 18244 18245#: lazarusidestrconsts.lisslowerbutmoreaccurate 18246msgid "Slower but more accurate." 18247msgstr "Daha yavaş ama daha doğru." 18248 18249#: lazarusidestrconsts.lissmallerratherthanfaster 18250msgid "Smaller rather than faster" 18251msgstr "Daha hızlı, daha küçük" 18252 18253#: lazarusidestrconsts.lissmatches 18254msgid "Matches" 18255msgstr "Karşılaşmalar" 18256 18257#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented 18258msgid "Sorry, this type is not yet implemented" 18259msgstr "Üzgünüz, bu tür henüz uygulanmadı" 18260 18261#: lazarusidestrconsts.lissortforscope 18262msgid "Sort for scope" 18263msgstr "Kapsam alanı için sıralama" 18264 18265#: lazarusidestrconsts.lissorting 18266msgid "Sorting" 18267msgstr "Sıralama" 18268 18269#: lazarusidestrconsts.lissortselascending 18270msgid "Ascending" 18271msgstr "Artan" 18272 18273#: lazarusidestrconsts.lissortselcasesensitive 18274msgid "&Case Sensitive" 18275msgstr "&Harfe duyarlı" 18276 18277#: lazarusidestrconsts.lissortseldescending 18278msgid "Descending" 18279msgstr "Azalan" 18280 18281#: lazarusidestrconsts.lissortseldomain 18282msgid "Domain" 18283msgstr "Alan" 18284 18285#: lazarusidestrconsts.lissortselignorespace 18286msgid "Ignore Space" 18287msgstr "Alanı Yoksay" 18288 18289#: lazarusidestrconsts.lissortsellines 18290msgid "Lines" 18291msgstr "Satırlar" 18292 18293#: lazarusidestrconsts.lissortseloptions 18294msgctxt "lazarusidestrconsts.lissortseloptions" 18295msgid "Options" 18296msgstr "Seçenekler" 18297 18298#: lazarusidestrconsts.lissortselparagraphs 18299msgid "Paragraphs" 18300msgstr "Paragraf" 18301 18302#: lazarusidestrconsts.lissortselpreview 18303msgctxt "lazarusidestrconsts.lissortselpreview" 18304msgid "Preview" 18305msgstr "Önizleme" 18306 18307#: lazarusidestrconsts.lissortselsort 18308msgid "Accept" 18309msgstr "Onayla" 18310 18311#: lazarusidestrconsts.lissortselsortselection 18312msgid "Sort selection" 18313msgstr "Sıralama seçimi" 18314 18315#: lazarusidestrconsts.lissortselwords 18316msgctxt "lazarusidestrconsts.lissortselwords" 18317msgid "Words" 18318msgstr "Kelimeler" 18319 18320#: lazarusidestrconsts.lissortunicoderangelistalphabetically 18321msgid "Sort Unicode range list alphabetically" 18322msgstr "Unicode aralık listesini alfabetik olarak sırala" 18323 18324#: lazarusidestrconsts.lissourceanddestinationaresame 18325#, object-pascal-format 18326msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory." 18327msgstr "Kaynak \"%s\"%s ve Hedef \"%s\"%s dizinleri aynıdır. Lütfen başka bir dizin seçin." 18328 18329#: lazarusidestrconsts.lissourceanddestinationarethesame 18330#, object-pascal-format 18331msgid "Source and Destination are the same:%s%s" 18332msgstr "Kaynak ve Hedef aynı: %s%s" 18333 18334#: lazarusidestrconsts.lissourcebreakpoint 18335msgid "&Source Breakpoint ..." 18336msgstr "&Kaynak Kesme Noktası ..." 18337 18338#: lazarusidestrconsts.lissourcedirectorydoesnotexist 18339#, object-pascal-format 18340msgid "Source directory \"%s\" does not exist." 18341msgstr "Kaynak dizini \"%s\" mevcut değil." 18342 18343#: lazarusidestrconsts.lissourceeditorwindowmanager 18344msgid "Source Editor Window Manager" 18345msgstr "Kaynak Düzenleyici Pencere Yöneticisi" 18346 18347#: lazarusidestrconsts.lissourcemodified 18348msgid "Source modified" 18349msgstr "Kaynak değiştirildi" 18350 18351#: lazarusidestrconsts.lissourceofpagehaschangedsave 18352#, object-pascal-format 18353msgid "Source of page \"%s\" has changed. Save?" 18354msgstr "Sayfa kaynağı \"%s\" değişti Kaydedilsin mi?" 18355 18356#: lazarusidestrconsts.lissourceofpagehaschangedsaveex 18357#, object-pascal-format 18358msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" 18359msgstr "Sayfaların kaynakları değişti. Sayfayı kaydet \"%s\"? (%d daha fazla)" 18360 18361#: lazarusidestrconsts.lissourcepaths 18362msgid "Source paths" 18363msgstr "Kaynak yolları" 18364 18365#: lazarusidestrconsts.lisspaceequally 18366msgid "Space equally" 18367msgstr "Eşit alan" 18368 18369#: lazarusidestrconsts.lissrcos 18370msgid "Src OS" 18371msgstr "Src OS" 18372 18373#: lazarusidestrconsts.lisssearching 18374msgid "Searching" 18375msgstr "Arama" 18376 18377#: lazarusidestrconsts.lisssearchtext 18378msgid "Search text" 18379msgstr "Metin ara" 18380 18381#: lazarusidestrconsts.lisstartconversion 18382msgid "Start Conversion" 18383msgstr "Dönüşümü Başlat" 18384 18385#: lazarusidestrconsts.lisstartide 18386msgid "Start IDE" 18387msgstr "IDE'yi Başlat" 18388 18389#: lazarusidestrconsts.lisstartwithanewproject 18390msgid "Start with a new project" 18391msgstr "Yeni bir proje ile başla" 18392 18393#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass 18394msgid "Statusbar shows the property's name and the class where it is published." 18395msgstr "Durum çubuğu, mülkün adını ve yayınlandığı sınıfı gösterir." 18396 18397#: lazarusidestrconsts.lisstop 18398msgid "Stop" 18399msgstr "Durdur" 18400 18401#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject 18402msgid "Stop current debugging and rebuild project?" 18403msgstr "Mevcut hata ayıklaması durdurulsun ve proje yeniden oluşturulsun mu?" 18404 18405#: lazarusidestrconsts.lisstopdebugging 18406msgid "Stop Debugging?" 18407msgstr "Hata ayıklama durdurulsun mu?" 18408 18409#: lazarusidestrconsts.lisstopdebugging2 18410msgid "Stop debugging?" 18411msgstr "Hata ayıklama dursun mu?" 18412 18413#: lazarusidestrconsts.lisstoponexception 18414msgid "Stop on exception" 18415msgstr "İstisna Durdur" 18416 18417#: lazarusidestrconsts.lisstopthedebugging 18418msgid "Stop the debugging?" 18419msgstr "Hata ayıklama durdurulsun mu?" 18420 18421#: lazarusidestrconsts.lisstorepathdelimitersandas 18422msgid "Store path delimiters \\ and / as" 18423msgstr "Yol sınırlayıcıları \\ ve / ekle" 18424 18425#: lazarusidestrconsts.lisstrangelpifile 18426msgid "Strange lpi file" 18427msgstr "Garip lpi dosyası" 18428 18429#: lazarusidestrconsts.lisstreamingerror 18430msgid "Streaming error" 18431msgstr "Akış hatası" 18432 18433#: lazarusidestrconsts.lisstring 18434msgid "String" 18435msgstr "String" 18436 18437#: lazarusidestrconsts.lisstyle 18438msgctxt "lazarusidestrconsts.lisstyle" 18439msgid "Style" 18440msgstr "Stil" 18441 18442#: lazarusidestrconsts.lissubprocedure 18443msgid "Sub Procedure" 18444msgstr "Alt Prosedür" 18445 18446#: lazarusidestrconsts.lissubprocedureonsamelevel 18447msgid "Sub Procedure on same level" 18448msgstr "Aynı seviyedeki Alt Prosedür" 18449 18450#: lazarusidestrconsts.lissuccess 18451msgid "Success" 18452msgstr "Başarılı" 18453 18454#: lazarusidestrconsts.lissuccessfullyexported 18455#, object-pascal-format 18456msgid "Successfully exported to \"%s\"." 18457msgstr "%s\" e başarıyla dışa aktarıldı." 18458 18459#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes 18460#, object-pascal-format 18461msgid "Successfully exported %d BuildModes to \"%s\"." 18462msgstr "%d YapıModu \"%s\" ya başarıyla dışa aktarıldı." 18463 18464#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions 18465#, object-pascal-format 18466msgid "Successfully exported compiler options to \"%s\"." 18467msgstr "Derleyici seçenekleri \"%s\" olarak başarıyla dışa aktarıldı." 18468 18469#: lazarusidestrconsts.lissuccessfullyimported 18470#, object-pascal-format 18471msgid "Successfully imported from \"%s\"." 18472msgstr "\"%s\" den başarıyla içe aktarıldı." 18473 18474#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes 18475#, object-pascal-format 18476msgid "Successfully imported %d BuildModes from \"%s\"." 18477msgstr "%d BuildModes başarıyla \"%s\" dizininden içe aktarıldı." 18478 18479#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions 18480#, object-pascal-format 18481msgid "Successfully imported compiler options from \"%s\"." 18482msgstr "\"%s\" dizininden derleyici seçenekleri başarıyla alındı." 18483 18484#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase 18485msgid "Suggest default name of new file in lowercase" 18486msgstr "Yeni dosyanın varsayılan adını küçük harflerle öner" 18487 18488#: lazarusidestrconsts.lissuspiciousincludepath 18489msgid "Suspicious include path" 18490msgstr "Şüpheli yol içeriyor" 18491 18492#: lazarusidestrconsts.lissuspiciousunitpath 18493msgid "Suspicious unit path" 18494msgstr "Şüpheli birim yolu" 18495 18496#: lazarusidestrconsts.lissvuoinvalidvariablename 18497msgid "Invalid variable name" 18498msgstr "Geçersiz değişken adı" 18499 18500#: lazarusidestrconsts.lissvuoisnotavalididentifier 18501#, object-pascal-format 18502msgid "\"%s\" is not a valid identifier." 18503msgstr "\"%s\" geçerli bir tanımlayıcı değil." 18504 18505#: lazarusidestrconsts.lissvuooverridesystemvariable 18506msgid "Override system variable" 18507msgstr "Sistem değişkenini geçersiz kıl" 18508 18509#: lazarusidestrconsts.lisswitchfiltersettings 18510msgid "Switch Filter Settings" 18511msgstr "Filtre Ayarlarını Değiştir" 18512 18513#: lazarusidestrconsts.lisswitchtofavoritestabafterasking 18514msgid "Switch to Favorites tab after asking for component name." 18515msgstr "Bileşen adını sorduktan sonra Favoriler sekmesine geçin." 18516 18517#: lazarusidestrconsts.lissyntaxmode 18518msgid "Syntax mode" 18519msgstr "Sözdizimi modu" 18520 18521#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg 18522msgid "system.ppu not found. Check your fpc.cfg." 18523msgstr "system.ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin." 18524 18525#: lazarusidestrconsts.listab 18526msgid "Tab" 18527msgstr "Sekme" 18528 18529#: lazarusidestrconsts.listaborderconfirmsort 18530#, object-pascal-format 18531msgid "Sort tab orders of all child controls of \"%s\" by their positions?" 18532msgstr "\"%s\" konumundaki tüm alt denetimlerin sekme sıralarını konumlarına göre mi?" 18533 18534#: lazarusidestrconsts.listaborderdownhint 18535msgid "Move the selected control down in tab order" 18536msgstr "Seçilen denetimi sekme sırasına getir" 18537 18538#: lazarusidestrconsts.listaborderof 18539#, object-pascal-format 18540msgid "Tab Order of %s" 18541msgstr "%s Sekmesi Sırası" 18542 18543#: lazarusidestrconsts.listaborderrecursionhint 18544msgid "Calculate tab order recursively for child controls" 18545msgstr "Alt kontroller için tekrarlı olarak sekme sırasını hesaplayın" 18546 18547#: lazarusidestrconsts.listaborderrecursively 18548msgid "recursively" 18549msgstr "yinelemeli" 18550 18551#: lazarusidestrconsts.listabordersorthint 18552msgid "Calculate tab order for controls by their X- and Y- positions" 18553msgstr "Kontroller için X ve Y pozisyonlarına göre sekme sırasını hesapla" 18554 18555#: lazarusidestrconsts.listaborderuphint 18556msgid "Move the selected control up in tab order" 18557msgstr "Seçili denetimi sekme sırasına taşıyın" 18558 18559#: lazarusidestrconsts.listabsfor 18560#, object-pascal-format 18561msgid "Tabs for %s" 18562msgstr "%s için sekmeler" 18563 18564#: lazarusidestrconsts.listakesnapshot 18565msgid "Take a Snapshot" 18566msgstr "Ekran Görüntüsü Alın" 18567 18568#: lazarusidestrconsts.listarget 18569msgid "Target:" 18570msgstr "Hedef:" 18571 18572#: lazarusidestrconsts.listarget2 18573#, object-pascal-format 18574msgid ", Target: %s" 18575msgstr ", Hedef: %s" 18576 18577#: lazarusidestrconsts.listargetcpu 18578msgid "Target CPU" 18579msgstr "Hedef CPU" 18580 18581#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory 18582msgid "Target file name: (-o, empty = use unit output directory)" 18583msgstr "Hedef dosya adı: (-o, boş = birim çıktı dizinini kullan)" 18584 18585#: lazarusidestrconsts.listargetfilenameo 18586msgid "Target file name (-o):" 18587msgstr "Hedef dosya adı (-o):" 18588 18589#: lazarusidestrconsts.listargetfilenameofproject 18590msgid "Target filename of project" 18591msgstr "Projenin hedef dosya adı" 18592 18593#: lazarusidestrconsts.listargetfilenameplusparams 18594msgid "Target filename + params" 18595msgstr "Hedef dosya adı + parametreler" 18596 18597#: lazarusidestrconsts.listargetisreadonly 18598msgid "Target is read only" 18599msgstr "Hedef yalnızca okunabilir" 18600 18601#: lazarusidestrconsts.listargetos 18602msgctxt "lazarusidestrconsts.listargetos" 18603msgid "Target OS" 18604msgstr "Hedeflenen İşletim Sistemi" 18605 18606#: lazarusidestrconsts.listemplateeditparamcell 18607msgid "Editable Cell" 18608msgstr "Düzenlenebilir Hücre" 18609 18610#: lazarusidestrconsts.listemplateeditparamcellhelp 18611#, object-pascal-format 18612msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")." 18613msgstr "Düzenlenebilir bir Hücre yerleştirin. Hücreler sekme tuşunu kullanarak gezilebilir.%0:s \"param \" makrosu virgülle ayrılmış değişkenlerin bir listesini alır.%0:sİlk değişken varsayılan değerdir.%0:sİkinci değişken (isteğe bağlı) kullanılabilir hücreyi başka bir hücreye bağlamak için (syncro edit).%0:s%0:s iken param ( \"foo \") param (foo) yapar;%0:sIki bağımsız metinle her ikisi de \" foo \".%0:s Tırnaklar isteğe bağlıdır.%0:s%0:s param (\" foo \")> 0 ve param (\" foo \", sync = 1) <99 sonra%0:sEkle 2, her ikisini de düzenleyen bağlantılı hücreleri diğerini de değiştirecektir.%0:s \"1 \" değeri, diğer \"param () \" nin konumunu belirtir, eğer daha fazla param varsa:%0:s, param ( \"bar \") ve param (foo)> 0 ve param (foo, sync = 2) <99 sonra%0:sİkinci ve üçüncü bağlanırsa (3. \"2 \" anlamına gelir). %0:s%0:s \"Eşitleme \", \"s \" olarak kısaltılabilir:%0:s eğer param ( \"foo \")> 0 ve param ( \"foo \", s = 1) <99 sonra%0:s%0:s param ( \"bar \") ve param ( \"foo \")> 0 ise ve param ( \"foo \", sync) <99 sonra%0:sİkinci ve üçüncü bağlantılar.%0:s Not: \"Senkronizasyon \" s konum yok ve \"= \" yok, bu nedenle aynı varsayılanla önceki hücreye eşitlenir (bu durumda \"foo \")." 18614 18615#: lazarusidestrconsts.listemplatefile 18616msgid "Template file" 18617msgstr "Şablon dosyası" 18618 18619#: lazarusidestrconsts.listestdirectory 18620msgid "Test directory" 18621msgstr "Dizini test et" 18622 18623#: lazarusidestrconsts.listesturl 18624msgid "Test URL" 18625msgstr "Test URL'si" 18626 18627#: lazarusidestrconsts.listheapplicationbundlewascreatedfor 18628#, object-pascal-format 18629msgid "The Application Bundle was created for \"%s\"" 18630msgstr "Uygulama Paketi oluşturuldu \"%s\"" 18631 18632#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro 18633#, object-pascal-format 18634msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." 18635msgstr "\"%s\"sınıfı bir TControl'tir ve olmayan bir denetleyiciye yapıştırılamaz.%s Yapıştırılamadı." 18636 18637#: lazarusidestrconsts.listhecodetoolsfoundanerror 18638#, object-pascal-format 18639msgid "The Codetools found an error:%s%s" 18640msgstr "Kod aracı bir hata buldu: %s%s" 18641 18642#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect 18643#, object-pascal-format 18644msgid "The compiler file \"%s\" does not look correct:%s%s" 18645msgstr "\"%s\" derleyici dosyası doğru görünmüyor: %s %s" 18646 18647#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby 18648#, object-pascal-format 18649msgid "The component %s can not be deleted because it is not owned by %s." 18650msgstr "%s bileşeni silinemiyor, çünkü %s tarafından sahip değil." 18651 18652#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror 18653#, object-pascal-format 18654msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" 18655msgstr "\"%s\" sınıfının bileşen editörü şu hatayı oluşturdu: %s\"%s\"" 18656 18657#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated 18658#, object-pascal-format 18659msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" 18660msgstr "\"%s\"%s sınıfının bileşen düzenleyicisi #%s \"%s\"%s fiili ile çağrıldı:%s \"%s\" hatası verdi" 18661 18662#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp 18663#, object-pascal-format 18664msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." 18665msgstr "%s bileşeni,%s%s öğesinden devralınmıştır. Devralınan bir bileşeni silmek için atayı açın ve silin." 18666 18667#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp 18668#, object-pascal-format 18669msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." 18670msgstr "%s bileşeni,%s öğesinden.%sdevralınan bir bileşeni yeniden adlandırmak için atayı açın ve orada yeniden adlandırın." 18671 18672#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo 18673msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier." 18674msgstr "Bileşen adı, form / datamodule'deki tüm bileşenlerde benzersiz olmalıdır. Ad, normal bir Pascal tanımlayıcısı gibi büyük / küçük harf duyarlılığı olmadan karşılaştırılır." 18675 18676#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted 18677msgid "The configuration will be downgraded/converted." 18678msgstr "Yapılandırma indirgenir / dönüştürülür." 18679 18680#: lazarusidestrconsts.listhecontainsanotexistingdirectory 18681#, object-pascal-format 18682msgid "The %s contains a nonexistent directory:%s%s" 18683msgstr "%s, varolmayan bir dizin içeriyor: %s %s" 18684 18685#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch 18686#, object-pascal-format 18687msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." 18688msgstr "%s bir yıldız * karakteri içeriyor.%sLazarus bunu normal karakter olarak kullanır ve bunu dosya maskesi olarak genişletmez." 18689 18690#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome 18691msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." 18692msgstr "Şu anki FPC'nin yapılandırma dosyası yok, muhtemelen bazı birimleri özlüyor olacak.Fpc kurulumunuzu kontrol edin." 18693 18694#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro 18695#, object-pascal-format 18696msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" 18697msgstr "\"%s\" %s hata ayıklayıcı mevcut değil veya çalıştırılabilir değil.%s Araçlar -> Seçenekler -> Hata ayıklayıcıyı seç" 18698 18699#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive 18700#, object-pascal-format 18701msgid "The debugger executable typically has the name \"%s\". Please give the full file path." 18702msgstr "Hata ayıklayıcı yürütülebilir dosyasının adı genellikle \"%s\"dir, lütfen tam dosya yolunu belirtin." 18703 18704#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject 18705msgid "The default mode must be stored in project, not in session." 18706msgstr "Varsayılan mod, oturumda değil, projede saklanmalıdır." 18707 18708#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist 18709#, object-pascal-format 18710msgid "The destination directory%s\"%s\" does not exist." 18711msgstr "%s hedef klasörü \"%s\"mevcut değil." 18712 18713#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep 18714#, object-pascal-format 18715msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options." 18716msgstr "\"%s\" hedef dizini mevcut değil.%sLütfen proje hedef dosya adını kontrol ediniz Menü> Proje> Proje Seçenekleri." 18717 18718#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere 18719#, object-pascal-format 18720msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" 18721msgstr "\"%s\" dizini artık proje içeren dosya içermiyor. Bu dizini projenin include arama yolundan kaldırılsın mı?" 18722 18723#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi 18724#, object-pascal-format 18725msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" 18726msgstr "\"%s\" dizini artık proje birimi içermiyor. Bu dizini projenin birim arama yolundan çıkar?" 18727 18728#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit 18729#, object-pascal-format 18730msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" 18731msgstr "\"%s\" dizini birim yolunda artık gerekli değil %sKaldırılsın mı?" 18732 18733#: lazarusidestrconsts.listhedirectoryisnotwritable 18734#, object-pascal-format 18735msgid "The directory \"%s\" is not writable." 18736msgstr "\"%s\"dizini yazılabilir değil." 18737 18738#: lazarusidestrconsts.listhedirectorywasnotfound 18739#, object-pascal-format 18740msgid "The directory %s was not found." 18741msgstr "%s dizini bulunamadı." 18742 18743#: lazarusidestrconsts.listhefile 18744#, object-pascal-format 18745msgid "The file \"%s\"" 18746msgstr "Dosyalar \"%s\"" 18747 18748#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile 18749#, object-pascal-format 18750msgid "The file %s does not look like a lpi file." 18751msgstr "Dosya %s bir lpi dosyası gibi görünmüyor." 18752 18753#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio 18754msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." 18755msgstr "Dosya indeksi, bulma bildirimi gibi işlevler için gereklidir. Tarama yaparken kaynakları düzenleyebilir ve derleyebilirsiniz, ancak bildirim bulma gibi işlevler birimin bulunamadığı hataları gösterir. Bu bir dakika sürebilir." 18756 18757#: lazarusidestrconsts.listhefileisasymlinkopeninstead 18758#, object-pascal-format 18759msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?" 18760msgstr "\"%s\"dosyası bir sembolik bağ.%s \"%s\" yerine Aç?" 18761 18762#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi 18763#, object-pascal-format 18764msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" 18765msgstr "\"%s\"dosyası bir Lazarus projesi değil.%s Bu \"%s\"için yeni bir proje oluşturun?" 18766 18767#: lazarusidestrconsts.listhefilemaskisinvalid 18768#, object-pascal-format 18769msgid "The file mask \"%s\" is invalid." 18770msgstr "Dosya maskesi \"%s\"geçersiz." 18771 18772#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression 18773#, object-pascal-format 18774msgid "The file mask \"%s\" is not a valid regular expression." 18775msgstr "Dosya maskesi \"%s\"geçerli bir düzenli ifade değil." 18776 18777#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject 18778#, object-pascal-format 18779msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." 18780msgstr "\"%s\"dosyası bir program gibi görünüyor.%s Geçerli projeyi kapatın ve yeni bir Lazarus projesi oluşturun\"%s dosya normal olarak yüklenecek." 18781 18782#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp 18783#, object-pascal-format 18784msgid "The file %s seems to be the program file of an existing Lazarus Project." 18785msgstr "%s dosyası mevcut bir Lazarus Projesinin program dosyası gibi görünüyor." 18786 18787#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac 18788#, object-pascal-format 18789msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?" 18790msgstr "\"%s\"%s dosyası,%s paketinin kaynak dizinlerinden birinde bulundu ve derlenmiş bir birime benziyor. Derlenmiş birimler paketin çıkış dizininde olmalıdır, aksi takdirde diğer paketler bu paketi kullanırken sorun yaşayabilir.%s Belirsiz dosyayı sil?" 18791 18792#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself 18793#, object-pascal-format 18794msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" 18795msgstr "\"%s\" dosyası bulunamadı. %s Bunu kendiniz bulmak istiyor musunuz?" 18796 18797#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject 18798#, object-pascal-format 18799msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." 18800msgstr "\"%s\" dosyası bulunamadı %sGünlük proje yüklenmeye devam edecek, %sİptal, yüklemeyi durduracak." 18801 18802#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth 18803#, object-pascal-format 18804msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" 18805msgstr "%s tarafından kullanılan aşağıdaki yöntemler kaynakta değil %s%s%s%s%sÇıkan referansları kaldır?" 18806 18807#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect 18808#, object-pascal-format 18809msgid "The FPC source directory \"%s\" does not look correct:%s%s" 18810msgstr "FPC kaynak dizini \"%s\"doğru görünmüyor: %s%s" 18811 18812#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename 18813#, object-pascal-format 18814msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." 18815msgstr "Ücretsiz Pascal derleyicisi çalıştırılabilir özelliği genellikle \"%s\" adını taşır. Hedefe özgü derleyiciyi \"%s\" gibi de kullanabilirsiniz. Lütfen tam dosya yolunu verin." 18816 18817#: lazarusidestrconsts.listheideisstillbuilding 18818msgid "The IDE is still building." 18819msgstr "IDE şuan bir deleme yapıyor." 18820 18821#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction 18822msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." 18823msgstr "Tanımlayıcı bir birimdir, lütfen birimi yeniden adlandırmak için Dosya - Farklı Kaydet işlevini kullanın." 18824 18825#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand 18826#, object-pascal-format 18827msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?" 18828msgstr "%s anahtarı zaten%s%s öğesine atanmış.%s%s Eski atamayı kaldır ve anahtarı%s yeni fonksiyonuna ata?" 18829 18830#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists 18831#, object-pascal-format 18832msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." 18833msgstr "Uygulama Paketi%s%s yürütme için gerekli değil veya çalıştırılabilir değil.%sBir tane oluşturmak ister misiniz?%s Bkz. Proje -> Proje Seçenekleri -> Uygulama için Ayarlar." 18834 18835#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta 18836#, object-pascal-format 18837msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" 18838msgstr "Başlatma uygulaması \"%s\"%s yok veya çalıştırılamıyor.%s Bkz. Çalıştır -> Çalıştırma parametreleri -> Yerel" 18839 18840#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth 18841#, object-pascal-format 18842msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." 18843msgstr "Lazarus dizini IDE kaynaklarını ve LCL paket dosyalarını ve birçok standart paket içerir. Örneğin \"ide%slazarus.lpi\" dosyasını içerir. Çeviri dosyaları da orada bulunur." 18844 18845#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect 18846#, object-pascal-format 18847msgid "The Lazarus directory \"%s\" does not look correct:%s%s" 18848msgstr "\"%s\" Lazarus dizini doğru görünmüyor: %s %s" 18849 18850#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis 18851msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually." 18852msgstr "LFM (Lazarus form) dosyası geçersiz özellikler içeriyor. Bu, örneğin mevcut LCL'de bulunmayan bazı özellikleri / sınıfları içerdiği anlamına gelir. Normal düzeltme, bu özellikleri lfm'den kaldırmak ve Pascal kodunu elle düzeltmektir." 18853 18854#: lazarusidestrconsts.listhemacrodoesnotbeginwith 18855#, object-pascal-format 18856msgid "The macro \"%s\" does not begin with \"%s\"." 18857msgstr "\"%s\" makrosu \"%s\" ile başlamaz." 18858 18859#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename 18860#, object-pascal-format 18861msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." 18862msgstr "\"Make\" yürütülebilir dosyası genellikle \"%s\" adına sahiptir. IDE'nin kurulması için gereklidir. Lütfen tam dosya yolunu verin." 18863 18864#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd 18865#, object-pascal-format 18866msgid "The new include file is not yet in the include search path.%sAdd directory %s?" 18867msgstr "Yeni include dosyası henüz include arama yolunda değil %s Dizine eklensin mi %s?" 18868 18869#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory 18870#, object-pascal-format 18871msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" 18872msgstr "Yeni birim henüz birim arama yolunda değil %sDizine eklensin mi %s?" 18873 18874#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded 18875msgid "The old configuration will be upgraded." 18876msgstr "Eski yapılandırma güncellenecektir." 18877 18878#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint 18879#, object-pascal-format 18880msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" 18881msgstr "\"Diğer kaynaklar\", zaten \"Diğer birim dosyaları\" nda bulunan bir dizini içerir. %s%s" 18882 18883#: lazarusidestrconsts.listheoutputdirectoryismissing 18884#, object-pascal-format 18885msgid "The output directory \"%s\" is missing." 18886msgstr "\"%s\" çıktı dizini eksik." 18887 18888#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath 18889#, object-pascal-format 18890msgid "The output directory of %s is listed in the include search path of %s." 18891msgstr "%s dizininin çıktı dizini %s içerdiği arama yolunda listeleniyor." 18892 18893#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes 18894#, object-pascal-format 18895msgid "The output directory of %s is listed in the inherited include search path of %s." 18896msgstr "%s dizininin çıkış dizini, %s dizisinin devralınan kapsayıcı arama yolunda listeleniyor." 18897 18898#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear 18899#, object-pascal-format 18900msgid "The output directory of %s is listed in the inherited unit search path of %s." 18901msgstr "%s çıktı dizini, %s ürününün devralınan birim arama yolunda listeleniyor." 18902 18903#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof 18904#, object-pascal-format 18905msgid "The output directory of %s is listed in the unit search path of %s." 18906msgstr "%s çıktı dizini %s birim arama yolunda listeleniyor." 18907 18908#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot 18909msgid " The output directory should be a separate directory and not contain any source files." 18910msgstr " Çıkış dizini ayrı bir dizinde olmalı ve herhangi bir kaynak dosyası içermemelidir." 18911 18912#: lazarusidestrconsts.listheownerclasshasthisname 18913msgid "The owner class has this name" 18914msgstr "Sahip sınıfının bu adı var" 18915 18916#: lazarusidestrconsts.listheownerhasthisname 18917msgid "The owner has this name" 18918msgstr "Sahibinin adı var" 18919 18920#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi 18921#, object-pascal-format 18922msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." 18923msgstr "%s paketi, \"%s\" yolunu IDE'nin içerme yoluna ekler.%s Bu muhtemelen paketin yanlış yapılandırılmasıdır." 18924 18925#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr 18926#, object-pascal-format 18927msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." 18928msgstr "%s paketi, \"%s\" yolunu IDE'nin birim yoluna ekler.%s Bu muhtemelen paketin yanlış yapılandırılmasıdır." 18929 18930#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname 18931msgid "The package already contains a unit with this name." 18932msgstr "Paket zaten bu ada sahip bir birim içeriyor." 18933 18934#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi 18935#, object-pascal-format 18936msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package." 18937msgstr "%s paketi yüklenemiyor, çünkü \"%s\"paketi gerektiriyor, bu sadece bir çalışma zamanı paketidir." 18938 18939#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth 18940#, object-pascal-format 18941msgid "The package %s can not be uninstalled because it is needed by the IDE itself." 18942msgstr "%s paketi kaldırılamaz, çünkü IDE kendisi tarafından gerekli." 18943 18944#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi 18945#, object-pascal-format 18946msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." 18947msgstr "%s paketi, herhangi bir IDE eklentisi sağlamadığı anlamına gelen herhangi bir \"Register \" prosedürüne sahip değildir. Kurulumu büyük olasılıkla yalnızca IDE'nin boyutunu artıracak ve hatta dengesiz hale getirebilir.%sİpucu: Projenizde bir paket kullanmak istiyorsanız, \"Projeye ekle \" menü öğesini kullanın." 18948 18949#: lazarusidestrconsts.listhepackageisalreadyinthelist 18950#, object-pascal-format 18951msgid "The package %s is already in the list" 18952msgstr "%s paketi zaten listede" 18953 18954#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall 18955#, object-pascal-format 18956msgid "The package %s is not a design time package. It cannot be installed in the IDE." 18957msgstr "%s paketi bir tasarım zamanı paketi değil, IDE'ye kurulamıyor." 18958 18959#: lazarusidestrconsts.listhepathofmakeisnotcorrect 18960#, object-pascal-format 18961msgid "The path of \"make\" is not correct: \"%s\"" 18962msgstr "\"make\" yolu doğru değil: \"%s\"" 18963 18964#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla 18965#, object-pascal-format 18966msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." 18967msgstr "\"make\" programı bulunamadı.%sBu araç Lazarus'u oluşturmak için gereklidir." 18968 18969#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain 18970msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" 18971msgstr "Proje derleyici seçenekleri ve ana kaynaktaki direktifler farklıdır. Yeni birim için proje seçeneklerinin modu ve string tipi kullanılır:" 18972 18973#: lazarusidestrconsts.listheprojectdoesnotusedwarf 18974#, object-pascal-format 18975msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf." 18976msgstr "Proje hata ayıklama bilgisini cüce biçiminde yazmıyor. \"%s\" yalnızca cüceyi destekler." 18977 18978#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems 18979#, object-pascal-format 18980msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces." 18981msgstr "Proje, LCLBase tarafından gereken LCL birim arayüzlerini kullanmaz.%s LCL'yi arayüzler olmadan kullanırsanız garip linker hataları alırsınız." 18982 18983#: lazarusidestrconsts.listheprojecthasnomainsourcefile 18984msgid "The project has no main source file." 18985msgstr "Projenin ana kaynak dosyası yok." 18986 18987#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource 18988#, object-pascal-format 18989msgid "The project info file \"%s\"%sis equal to the project main source file!" 18990msgstr "Proje bilgi dosyası \"%s\"%s proje ana kaynak dosyasına eşit!" 18991 18992#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk 18993#, object-pascal-format 18994msgid "The project information file \"%s\"%shas changed on disk." 18995msgstr "Proje bilgi dosyası \"%s\"%s Disk üzerinde değişti." 18996 18997#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest 18998#, object-pascal-format 18999msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" 19000msgstr "%s inşa edilmeden önce proje kaydedilmelidir. Test Dizini IDE seçeneklerinde ayarlandıysa,%s yeni projeler oluşturabilir ve bir kerede oluşturabilirsiniz.%s Projeyi kaydet?" 19001 19002#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast 19003msgid "The project uses FPC resources which require at least FPC 2.4" 19004msgstr "Proje en az FPC 2.4 gerektiren FPC kaynaklarını kullanıyor" 19005 19006#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar 19007#, object-pascal-format 19008msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." 19009msgstr "Projede hedef OS =%s ve CPU =%s.%s kullanılıyor. Bu hedef için system.ppu FPC ikili dizinlerinde bulunamadı.%s FPC'nin bu hedef için doğru yüklendiğinden ve fpc.cfg'nin doğru dizinleri içerdiğinden emin olun ." 19010 19011#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe 19012#, object-pascal-format 19013msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable." 19014msgstr "Proje, hata ayıklama simgelerini harici bir dosyaya yazar. \"%s\" yalnızca çalıştırılabilir içindeki sembolleri destekler." 19015 19016#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable 19017#, object-pascal-format 19018msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file." 19019msgstr "Proje, hata ayıklama simgelerini harici bir dosya yerine çalıştırılabilir dosyaya yazar. \"%s\" yalnızca harici bir dosyadaki sembolleri destekler." 19020 19021#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon 19022#, object-pascal-format 19023msgid "%sThere are additional notes for this message on%s" 19024msgstr "%s Bu ileti için %s üzerinde ek notlar var" 19025 19026#: lazarusidestrconsts.listherearenoconflictingkeys 19027msgid "There are no conflicting keys." 19028msgstr "Çakışan anahtar yok." 19029 19030#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename 19031#, object-pascal-format 19032msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" 19033msgstr "Dizinde aynı ada sahip başka dosyalar var, %s yalnızca farklı durumda: %s %s %s Öğe silinsin mi?" 19034 19035#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension 19036#, object-pascal-format 19037msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" 19038msgstr "%s diskinde aynı adı ve benzer bir uzantısı olan bir dosya var. Dosya:%s%s Belirsiz Dosya:%s%s Belirsiz dosyayı sil?" 19039 19040#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname 19041msgid "There is already a build mode with this name." 19042msgstr "Bu ada sahip zaten bir yapı modu var." 19043 19044#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename 19045#, object-pascal-format 19046msgid "There is already a component class with the name %s." 19047msgstr "Zaten %s isminde bir bileşen sınıfı var." 19048 19049#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname 19050msgid "There is already a component with this name" 19051msgstr "Bu isimde zaten bir bileşen var" 19052 19053#: lazarusidestrconsts.listhereisalreadyafilein 19054#, object-pascal-format 19055msgid "There is already a file%s%s%sin %s" 19056msgstr "Zaten %s %s %s %s adlı bir dosya var" 19057 19058#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue 19059#, object-pascal-format 19060msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" 19061msgstr "%s%s \"%s\" adlı bir dosya zaten var Eski:%s%s Yeni:%s%s%s Devam edilsin mi?" 19062 19063#: lazarusidestrconsts.listhereisalreadyaformwiththename 19064#, object-pascal-format 19065msgid "There is already a form with the name \"%s\"" 19066msgstr "\"%s\" adı olan bir form zaten var" 19067 19068#: lazarusidestrconsts.listhereisalreadyamacrowiththename 19069#, object-pascal-format 19070msgid "There is already a macro with the name \"%s\"." 19071msgstr "\"%s\"adı olan bir makro zaten var." 19072 19073#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename 19074#, object-pascal-format 19075msgid "There is already an IDE macro with the name \"%s\"" 19076msgstr "\"%s\" adı olan bir IDE makrosu zaten var" 19077 19078#: lazarusidestrconsts.listhereisalreadyapackageinthelist 19079#, object-pascal-format 19080msgid "There is already a package %s in the list" 19081msgstr "Listede bir %s paket zaten var" 19082 19083#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur 19084#, object-pascal-format 19085msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?" 19086msgstr "%s%s cinsinden \"%s\" birimi zaten var: Eski:%s%s Yeni:%s%s Birim arama yolunun bunlardan yalnızca birini içerdiğinden emin olmanız gerekir.%s%s Devam edlsin mi?" 19087 19088#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus 19089#, object-pascal-format 19090msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." 19091msgstr "\"%s\" adı olan bir birim zaten var Pascal tanımlayıcıları benzersiz olmalıdır." 19092 19093#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose 19094#, object-pascal-format 19095msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" 19096msgstr "Projede \"%s\"adı olan bir birim var %sLütfen farklı bir ad seçin" 19097 19098#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu 19099#, object-pascal-format 19100msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." 19101msgstr "%s dizininde hiçbir fpc.exe yok. Genellikle make çalıştırılabilir dosyası birlikte kurulur." 19102 19103#: lazarusidestrconsts.listheremustbeatleastonebuildmode 19104msgid "There must be at least one build mode." 19105msgstr "En az bir yapı modu olmalı." 19106 19107#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor 19108#, object-pascal-format 19109msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." 19110msgstr "Kaynak sınıfı \"%s\" dan \"%s\" iniyor Muhtemelen bu TForm için bir yazım hatasıdır." 19111 19112#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent 19113#, object-pascal-format 19114msgid "There was an error during writing the selected component %s:%s:%s%s" 19115msgstr "Seçili bileşen %s yazarken bir hata oluştu: %s: %s %s" 19116 19117#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe 19118#, object-pascal-format 19119msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" 19120msgstr "Seçilen bileşen %s'nin ikili akışını dönüştürürken bir hata oluştu: %s: %s %s" 19121 19122#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli 19123#, object-pascal-format 19124msgid "There was an error while copying the component stream to clipboard:%s%s" 19125msgstr "Bileşen akışını panoya kopyalarken bir hata oluştu: %s %s" 19126 19127#: lazarusidestrconsts.listherootcomponentcannotbedeleted 19128msgid "The root component cannot be deleted." 19129msgstr "Kök bileşen silinemez." 19130 19131#: lazarusidestrconsts.listhesefileswillbedeleted 19132msgid "These files will be deleted" 19133msgstr "Bu dosyalar silinecek" 19134 19135#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject 19136msgid "These settings are stored with the project." 19137msgstr "Bu ayarlar proje ile birlikte saklanır." 19138 19139#: lazarusidestrconsts.listheseunitswerenotfound 19140msgid "These units were not found:" 19141msgstr "Bu birimler bulunamadı:" 19142 19143#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro 19144#, object-pascal-format 19145msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." 19146msgstr "Free Pascal paketlerinin kaynakları tarama ve kod tamamlama için gereklidir. Örneğin, \"%s\" dosyasına sahip." 19147 19148#: lazarusidestrconsts.listhetargetdirectoryisafile 19149#, object-pascal-format 19150msgid "The target directory is a file:%s" 19151msgstr "Hedef klasör adı bir dosya %s" 19152 19153#: lazarusidestrconsts.listhetargetfilenameisadirectory 19154msgid "The target file name is a directory." 19155msgstr "Hedef dosya adı bir klasör." 19156 19157#: lazarusidestrconsts.listhetargetisnotwritable 19158#, object-pascal-format 19159msgid "The target %s is not writable." 19160msgstr "Hedef %s yazılabilir değil." 19161 19162#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt 19163#, object-pascal-format 19164msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" 19165msgstr "Test Dizini bulunamadı: %s \"%s\" %s (IDE seçeneklerine bakın)" 19166 19167#: lazarusidestrconsts.listheunitalreadyexists 19168#, object-pascal-format 19169msgid "The unit \"%s\" already exists." 19170msgstr "Birim \"%s\" zaten var." 19171 19172#: lazarusidestrconsts.listheunitbelongstopackage 19173#, object-pascal-format 19174msgid "The unit belongs to package %s." 19175msgstr "Birim %s paketine ait." 19176 19177#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe 19178#, object-pascal-format 19179msgid "The unit %s exists twice in the unit path of the %s:" 19180msgstr "%s birimi %s birim yolunda iki kez var:" 19181 19182#: lazarusidestrconsts.listheunithasthisname 19183msgid "The unit has this name" 19184msgstr "Birimin adı var" 19185 19186#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler 19187#, object-pascal-format 19188msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" 19189msgstr "\"%s\" birim dosya adı küçük harf değil.%s Free Pascal derleyicisi tüm durumları aramıyor. Küçük harfli dosya kullanılması önerilir.%s Dosya küçük harfli olarak yeniden adlandırılsın mı?" 19190 19191#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd 19192#, object-pascal-format 19193msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." 19194msgstr "\"%s\" birimi FPC kaynaklarının bir parçası, ancak ilgili fpdoc xml dosyası bulunamadı.%sYa fpcdocs dizinini arama yoluna henüz eklemediniz ya da birim henüz belgelenmemiş.%s FPC kaynakları için fpdoc dosyaları şu adresten indirilebilir:%s%s Lütfen dizini fpdoc düzenleyici seçeneklerine ekleyin.%s Yeni bir dosya oluşturmak için dizinin yazılabilir olması gerekir." 19195 19196#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic 19197#, object-pascal-format 19198msgid "The unit %s is used by other files.%sUpdate references automatically?" 19199msgstr "%s birimi diğer dosyalar tarafından kullanılıyor:%s Referanslar otomatik olarak güncellensin mi?" 19200 19201#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus 19202#, object-pascal-format 19203msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." 19204msgstr "Ünitenin kendisi zaten \"%s\" ismine sahip ve Pascal tanımlayıcıları benzersiz olmalı." 19205 19206#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac 19207#, object-pascal-format 19208msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" 19209msgstr "\"%s\" biriminde arama yolu %s paketinin \"%s\"kaynak dizinini içeriyor" 19210 19211#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki 19212#, object-pascal-format 19213msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." 19214msgstr "\"%s\"çalışma dizini yok %sLütfen çalışma dizinini kontrol edin. Menü> Çalıştır> Prametreleri Çalıştır." 19215 19216#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename 19217#, object-pascal-format 19218msgid "This component already contains a class with the name %s." 19219msgstr "Bu bileşen zaten %s isminde bir sınıf içeriyor." 19220 19221#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor 19222msgid "This function needs an open .lfm file in the source editor." 19223msgstr "Bu fonksiyonun kaynak editöründe açık bir .lfm dosyası olması gerekir." 19224 19225#: lazarusidestrconsts.listhishelpmessage 19226msgid "this help message" 19227msgstr "bu yardım mesajı" 19228 19229#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage 19230msgid "This is a test project for a design time package, testing it outside the IDE." 19231msgstr "Bu, tasarım zamanı paketi için bir test projesidir ve IDE dışında test eder." 19232 19233#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc 19234#, object-pascal-format 19235msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" 19236msgstr "Bu bir Pascal dosyasına benziyor.%s Bazı dosya sistemlerinde ve farklı derleyicilerde çeşitli sorunlardan kaçınmak için küçük harfli dosya kullanılması önerilir.%s Küçük harfle mi değiştirilsin mi?" 19237 19238#: lazarusidestrconsts.listhisprojecthasnomainsourcefile 19239msgid "This project has no main source file" 19240msgstr "Bu projenin ana kaynak dosyası yok" 19241 19242#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode 19243msgid "This project has only the default build mode." 19244msgstr "Bu proje sadece varsayılan yapı moduna sahip." 19245 19246#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis 19247#, object-pascal-format 19248msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." 19249msgstr "Lazarus'u oluşturmak için bu seçenek kümesi bu yükleme tarafından desteklenmiyor.%s \"%s\" dizini yazılabilir değil.%s Yardım için Lazarus web sitesini görüntüleyin." 19250 19251#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode 19252#, object-pascal-format 19253msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." 19254msgstr "Bu ifade açılamıyor.%s Lütfen yeni bir prosedür / yöntem ayıklamak için bazı kod seçin." 19255 19256#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme 19257msgid "This will allow changing all build modes at once. Not implemented yet." 19258msgstr "Bu, tüm yapı modlarını bir defada değiştirmeye izin verecek, henüz uygulanmadı." 19259 19260#: lazarusidestrconsts.listhiswillcreateacirculardependency 19261msgid "This will create a circular dependency." 19262msgstr "Bu dairesel bağımlılık yaratacaktır." 19263 19264#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed 19265#, object-pascal-format 19266msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" 19267msgstr "Bu, panoya bir sürü metin ( %s) koyar.%sDevam edilsin mi?" 19268 19269#: lazarusidestrconsts.listhreads 19270msgctxt "lazarusidestrconsts.listhreads" 19271msgid "Threads" 19272msgstr "Konular" 19273 19274#: lazarusidestrconsts.listhreadscurrent 19275msgctxt "lazarusidestrconsts.listhreadscurrent" 19276msgid "Current" 19277msgstr "Geçerli" 19278 19279#: lazarusidestrconsts.listhreadsfunc 19280msgctxt "lazarusidestrconsts.listhreadsfunc" 19281msgid "Function" 19282msgstr "Fonksiyon" 19283 19284#: lazarusidestrconsts.listhreadsgoto 19285msgid "Goto" 19286msgstr "Git" 19287 19288#: lazarusidestrconsts.listhreadsline 19289msgctxt "lazarusidestrconsts.listhreadsline" 19290msgid "Line" 19291msgstr "Satır" 19292 19293#: lazarusidestrconsts.listhreadsnotevaluated 19294msgid "Threads not evaluated" 19295msgstr "Konuları değerlendirilmedi" 19296 19297#: lazarusidestrconsts.listhreadssrc 19298msgctxt "lazarusidestrconsts.listhreadssrc" 19299msgid "Source" 19300msgstr "Kaynak" 19301 19302#: lazarusidestrconsts.listhreadsstate 19303msgctxt "lazarusidestrconsts.listhreadsstate" 19304msgid "State" 19305msgstr "Durum" 19306 19307#: lazarusidestrconsts.listitle 19308msgid "&Title" 19309msgstr "&Başlık" 19310 19311#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus 19312msgid "Title in taskbar shows for example: project1.lpi - Lazarus" 19313msgstr "Görev çubuğundaki başlık, örneğin: project1.lpi - Lazarus" 19314 19315#: lazarusidestrconsts.listitleleaveemptyfordefault 19316msgid "Title (leave empty for default)" 19317msgstr "Başlık (varsayılan olarak boş bırakın)" 19318 19319#: lazarusidestrconsts.listmfunctionappendpathdelimiter 19320msgid "Function: append path delimiter" 19321msgstr "Fonksiyon: yol sınırlayıcı ekleme" 19322 19323#: lazarusidestrconsts.listmfunctionchomppathdelimiter 19324msgid "Function: remove trailing path delimiter" 19325msgstr "Fonksiyon: sondaki yol sınırlayıcı kaldır" 19326 19327#: lazarusidestrconsts.listmfunctionextractfileextension 19328msgid "Function: extract file extension" 19329msgstr "Fonksiyon: dosya uzantısını ayıklayın" 19330 19331#: lazarusidestrconsts.listmfunctionextractfilenameextension 19332msgid "Function: extract file name+extension" 19333msgstr "Fonksiyon: dosya adı + uzantısını ayıkla" 19334 19335#: lazarusidestrconsts.listmfunctionextractfilenameonly 19336msgid "Function: extract file name only" 19337msgstr "Fonksiyon: yalnızca dosya adını ayıkla" 19338 19339#: lazarusidestrconsts.listmfunctionextractfilepath 19340msgid "Function: extract file path" 19341msgstr "Fonksiyon: dosya yolunu ayıkla" 19342 19343#: lazarusidestrconsts.listmunknownmacro 19344#, object-pascal-format 19345msgid "(unknown macro: %s)" 19346msgstr "(Bilinmeyen makro: %s)" 19347 19348#: lazarusidestrconsts.listofpcpath 19349msgid "Path:" 19350msgstr "Yol:" 19351 19352#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa 19353msgid "Toggle showing filenames with full path or with relative path" 19354msgstr "Dosya adlarını tam yolla veya göreceli yolla gösterme" 19355 19356#: lazarusidestrconsts.listoolbarconfiguration 19357msgid "Toolbar Configuration" 19358msgstr "Araç Çubuğunu Yapılandır" 19359 19360#: lazarusidestrconsts.listoolbaroptions 19361msgid "Toolbar" 19362msgstr "Araç Çubuğu" 19363 19364#: lazarusidestrconsts.listoolbaroptionshighlight 19365msgid "Highlight toolbars buttons" 19366msgstr "Araç çubuklarının vurgulanması düğmeleri" 19367 19368#: lazarusidestrconsts.listoolbaroptionsraise 19369msgid "Raise toolbars" 19370msgstr "Araç çubuklarını kaldır" 19371 19372#: lazarusidestrconsts.listoolhasnoexecutable 19373#, object-pascal-format 19374msgid "tool \"%s\" has no executable" 19375msgstr "\"%s\" aracı çalıştırılabilir değil" 19376 19377#: lazarusidestrconsts.listoolheaderfailed 19378msgid "Tool Header: Failed" 19379msgstr "Araç Başlığı: Başarısız" 19380 19381#: lazarusidestrconsts.listoolheaderrunning 19382msgid "Tool Header: Running" 19383msgstr "Alet Başlığı: Çalışıyor" 19384 19385#: lazarusidestrconsts.listoolheaderscrolledup 19386msgid "Tool Header: Scrolled up" 19387msgstr "Araç Başlığı: Kaydırıldı" 19388 19389#: lazarusidestrconsts.listoolheadersuccess 19390msgid "Tool Header: Success" 19391msgstr "Araç Başlığı: Başarılı" 19392 19393#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo 19394#, object-pascal-format 19395msgid "tool stopped with exit code %s. Use context menu to get more information." 19396msgstr "araç %s çıkış koduyla durduruldu, daha fazla bilgi almak için bağlam menüsünü kullanın." 19397 19398#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo 19399#, object-pascal-format 19400msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information." 19401msgstr "exitCode 0 ve ExitStatus %s ile durduruldu. Daha fazla bilgi almak için içerik menüsünü kullanın." 19402 19403#: lazarusidestrconsts.listop 19404msgctxt "lazarusidestrconsts.listop" 19405msgid "Top" 19406msgstr "Üst" 19407 19408#: lazarusidestrconsts.listopanchoring 19409msgid "Top anchoring" 19410msgstr "En üst çapa" 19411 19412#: lazarusidestrconsts.listopborderspacespinedithint 19413msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." 19414msgstr "Üst sınır alanı. Bu değer taban sınır alanına eklenir ve kontrolün üstündeki boşluk için kullanılır." 19415 19416#: lazarusidestrconsts.listopinfoview 19417msgid "Show Class/Procedure hint" 19418msgstr "Class/Procedure ipuçlarını Göster" 19419 19420#: lazarusidestrconsts.listops 19421msgid "Tops" 19422msgstr "Üstler" 19423 19424#: lazarusidestrconsts.listopsiblingcomboboxhint 19425msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 19426msgstr "Bu, üst tarafın tutturulduğu kardeş kontrolüdür. Ebeveynlere tutturmak için Delphi stilinde boş bırakın (BorderSpacing ve ReferenceSide önemli değil)." 19427 19428#: lazarusidestrconsts.listopspaceequally 19429msgid "Top space equally" 19430msgstr "Üstteki alan eşit" 19431 19432#: lazarusidestrconsts.listotalpages 19433#, object-pascal-format 19434msgid "Total Pages: %s" 19435msgstr "Toplam sayfa: %s" 19436 19437#: lazarusidestrconsts.listranslatetheenglishmessages 19438msgid "Translate the English Messages" 19439msgstr "İngilizce Mesajları Çevir" 19440 19441#: lazarusidestrconsts.listreeneedsrefresh 19442msgid "Tree needs refresh" 19443msgstr "Ağacın yenilenmesi gerekiyor" 19444 19445#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein 19446#, object-pascal-format 19447msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" 19448msgstr "Taşınan iki taşınan dosya aynı dosya adına sahip olacaktır: %s %s %s %s %sin %s" 19449 19450#: lazarusidestrconsts.listypes 19451msgid "Types (not removed if no replacement)" 19452msgstr "Türler (değiştirilmezse kaldırılmaz)" 19453 19454#: lazarusidestrconsts.lisudadditionaldirectories 19455msgid "Additional directories:" 19456msgstr "Ek dizinler:" 19457 19458#: lazarusidestrconsts.lisudallpackageunits 19459msgid "All package units" 19460msgstr "Tüm paket üniteleri" 19461 19462#: lazarusidestrconsts.lisudallsourceeditorunits 19463msgid "All source editor units" 19464msgstr "Tüm kaynak editör birimleri" 19465 19466#: lazarusidestrconsts.lisudallunits 19467msgid "All units" 19468msgstr "Tüm birimler" 19469 19470#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit 19471msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well." 19472msgstr "Varsayılan olarak sadece proje birimleri ve kaynak editör birimleri aranır. Arama yapmak için buraya noktalı virgülle ayrılmış dizinlerin bir listesini ekleyin." 19473 19474#: lazarusidestrconsts.lisudcollapseallnodes 19475msgid "Collapse all nodes" 19476msgstr "Tümünü daralt" 19477 19478#: lazarusidestrconsts.lisudexpandallnodes 19479msgid "Expand all nodes" 19480msgstr "Tümünü genişlet" 19481 19482#: lazarusidestrconsts.lisudfile 19483#, object-pascal-format 19484msgid "File: %s" 19485msgstr "Dosya: %s" 19486 19487#: lazarusidestrconsts.lisudfilter 19488msgid "(Filter)" 19489msgstr "(Filtre)" 19490 19491#: lazarusidestrconsts.lisudimplementationuses 19492#, object-pascal-format 19493msgid "Implementation Uses: %s" 19494msgstr "Implementation Kullanımı: %s" 19495 19496#: lazarusidestrconsts.lisudimplementationuses2 19497#, object-pascal-format 19498msgid "implementation uses: %s" 19499msgstr "implementation kullanımı: %s" 19500 19501#: lazarusidestrconsts.lisudinterfaceuses 19502#, object-pascal-format 19503msgid "Interface Uses: %s" 19504msgstr "Interface Kullanımı: %s" 19505 19506#: lazarusidestrconsts.lisudinterfaceuses2 19507#, object-pascal-format 19508msgid "interface uses: %s" 19509msgstr "interface kullanımı: %s" 19510 19511#: lazarusidestrconsts.lisudprojectsandpackages 19512msgid "Projects and packages" 19513msgstr "Projeler ve paketler" 19514 19515#: lazarusidestrconsts.lisudscanning 19516msgid "Scanning ..." 19517msgstr "Taranıyor ..." 19518 19519#: lazarusidestrconsts.lisudscanningunits 19520#, object-pascal-format 19521msgid "Scanning: %s units ..." 19522msgstr "Taranıyor: %s birimi ..." 19523 19524#: lazarusidestrconsts.lisudsearch 19525msgid "(Search)" 19526msgstr "(Ara)" 19527 19528#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase 19529msgid "Find next occurrence of this phrase" 19530msgstr "Bu cümlenin bir sonraki varlığını bul" 19531 19532#: lazarusidestrconsts.lisudsearchnextunitofthisphrase 19533msgid "Find next unit with this phrase" 19534msgstr "Bu cümle ile sonraki birimi bulun" 19535 19536#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase 19537msgid "Find previous occurrence of this phrase" 19538msgstr "Bu cümlenin önceki oluşumunu bul" 19539 19540#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase 19541msgid "Find previous unit with this phrase" 19542msgstr "Bu cümleyle önceki birimi bulun" 19543 19544#: lazarusidestrconsts.lisudselectedunits 19545msgid "Selected units" 19546msgstr "Seçilen birimler" 19547 19548#: lazarusidestrconsts.lisudshownodesfordirectories 19549msgid "Show nodes for directories" 19550msgstr "Dizinler için düğümleri göster" 19551 19552#: lazarusidestrconsts.lisudshownodesforprojectandpackages 19553msgid "Show nodes for project and packages" 19554msgstr "Proje ve paketler için düğümleri göster" 19555 19556#: lazarusidestrconsts.lisudunits 19557msgid "Units" 19558msgstr "Birimler" 19559 19560#: lazarusidestrconsts.lisudunits2 19561#, object-pascal-format 19562msgid "Units: %s" 19563msgstr "Birimler: %s" 19564 19565#: lazarusidestrconsts.lisudusedbyimplementations 19566#, object-pascal-format 19567msgid "Used by Implementations: %s" 19568msgstr "Implementations Tarafından Kullanılıyor: %s" 19569 19570#: lazarusidestrconsts.lisudusedbyimplementations2 19571#, object-pascal-format 19572msgid "used by implementations: %s" 19573msgstr "implementations tarafından kullanılır: %s" 19574 19575#: lazarusidestrconsts.lisudusedbyinterfaces 19576#, object-pascal-format 19577msgid "Used by Interfaces: %s" 19578msgstr "Interfaces tarafından kullanılıyor: %s" 19579 19580#: lazarusidestrconsts.lisudusedbyinterfaces2 19581#, object-pascal-format 19582msgid "used by interfaces: %s" 19583msgstr "interfaces tarafından kullanılır: %s" 19584 19585#: lazarusidestrconsts.lisuedonotsho 19586msgid "Do not show this message again." 19587msgstr "Bu mesajı tekrar gösterme." 19588 19589#: lazarusidestrconsts.lisueerrorinregularexpression 19590msgid "Error in regular expression" 19591msgstr "Normal ifade hatası" 19592 19593#: lazarusidestrconsts.lisuefontwith 19594msgid "Font without UTF-8" 19595msgstr "UTF-8 siz yazı tipi" 19596 19597#: lazarusidestrconsts.lisuegotoline 19598msgid "Goto line:" 19599msgstr "Satıra Git:" 19600 19601#: lazarusidestrconsts.lisuemodeseparator 19602msgid "/" 19603msgstr "/" 19604 19605#: lazarusidestrconsts.lisuenotfound 19606msgid "Not found" 19607msgstr "Bulunamadı" 19608 19609#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith 19610#, object-pascal-format 19611msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" 19612msgstr "Bu \"%s\"%s\" ile \"%s\" ile değiştirilsin mi?" 19613 19614#: lazarusidestrconsts.lisuesearching 19615#, object-pascal-format 19616msgid "Searching: %s" 19617msgstr "Aranıyor: %s" 19618 19619#: lazarusidestrconsts.lisuesearchstringcontinuebeg 19620msgid "Continue search from the beginning?" 19621msgstr "Baştan aramaya devam et?" 19622 19623#: lazarusidestrconsts.lisuesearchstringcontinueend 19624msgid "Continue search from the end?" 19625msgstr "Arama sona kadar devam etsin mi?" 19626 19627#: lazarusidestrconsts.lisuesearchstringnotfound 19628#, object-pascal-format 19629msgid "Search string '%s' not found!" 19630msgstr "Arama dizesi '%s' bulunamadı!" 19631 19632#: lazarusidestrconsts.lisuethecurre 19633#, object-pascal-format 19634msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." 19635msgstr "Geçerli düzenleyici yazı tipi UTF-8'i desteklemiyor, ancak sisteminiz kullanıyor gibi görünüyor.%s Bu ASCII olmayan karakterlerin muhtemelen yanlış gösterileceği anlamına gelir.%s Editör seçeneklerinde başka bir yazı tipi seçebilirsiniz." 19636 19637#: lazarusidestrconsts.lisuiclearincludedbyreference 19638msgid "Clear include cache" 19639msgstr "Önbelleği temizle" 19640 19641#: lazarusidestrconsts.lisuidbytes 19642#, object-pascal-format 19643msgid "%s bytes" 19644msgstr "%s byte" 19645 19646#: lazarusidestrconsts.lisuidincludedby 19647msgid "Included by:" 19648msgstr "Dahil olan:" 19649 19650#: lazarusidestrconsts.lisuidinproject 19651msgid "In project:" 19652msgstr "Projede:" 19653 19654#: lazarusidestrconsts.lisuidlines 19655msgid "Lines:" 19656msgstr "Satırlar:" 19657 19658#: lazarusidestrconsts.lisuidname 19659msgctxt "lazarusidestrconsts.lisuidname" 19660msgid "Name:" 19661msgstr "Ad:" 19662 19663#: lazarusidestrconsts.lisuidno 19664msgid "no" 19665msgstr "hayır" 19666 19667#: lazarusidestrconsts.lisuidsize 19668msgid "Size:" 19669msgstr "Boyut:" 19670 19671#: lazarusidestrconsts.lisuidtype 19672msgid "Type:" 19673msgstr "Tür:" 19674 19675#: lazarusidestrconsts.lisuidyes 19676msgid "yes" 19677msgstr "evet" 19678 19679#: lazarusidestrconsts.lisuishowcodetoolsvalues 19680msgid "Show CodeTools Values" 19681msgstr "Kod Araçları Değerlerini Göster" 19682 19683#: lazarusidestrconsts.lisunableconvertbinarystreamtotext 19684msgid "Unable convert binary stream to text" 19685msgstr "İkili akış metne dönüştürülemiyor" 19686 19687#: lazarusidestrconsts.lisunablecopycomponentstoclipboard 19688msgid "Unable copy components to clipboard" 19689msgstr "Bileşenleri panoya kopyalayamıyor" 19690 19691#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile 19692#, object-pascal-format 19693msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." 19694msgstr "Kaynak dosyası %s\"%s\" kaynak başlığına yorum eklenemedi.%s Muhtemelen bir sözdizimi hatası." 19695 19696#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably 19697#, object-pascal-format 19698msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." 19699msgstr "Kaynak T%s: FORMDATA %s kaynağına eklenemiyor \"%s\".%s Muhtemelen bir sözdizimi hatası." 19700 19701#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread 19702#, object-pascal-format 19703msgid "Unable to add the dependency %s because the package %s has already a dependency %s" 19704msgstr "%s bağımlılığı eklenemiyor çünkü %s paketi zaten bir bağımlılık %s" 19705 19706#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea 19707#, object-pascal-format 19708msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s" 19709msgstr "Bağımlılık %s eklenemedi, çünkü bu bir dairesel bağımlılık yaratacak Bağımlılık %s" 19710 19711#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith 19712#, object-pascal-format 19713msgid "Unable to add %s to project because there is already a unit with the same name in the Project." 19714msgstr "Projede aynı adı taşıyan bir birim zaten olduğundan %s projeye eklenemedi." 19715 19716#: lazarusidestrconsts.lisunabletobackupfileto 19717#, object-pascal-format 19718msgid "Unable to backup file \"%s\" to \"%s\"!" 19719msgstr "\"%s\" dosyasını \"%s\" dosyasına yedekleyemiyorum!" 19720 19721#: lazarusidestrconsts.lisunabletochangeclassofto 19722#, object-pascal-format 19723msgid "%s%sUnable to change class of %s to %s" 19724msgstr "%s%s %s sınıfını %s olarak değiştirilemiyor" 19725 19726#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource 19727#, object-pascal-format 19728msgid "Unable to change project scaled in source.%s%s" 19729msgstr "Kaynakta ölçeklendirilen proje değiştirilemiyor. %s%s" 19730 19731#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource 19732#, object-pascal-format 19733msgid "Unable to change project title in source.%s%s" 19734msgstr "Kaynakta proje başlığı değiştirilemiyor .%s %s" 19735 19736#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory 19737msgid "Unable to clean up destination directory" 19738msgstr "Hedef klasör temizlenemedi" 19739 19740#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions 19741#, object-pascal-format 19742msgid "Unable to clean up \"%s\".%sPlease check permissions." 19743msgstr "\"%s\"dosyasını temizleyemiyor %s Lütfen izinleri kontrol edin." 19744 19745#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat 19746#, object-pascal-format 19747msgid "Unable to convert component text into binary format:%s%s" 19748msgstr "Bileşen metni ikili biçimde dönüştürülemiyor: %s %s" 19749 19750#: lazarusidestrconsts.lisunabletoconvertfileerror 19751#, object-pascal-format 19752msgid "Unable to convert file \"%s\"%sError: %s" 19753msgstr "Dosya \"%s\" %sHata: %s" 19754 19755#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream 19756#, object-pascal-format 19757msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" 19758msgstr "%s dosyası \"%s\" %s akışı ikili sistem ( %s) dosyasının metin form verilerini dönüştürmek mümkün değil" 19759 19760#: lazarusidestrconsts.lisunabletoconverttoencoding 19761#, object-pascal-format 19762msgid "Unable to convert to encoding \"%s\"" 19763msgstr "\"%s\" kodlamasına dönüştürülemez" 19764 19765#: lazarusidestrconsts.lisunabletocopyfile 19766msgid "Unable to copy file" 19767msgstr "Dosya kopyalanamıyor" 19768 19769#: lazarusidestrconsts.lisunabletocopyfileto 19770#, object-pascal-format 19771msgid "Unable to copy file \"%s\"%sto \"%s\"" 19772msgstr "Dosya \"%s\"%s ye \"%s\" kopyalanamıyor" 19773 19774#: lazarusidestrconsts.lisunabletocreatedirectory 19775#, object-pascal-format 19776msgid "Unable to create directory \"%s\"." 19777msgstr "\"%s\" dizini oluşturulamadı." 19778 19779#: lazarusidestrconsts.lisunabletocreatefile 19780msgid "Unable to create file" 19781msgstr "Dosya oluşturulamadı" 19782 19783#: lazarusidestrconsts.lisunabletocreatefile2 19784#, object-pascal-format 19785msgid "Unable to create file \"%s\"" 19786msgstr "\"%s\" dosyası oluşturulamadı." 19787 19788#: lazarusidestrconsts.lisunabletocreatefile3 19789#, object-pascal-format 19790msgid "Unable to create file%s\"%s\"" 19791msgstr "%s dosyası \" %s\" dosyası oluşturulamadı." 19792 19793#: lazarusidestrconsts.lisunabletocreatelinkwithtarget 19794#, object-pascal-format 19795msgid "Unable to create link \"%s\" with target \"%s\"" 19796msgstr "Hedef \"%s\"\" ile \" %s \" bağlantısı oluşturulamadı" 19797 19798#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto 19799msgid "Unable to create new file because there is already a directory with this name." 19800msgstr "Yeni bir dosya oluşturulamadı, çünkü zaten bu ada sahip bir klasör var." 19801 19802#: lazarusidestrconsts.lisunabletocreatenewmethod 19803msgid "Unable to create new method." 19804msgstr "Yeni yöntem oluşturulamadı." 19805 19806#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer 19807msgid "Unable to create temporary lfm buffer." 19808msgstr "Geçici lfm arabelleği oluşturulamadı." 19809 19810#: lazarusidestrconsts.lisunabletodelete 19811msgid "Unable to delete" 19812msgstr "Silinemiyor" 19813 19814#: lazarusidestrconsts.lisunabletodeleteambiguousfile 19815#, object-pascal-format 19816msgid "Unable to delete ambiguous file \"%s\"" 19817msgstr "Belirsiz dosya \"%s\" silinemiyor" 19818 19819#: lazarusidestrconsts.lisunabletoexecute 19820#, object-pascal-format 19821msgid "unable to execute: %s" 19822msgstr "yürütemedi: %s" 19823 19824#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe 19825msgid "Unable to find a ResourceString section in this or any of the used units." 19826msgstr "Bu ya da kullanılan birimlerden herhangi birinde bir ResourceString bölümü bulunamadı." 19827 19828#: lazarusidestrconsts.lisunabletofindavalidclassnamein 19829#, object-pascal-format 19830msgid "Unable to find a valid classname in \"%s\"" 19831msgstr "\"%s \" 'da geçerli bir sınıf adı bulunamadı" 19832 19833#: lazarusidestrconsts.lisunabletofindfile 19834#, object-pascal-format 19835msgid "Unable to find file \"%s\"." 19836msgstr "\"%s\" dosyası bulunamadı." 19837 19838#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption 19839#, object-pascal-format 19840msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" 19841msgstr "\"%s\" dosyası bulunamıyor. %s Programınıza aitse, %s Proje -> Derleyici Seçenekleri -> Arama Yolları -> Diğer Birim Dosyaları içindeki arama yolunu kontrol edin. Bu dosya bir pakete aitse, uygun paket derleyici seçeneklerini kontrol edin. Bu dosya Lazarus'a aitse, derlemeyi temizlediğinizden emin olun. Dosya FPC'ye aitse, fpc.cfg dosyasını kontrol edin. Emin değilseniz, Proje -> Derleyici Seçenekleri -> Test'i kontrol edin" 19842 19843#: lazarusidestrconsts.lisunabletofindinlfmstream 19844#, object-pascal-format 19845msgid "Unable to find %s in LFM Stream." 19846msgstr "LFM Akışında %s bulunamadı." 19847 19848#: lazarusidestrconsts.lisunabletofindmethod 19849msgid "Unable to find method." 19850msgstr "Yöntem bulunamadı." 19851 19852#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile 19853#, object-pascal-format 19854msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" 19855msgstr ".lfm dosyası %s \"%s\" için Pascal birimi (.pas, .pp) bulunamadı" 19856 19857#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar 19858#, object-pascal-format 19859msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" 19860msgstr "\"%s\" bileşen sınıfı bulunamadı.%s RegisterClass üzerinden kayıtlı değil ve lfm bulunamadı. %s Bu birime ihtiyaç duyuluyor:%s%s" 19861 19862#: lazarusidestrconsts.lisunabletogathereditorchanges 19863msgid "Unable to gather editor changes." 19864msgstr "Editör değişiklikleri alınamadı." 19865 19866#: lazarusidestrconsts.lisunabletogetsourcefordesigner 19867msgid "Unable to get source for designer." 19868msgstr "Tasarımcı için kaynak bulunamadı." 19869 19870#: lazarusidestrconsts.lisunabletoloadfile2 19871#, object-pascal-format 19872msgid "unable to load file %s: %s" 19873msgstr "%s dosyası yüklenemedi: %s" 19874 19875#: lazarusidestrconsts.lisunabletoloadpackage 19876#, object-pascal-format 19877msgid "Unable to load package \"%s\"" 19878msgstr "\"%s\" Paketi yüklenemedi" 19879 19880#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits 19881#, object-pascal-format 19882msgid "Unable to load the component class \"%s\" because it depends on itself." 19883msgstr "\"%s\" bileşen sınıfı yüklenemiyor çünkü kendisine bağımlı." 19884 19885#: lazarusidestrconsts.lisunabletoopen 19886#, object-pascal-format 19887msgid "Unable to open \"%s\"" 19888msgstr "\"%s\" açılamıyor" 19889 19890#: lazarusidestrconsts.lisunabletoopenancestorcomponent 19891msgid "Unable to open ancestor component" 19892msgstr "Bileşenin atası açılamıyor" 19893 19894#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades 19895#, object-pascal-format 19896msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." 19897msgstr "Tasarımcı açılamıyor.%s %s sınıfı, TForm veya TDataModule gibi bir tasarım sınıfından kaynaklanmıyor." 19898 19899#: lazarusidestrconsts.lisunabletoread 19900#, object-pascal-format 19901msgid "Unable to read %s" 19902msgstr "%s okunamadı" 19903 19904#: lazarusidestrconsts.lisunabletoreadfile 19905msgid "Unable to read file" 19906msgstr "Dosyayı okunamıyor" 19907 19908#: lazarusidestrconsts.lisunabletoreadfile2 19909#, object-pascal-format 19910msgid "Unable to read file \"%s\"." 19911msgstr "Dosya \"%s\" okunamadı." 19912 19913#: lazarusidestrconsts.lisunabletoreadfileerror 19914#, object-pascal-format 19915msgid "Unable to read file \"%s\"%sError: %s" 19916msgstr "Dosya okunamıyor \"%s\"%sHata: %s" 19917 19918#: lazarusidestrconsts.lisunabletoreadlpi 19919msgid "Unable to read lpi" 19920msgstr "Lpi okunamıyor" 19921 19922#: lazarusidestrconsts.lisunabletoreadprocessexitstatus 19923msgid "unable to read process ExitStatus" 19924msgstr "exitStatus işlemi okunamıyor" 19925 19926#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile 19927#, object-pascal-format 19928msgid "Unable to read the project info file%s\"%s\"." 19929msgstr "Proje bilgi dosyası %s\"%s\" okunamadı." 19930 19931#: lazarusidestrconsts.lisunabletoremoveoldbackupfile 19932#, object-pascal-format 19933msgid "Unable to remove old backup file \"%s\"!" 19934msgstr "Eski yedek dosyası \"%s\"kaldırılamadı!" 19935 19936#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource 19937#, object-pascal-format 19938msgid "Unable to remove project scaled from source.%s%s" 19939msgstr "Ölçeklendirme proje kaynağından kaldırılamıyor %s%s" 19940 19941#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource 19942#, object-pascal-format 19943msgid "Unable to remove project title from source.%s%s" 19944msgstr "Proje başlığını kaynaktan kaldıramadı %s%s" 19945 19946#: lazarusidestrconsts.lisunabletorenameambiguousfileto 19947#, object-pascal-format 19948msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" 19949msgstr "Belirsiz dosyayı \"%s\" %sto \"%s\"\" olarak yeniden adlandıramıyor" 19950 19951#: lazarusidestrconsts.lisunabletorenamefile 19952msgid "Unable to rename file" 19953msgstr "Dosya yeniden adlandırılamıyor" 19954 19955#: lazarusidestrconsts.lisunabletorenamefileto 19956#, object-pascal-format 19957msgid "Unable to rename file \"%s\" to \"%s\"!" 19958msgstr "\"%s\" dosyasını \"%s\" olarak yeniden adlandırılamadı!" 19959 19960#: lazarusidestrconsts.lisunabletorenamefileto2 19961#, object-pascal-format 19962msgid "Unable to rename file \"%s\"%sto \"%s\"." 19963msgstr "\"%s\"%s Dosyasını \"%s\" yeniden adlandırılamıyor." 19964 19965#: lazarusidestrconsts.lisunabletorenameforminsource 19966msgid "Unable to rename form in source." 19967msgstr "Kaynak formun adı yeniden adlandırılamadı." 19968 19969#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag 19970msgid "Unable to rename method. Please fix the error shown in the message window." 19971msgstr "Metni yeniden adlandıramıyor, lütfen ileti penceresinde gösterilen hatayı düzeltin." 19972 19973#: lazarusidestrconsts.lisunabletorenamevariableinsource 19974msgid "Unable to rename variable in source." 19975msgstr "Kaynaktaki değişken adını yeniden adlandırılamadı." 19976 19977#: lazarusidestrconsts.lisunabletorun 19978msgid "Unable to run" 19979msgstr "Çalıştırılamadı" 19980 19981#: lazarusidestrconsts.lisunabletorun2 19982#, object-pascal-format 19983msgid "Unable to run \"%s\"" 19984msgstr "\"%s\" Çalıştırılamadı" 19985 19986#: lazarusidestrconsts.lisunabletosetanchorsidecontrol 19987msgid "Unable to set AnchorSide Control" 19988msgstr "AnchorSide Kontrolü ayarlanamadı" 19989 19990#: lazarusidestrconsts.lisunabletoshowmethod 19991msgid "Unable to show method." 19992msgstr "Yöntem gösterilemiyor." 19993 19994#: lazarusidestrconsts.lisunabletostreamselectedcomponents 19995msgid "Unable to stream selected components" 19996msgstr "Seçilen bileşenler aktarılamıyor" 19997 19998#: lazarusidestrconsts.lisunabletostreamselectedcomponents2 19999msgid "Unable to stream selected components." 20000msgstr "Seçilen bileşenler aktarılamıyor." 20001 20002#: lazarusidestrconsts.lisunabletostreamt 20003#, object-pascal-format 20004msgid "Unable to stream %s:T%s." 20005msgstr "%s akış yapılamadı: T%s." 20006 20007#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext 20008#, object-pascal-format 20009msgid "Unable to transform binary component stream of %s:T%s into text." 20010msgstr "%s:T%s'nin ikili bileşen akışını metin haline dönüştürülemez." 20011 20012#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource 20013msgid "Unable to update CreateForm statement in project source" 20014msgstr "Proje kaynağında CreateForm deyimi güncelleştirilemiyor" 20015 20016#: lazarusidestrconsts.lisunabletowrite2 20017#, object-pascal-format 20018msgid "Unable to write \"%s\"" 20019msgstr "\"%s\" yazamıyor" 20020 20021#: lazarusidestrconsts.lisunabletowritefile 20022msgid "Unable to write file" 20023msgstr "Dosya yazamadı" 20024 20025#: lazarusidestrconsts.lisunabletowritefile2 20026#, object-pascal-format 20027msgid "Unable to write file \"%s\"." 20028msgstr "Dosya \"%s\" yazılamadı." 20029 20030#: lazarusidestrconsts.lisunabletowritefileerror 20031#, object-pascal-format 20032msgid "Unable to write file \"%s\"%sError: %s" 20033msgstr "Dosya \"%s\"%sHata: %s yazılamıyor" 20034 20035#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror 20036#, object-pascal-format 20037msgid "Unable to write the project info file%s\"%s\".%sError: %s" 20038msgstr "Proje bilgi dosyası %s\"%s\" yazılamadı %sHata: %s" 20039 20040#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror 20041#, object-pascal-format 20042msgid "Unable to write the project session file%s\"%s\".%sError: %s" 20043msgstr "Proje oturum dosyası %s\"%s\" yazılamadı %sHata: %s" 20044 20045#: lazarusidestrconsts.lisunabletowritetofile2 20046#, object-pascal-format 20047msgid "Unable to write to file \"%s\"." 20048msgstr "\"%s\" dosyasına yazılamıyor." 20049 20050#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror 20051#, object-pascal-format 20052msgid "Unable to write xml stream to %s%sError: %s" 20053msgstr "%s%s xml akışı yazılamadı Hata:%s" 20054 20055#: lazarusidestrconsts.lisuncheckall 20056msgid "Uncheck All" 20057msgstr "Tüm işareti kaldır" 20058 20059#: lazarusidestrconsts.lisundo 20060msgid "Undo" 20061msgstr "Geri" 20062 20063#: lazarusidestrconsts.lisuninstall 20064#, object-pascal-format 20065msgid "Uninstall %s" 20066msgstr "%s kaldırıldı" 20067 20068#: lazarusidestrconsts.lisuninstallimpossible 20069msgid "Uninstall impossible" 20070msgstr "Kaldırmak imkansız" 20071 20072#: lazarusidestrconsts.lisuninstallselection 20073msgid "Uninstall selection" 20074msgstr "Seçimi kaldır" 20075 20076#: lazarusidestrconsts.lisunit 20077msgctxt "lazarusidestrconsts.lisunit" 20078msgid "Unit" 20079msgstr "Birim" 20080 20081#: lazarusidestrconsts.lisunithaschangedsave 20082#, object-pascal-format 20083msgid "Unit \"%s\" has changed. Save?" 20084msgstr "Birim \"%s\"değiştirildi. Değişiklikler kaydedilsin mi?" 20085 20086#: lazarusidestrconsts.lisunitidentifierexists 20087msgid "Unit identifier exists" 20088msgstr "Birim tanımlayıcı var" 20089 20090#: lazarusidestrconsts.lisunitinpackage 20091#, object-pascal-format 20092msgid "%s unit %s in package %s" 20093msgstr "%s birimi %s, %s paketinde" 20094 20095#: lazarusidestrconsts.lisunitmustsavebeforeinherit 20096#, object-pascal-format 20097msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?" 20098msgstr "" 20099 20100#: lazarusidestrconsts.lisunitnamealreadyexistscap 20101msgid "Unitname already in project" 20102msgstr "Birim adı zaten projede" 20103 20104#: lazarusidestrconsts.lisunitnamebeginswith 20105msgid "Unit name begins with ..." 20106msgstr "Birim adı başlıyor ..." 20107 20108#: lazarusidestrconsts.lisunitnamecontains 20109msgid "Unit name contains ..." 20110msgstr "Birim adı içeriyor ..." 20111 20112#: lazarusidestrconsts.lisunitnotfound 20113#, object-pascal-format 20114msgid "unit %s not found" 20115msgstr "birim %s bulunamadı" 20116 20117#: lazarusidestrconsts.lisunitnotfoundatnewposition 20118#, object-pascal-format 20119msgid "unit %s not found at new position \"%s\"" 20120msgstr "%s birimi \"%s\" yeni konumunda bulunamadı \"" 20121 20122#: lazarusidestrconsts.lisunitnotfoundinproject 20123#, object-pascal-format 20124msgid "A unit not found in project %s" 20125msgstr "%s projesinde bulunmayan bir birim" 20126 20127#: lazarusidestrconsts.lisunitoutputdirectory 20128msgid "Unit Output directory" 20129msgstr "Birim Çıktı Dizini" 20130 20131#: lazarusidestrconsts.lisunitpath 20132msgid "unit path" 20133msgstr "birim yolu" 20134 20135#: lazarusidestrconsts.lisunitpaths 20136msgid "Unit paths" 20137msgstr "Birim yolları" 20138 20139#: lazarusidestrconsts.lisunitrequirespackage 20140#, object-pascal-format 20141msgid "unit %s requires package %s" 20142msgstr "%s birimi %s paketini gerektiriyor" 20143 20144#: lazarusidestrconsts.lisunitsnotfoundinproject 20145#, object-pascal-format 20146msgid "Units not found in project %s" 20147msgstr "%s projesinde bulunmayan birimler" 20148 20149#: lazarusidestrconsts.lisunsigned 20150msgid "Unsigned" 20151msgstr "İmzasız" 20152 20153#: lazarusidestrconsts.lisunusedunitsof 20154#, object-pascal-format 20155msgid "Unused units of %s" 20156msgstr "%s kullanılmayan birimler" 20157 20158#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor 20159msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." 20160msgstr "Alışılmadık derleyici dosya adı Genellikle fpc, ppc veya ppcross ile başlar." 20161 20162#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa 20163msgid "Unusual pas2js compiler file name. Usually it starts with pas2js." 20164msgstr "Olağandışı pas2js derleyici dosya adı. Genellikle pas2js ile başlar." 20165 20166#: lazarusidestrconsts.lisup 20167msgid "Up" 20168msgstr "Yukarı" 20169 20170#: lazarusidestrconsts.lisupdateapplicationcreateform 20171msgid "Update Application.CreateForm statements in main unit" 20172msgstr "Ana ünitede Application.CreateForm deyimlerini güncelleyin" 20173 20174#: lazarusidestrconsts.lisupdateapplicationscaledstatement 20175msgid "Update Application.Scaled statement in main unit" 20176msgstr "Ana ünitede Application.Scaled deyimlerini güncelleyin" 20177 20178#: lazarusidestrconsts.lisupdateapplicationtitlestatement 20179msgid "Update Application.Title statement in main unit" 20180msgstr "Ana ünitede Application.Title deyimlerini güncelleyin" 20181 20182#: lazarusidestrconsts.lisupdateinfo 20183msgid "Update info" 20184msgstr "Güncelleme bilgisi" 20185 20186#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha 20187msgid "Update other procedure signatures when only letter case has changed" 20188msgstr "Yalnızca harf durumu değiştiğinde diğer prosedür imzalarını güncelleyin" 20189 20190#: lazarusidestrconsts.lisupdatereferences 20191msgid "Update references?" 20192msgstr "Kaynaklar güncellensin mi?" 20193 20194#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage 20195#, object-pascal-format 20196msgid "Updating PO files failed for package %s" 20197msgstr "PO dosyası güncellemesi %s paketinde başarısız oldu" 20198 20199#: lazarusidestrconsts.lisupgrade 20200msgid "Upgrade" 20201msgstr "Yükselt" 20202 20203#: lazarusidestrconsts.lisupgradeconfiguration 20204msgid "Upgrade configuration" 20205msgstr "Yapılandırmayı yükselt" 20206 20207#: lazarusidestrconsts.lisuppercasestring 20208msgid "uppercase string" 20209msgstr "büyük harf" 20210 20211#: lazarusidestrconsts.lisuppercasestringgivenasparameter 20212msgid "Uppercase string given as parameter." 20213msgstr "Parametre olarak verilen büyük harfli string." 20214 20215#: lazarusidestrconsts.lisurlonwikithebaseurlis 20216#, object-pascal-format 20217msgid "URL on wiki (the base url is %s)" 20218msgstr "Wiki'deki URL (temel url %s)" 20219 20220#: lazarusidestrconsts.lisusagemessagehoption 20221msgid "Usage message (-h option)" 20222msgstr "Kullanım mesajı (-h seçeneği)" 20223 20224#: lazarusidestrconsts.lisuse 20225msgid "Use" 20226msgstr "Kullan" 20227 20228#: lazarusidestrconsts.lisuseansistrings 20229msgctxt "lazarusidestrconsts.lisuseansistrings" 20230msgid "Use Ansistrings" 20231msgstr "Ansistrings kullanın" 20232 20233#: lazarusidestrconsts.lisusecheckboxforbooleanvalues 20234msgid "Use CheckBox for Boolean values" 20235msgstr "Boolean değerleri için CheckBox kullanın" 20236 20237#: lazarusidestrconsts.lisusecommentsincustomoptions 20238msgid "Use comments in custom options" 20239msgstr "Özel seçeneklerdeki yorumları kullanın" 20240 20241#: lazarusidestrconsts.lisusedby 20242#, object-pascal-format 20243msgid " used by %s" 20244msgstr " %s tarafından kullanılıyor" 20245 20246#: lazarusidestrconsts.lisusedesigntimepackages 20247msgid "Use design time packages" 20248msgstr "Tasarım zaman paketlerini kullanın" 20249 20250#: lazarusidestrconsts.lisusedforautocreatedforms 20251msgid "Used for auto-created forms." 20252msgstr "Otomatik oluşturulan formlar için kullanılır." 20253 20254#: lazarusidestrconsts.lisusefilterforextrafiles 20255msgid "Use filter to include extra files" 20256msgstr "Ekstra dosyalar eklemek için filtre kullanın" 20257 20258#: lazarusidestrconsts.lisuseidentifier 20259msgid "Use identifier" 20260msgstr "Tanımlayıcı kullan" 20261 20262#: lazarusidestrconsts.lisuseidentifierinat 20263#, object-pascal-format 20264msgid "Use identifier %s in %s at %s" 20265msgstr "%s içindeki tanımlayıcı %s'yi kullanın %s" 20266 20267#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox 20268msgid "Launching application" 20269msgstr "Uygulama başlatılıyor" 20270 20271#: lazarusidestrconsts.lisusepackageinpackage 20272#, object-pascal-format 20273msgid "Use package %s in package %s" 20274msgstr "Paket %s içerisindeki paketi %s kullan" 20275 20276#: lazarusidestrconsts.lisusepackageinpackage2 20277msgid "Use package in package" 20278msgstr "Paketde paketi kullanın" 20279 20280#: lazarusidestrconsts.lisusepackageinproject 20281#, object-pascal-format 20282msgid "Use package %s in project" 20283msgstr "Projede %s paketini kullan" 20284 20285#: lazarusidestrconsts.lisusepackageinproject2 20286msgid "Use package in project" 20287msgstr "Projede paketi kullan" 20288 20289#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd 20290#, object-pascal-format 20291msgid "Add to list \"%s\"" 20292msgstr "Listeye ekle \"%s\"" 20293 20294#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup 20295msgid "User defined text markup" 20296msgstr "Kullanıcı tanımlı metin biçimlendirme" 20297 20298#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove 20299#, object-pascal-format 20300msgid "Remove from list \"%s\"" 20301msgstr "Listeden kaldır \"%s\"" 20302 20303#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle 20304#, object-pascal-format 20305msgid "Toggle on list \"%s\"" 20306msgstr "Listede aç \"%s\"" 20307 20308#: lazarusidestrconsts.lisusershomedirectory 20309msgid "User's home directory" 20310msgstr "Kullanıcının ana dizini" 20311 20312#: lazarusidestrconsts.lisuseunit 20313msgid "Add Unit to Uses Section" 20314msgstr "Uses bölümüne birim Ekle" 20315 20316#: lazarusidestrconsts.lisuseunitinunit 20317#, object-pascal-format 20318msgid "Use unit %s in unit %s" 20319msgstr "%s biriminde %s birimini kullan" 20320 20321#: lazarusidestrconsts.lisutf8withbom 20322msgid "UTF-8 with BOM" 20323msgstr "BOM ile UTF-8" 20324 20325#: lazarusidestrconsts.lisvalue 20326msgctxt "lazarusidestrconsts.lisvalue" 20327msgid "Value" 20328msgstr "Değer" 20329 20330#: lazarusidestrconsts.lisvalue2 20331#, object-pascal-format 20332msgid "Value%s" 20333msgstr "Değer %s" 20334 20335#: lazarusidestrconsts.lisvalue3 20336msgid "Value: " 20337msgstr "Değer: " 20338 20339#: lazarusidestrconsts.lisvalues 20340msgid "Values" 20341msgstr "Değerler" 20342 20343#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault 20344msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector." 20345msgstr "Varsayılandan değiştirilen değerler .lfm dosyasında saklanır ve Nesne Denetçisi'nde farklı gösterilir." 20346 20347#: lazarusidestrconsts.lisvariable 20348msgid "Variable" 20349msgstr "Değişken" 20350 20351#: lazarusidestrconsts.lisverbose 20352msgctxt "lazarusidestrconsts.lisverbose" 20353msgid "Verbose" 20354msgstr "Ayrıntılı" 20355 20356#: lazarusidestrconsts.lisverifymethodcalls 20357msgid "Verify method calls" 20358msgstr "Yöntem çağrılarını doğrulayın" 20359 20360#: lazarusidestrconsts.lisversion 20361msgid "Version" 20362msgstr "Sürüm" 20363 20364#: lazarusidestrconsts.lisversionmismatch 20365msgid "Version mismatch" 20366msgstr "Sürüm uyuşmazlığı" 20367 20368#: lazarusidestrconsts.lisvertical 20369msgid "Vertical" 20370msgstr "Dikey" 20371 20372#: lazarusidestrconsts.lisvertoclipboard 20373msgid "Copy version information to clipboard" 20374msgstr "Sürüm bilgilerini panoya kopyala" 20375 20376#: lazarusidestrconsts.lisveryverbose 20377msgid "Very Verbose" 20378msgstr "Çok Ayrıntılı" 20379 20380#: lazarusidestrconsts.lisviewbreakpointproperties 20381msgctxt "lazarusidestrconsts.lisviewbreakpointproperties" 20382msgid "Breakpoint Properties ..." 20383msgstr "Kesme Noktası Özellikleri ..." 20384 20385#: lazarusidestrconsts.lisviewsource 20386msgid "View Source" 20387msgstr "Kaynağı Görüntüle" 20388 20389#: lazarusidestrconsts.lisviewsourcedisass 20390msgctxt "lazarusidestrconsts.lisviewsourcedisass" 20391msgid "View Assembler" 20392msgstr "Assembler Görüntüle" 20393 20394#: lazarusidestrconsts.lisviewsourcelfm 20395msgid "View Source (.lfm)" 20396msgstr "Kaynağı Görüntüle (.lfm)" 20397 20398#: lazarusidestrconsts.liswarning 20399msgid "Warning: " 20400msgstr "Uyarı: " 20401 20402#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis 20403#, object-pascal-format 20404msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\"" 20405msgstr "Uyarı: belirsiz dosya bulundu: \"%s\". Kaynak dosya: \"%s\"" 20406 20407#: lazarusidestrconsts.liswarnings 20408#, object-pascal-format 20409msgid ", Warnings: %s" 20410msgstr ", Uyarılar: %s" 20411 20412#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas 20413#, object-pascal-format 20414msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." 20415msgstr "%s Uyarı: Bu ana ünitedir, yeni ana ünite %s.pas olacaktır." 20416 20417#: lazarusidestrconsts.liswatch 20418msgid "&Watch" 20419msgstr "&İzle" 20420 20421#: lazarusidestrconsts.liswatchdata 20422msgid "Watch:" 20423msgstr "İzle:" 20424 20425#: lazarusidestrconsts.liswatchkind 20426msgid "Watch action" 20427msgstr "Eylem izle" 20428 20429#: lazarusidestrconsts.liswatchkindread 20430msgid "Read" 20431msgstr "Oku" 20432 20433#: lazarusidestrconsts.liswatchkindreadwrite 20434msgid "Read/Write" 20435msgstr "Oku/Yaz" 20436 20437#: lazarusidestrconsts.liswatchkindwrite 20438msgid "Write" 20439msgstr "Yaz" 20440 20441#: lazarusidestrconsts.liswatchpoint 20442msgid "&Data/Watch Breakpoint ..." 20443msgstr "&Veri/İzleme Noktası ..." 20444 20445#: lazarusidestrconsts.liswatchpointbreakpoint 20446msgid "&Data/watch Breakpoint ..." 20447msgstr "&Veri/İzleme noktası ..." 20448 20449#: lazarusidestrconsts.liswatchpropert 20450msgid "Watch Properties" 20451msgstr "İzleme Özellikleri" 20452 20453#: lazarusidestrconsts.liswatchscope 20454msgid "Watch scope" 20455msgstr "Kapsamı izle" 20456 20457#: lazarusidestrconsts.liswatchscopeglobal 20458msgctxt "lazarusidestrconsts.liswatchscopeglobal" 20459msgid "Global" 20460msgstr "Küresel" 20461 20462#: lazarusidestrconsts.liswatchscopelocal 20463msgid "Declaration" 20464msgstr "Deklarasyon" 20465 20466#: lazarusidestrconsts.liswatchtowatchpoint 20467msgid "Create &Data/Watch Breakpoint ..." 20468msgstr "Veri/İzleme Noktası oluştur..." 20469 20470#: lazarusidestrconsts.liswelcometolazaruside 20471#, object-pascal-format 20472msgid "Welcome to Lazarus IDE %s" 20473msgstr "Lazarus IDE %s ya hoş geldiniz" 20474 20475#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve 20476#, object-pascal-format 20477msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" 20478msgstr "Lazarus %s%s 'a hoş geldiniz %s%s içinde %s sürümünden bir yapılandırma zaten var" 20479 20480#: lazarusidestrconsts.liswhatneedsbuilding 20481msgid "What needs building" 20482msgstr "Derlemeye ne gerek var" 20483 20484#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences 20485msgid "When a unit is renamed, update references" 20486msgstr "Bir birim yeniden adlandırıldığında, referansları güncelleyin" 20487 20488#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew 20489msgid "When enabled the current options are saved to the template which is used when creating new projects" 20490msgstr "Etkinleştirildiğinde, mevcut seçenekler yeni proje oluştururken kullanılan şablona kaydedilir" 20491 20492#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed 20493msgid "When there is only one possible completion item use it immediately, without showing the completion box" 20494msgstr "Yalnızca bir olası tamamlama öğesi olduğunda, tamamlama kutusunu göstermeden hemen kullanın" 20495 20496#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein 20497msgid "When the source editor cursor moves, show the current node in the code explorer" 20498msgstr "Kaynak editörü imleci hareket edince, kod gezgini içindeki geçerli düğümü gösterin" 20499 20500#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform 20501msgid "Window menu shows designed form's name instead of caption" 20502msgstr "Pencere menüsü, resim yazısının yerine tasarlanmış form adını gösterir" 20503 20504#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint 20505msgid "Useful especially if the caption is left empty." 20506msgstr "Özellikle altyazı boş bırakılırsa kullanışlıdır." 20507 20508#: lazarusidestrconsts.liswindowstaysontop 20509msgid "Window stays on top" 20510msgstr "Herzaman üstte" 20511 20512#: lazarusidestrconsts.liswithincludes2 20513msgid ", with includes " 20514msgstr ", içerir " 20515 20516#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw 20517msgid "Without a proper compiler the code browsing and compiling will be disappointing." 20518msgstr "Uygun bir derleyici olmadan, kod tarama ve derleme hayal kırıklığı yaratacaktır." 20519 20520#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing 20521msgid "Without a proper debugger, debugging will be disappointing." 20522msgstr "Düzgün bir hata ayıklayıcı olmadan, hata ayıklama hayal kırıklığı yaratacaktır." 20523 20524#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn 20525msgid "Without a proper Lazarus directory you will get a lot of warnings." 20526msgstr "Uygun bir Lazarus dizini olmadan çok fazla uyarı alırsınız." 20527 20528#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis 20529msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." 20530msgstr "Uygun bir \"make\" yürütülebilir dosyası olmadan IDE'nin derlenmesi mümkün değildir." 20531 20532#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio 20533msgid "Without the proper FPC sources code browsing and completion will be very limited." 20534msgstr "Doğru FPC kaynakları olmadan kod tarama ve tamamlama çok sınırlı olacaktır." 20535 20536#: lazarusidestrconsts.liswithrequiredpackages 20537msgid "With required packages" 20538msgstr "Gerekli paketler ile" 20539 20540#: lazarusidestrconsts.liswldeleteall 20541msgid "De&lete All" 20542msgstr "H&epsini sil" 20543 20544#: lazarusidestrconsts.liswldisableall 20545msgid "D&isable All" 20546msgstr "Tü&münü devre dışı bırak" 20547 20548#: lazarusidestrconsts.liswlenableall 20549msgid "E&nable All" 20550msgstr "Hepsi&ni etkinleştir" 20551 20552#: lazarusidestrconsts.liswlexpression 20553msgid "Expression" 20554msgstr "İfade" 20555 20556#: lazarusidestrconsts.liswlinspectpane 20557msgid "Inspect pane" 20558msgstr "Bölmeyi inceleyin" 20559 20560#: lazarusidestrconsts.liswlproperties 20561msgid "&Properties" 20562msgstr "&Özellikler" 20563 20564#: lazarusidestrconsts.liswlwatchlist 20565msgctxt "lazarusidestrconsts.liswlwatchlist" 20566msgid "Watches" 20567msgstr "İzlemeler" 20568 20569#: lazarusidestrconsts.liswordatcursorincurrenteditor 20570msgid "Word at cursor in current editor" 20571msgstr "İmleçteki sözcükler geçerli düzenleyicide" 20572 20573#: lazarusidestrconsts.lisworkingdirectoryforbuilding 20574msgid "Working directory for building" 20575msgstr "Derleme için çalışma dizini" 20576 20577#: lazarusidestrconsts.lisworkingdirectoryforrun 20578msgid "Working directory for run" 20579msgstr "Çalıştırmak için çalışma dizini" 20580 20581#: lazarusidestrconsts.liswriteerror 20582msgid "Write Error" 20583msgstr "Yazma Hatası" 20584 20585#: lazarusidestrconsts.liswriteerrorfile 20586#, object-pascal-format 20587msgid "Write error: %s%sFile: %s%s%s" 20588msgstr "Yazma hatası: %s%sDosya: %s%s%s" 20589 20590#: lazarusidestrconsts.liswritepackageinfofailed 20591msgid "Writing the package info file failed." 20592msgstr "Paket bilgi dosyası yazılamadı." 20593 20594#: lazarusidestrconsts.liswriteprojectinfofailed 20595msgid "Writing the project info file failed." 20596msgstr "Proje bilgi dosyası yazılamadı." 20597 20598#: lazarusidestrconsts.liswrongversionin 20599#, object-pascal-format 20600msgid "wrong version in %s: %s" 20601msgstr "%s içindeki yanlış sürüm: %s" 20602 20603#: lazarusidestrconsts.lisxmlerror 20604msgid "XML Error" 20605msgstr "XML Hatası" 20606 20607#: lazarusidestrconsts.lisxmlparsererrorinfileerror 20608#, object-pascal-format 20609msgid "XML parser error in file %s%sError: %s" 20610msgstr "%s dosyasındaki XML ayrıştırıcı hatası %sHata:%s" 20611 20612#: lazarusidestrconsts.lisyes 20613msgid "Yes" 20614msgstr "Evet" 20615 20616#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed 20617msgid "You can disable this for individual forms via the package editor" 20618msgstr "Bireysel formlar için bunu paket düzenleyicisiyle devre dışı bırakabilirsiniz" 20619 20620#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu 20621msgid "You can disable this for individual forms via the popup menu in the project inspector" 20622msgstr "Bunu, proje denetçisindeki açılır menü aracılığıyla bireysel formlar için devre dışı bırakabilirsiniz" 20623 20624#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor 20625msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" 20626msgstr "FPC ve FPC kaynaklarını http://sourceforge.net/projects/lazarus/?source=dir adresinden indirebilirsiniz" 20627 20628#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling 20629msgid "You cannot build Lazarus while debugging or compiling." 20630msgstr "Hata ayıklama veya derleme yaparken Lazarus'u derleyemezsiniz." 20631 20632#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling 20633msgid "You cannot change the build mode while compiling." 20634msgstr "Derleme yaparken derleme modunu değiştiremezsiniz." 20635 20636#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter 20637msgid "You can select items by simply pressing underscored letters" 20638msgstr "Sadece altı çizili harflere basarak öğeleri seçebilirsiniz" 20639 20640#: lazarusidestrconsts.lis_all_ 20641msgctxt "lazarusidestrconsts.lis_all_" 20642msgid "<All>" 20643msgstr "<Tüm>" 20644 20645#: lazarusidestrconsts.locwndsrceditor 20646msgctxt "lazarusidestrconsts.locwndsrceditor" 20647msgid "Source Editor" 20648msgstr "Kaynak Düzenleyici" 20649 20650#: lazarusidestrconsts.lrsplddeleteselected 20651msgid "Delete selected" 20652msgstr "Seçileni sil" 20653 20654#: lazarusidestrconsts.lrspldinvalid 20655msgid "invalid" 20656msgstr "geçersiz" 20657 20658#: lazarusidestrconsts.lrspldlpkfileinvalid 20659#, object-pascal-format 20660msgid "lpk file invalid (%s)" 20661msgstr "lpk dosyası geçersiz ( %s)" 20662 20663#: lazarusidestrconsts.lrspldlpkfilevalid 20664#, object-pascal-format 20665msgid "lpk file valid (%s)" 20666msgstr "lpk dosyası geçerli ( %s)" 20667 20668#: lazarusidestrconsts.lrspldunabletodeletefile 20669#, object-pascal-format 20670msgid "Unable to delete file \"%s\"" 20671msgstr "\"%s\" dosyasını silemiyor" 20672 20673#: lazarusidestrconsts.lrspldvalid 20674msgid "valid" 20675msgstr "geçerli" 20676 20677#: lazarusidestrconsts.lrsrescanlplfiles 20678msgid "Rescan lpl files" 20679msgstr "Lpl dosyalarını yeniden tara" 20680 20681#: lazarusidestrconsts.lvlgraphaddhorizontalspacing 20682msgid "Add horizontal spacing between columns" 20683msgstr "Sütunlar arasına yatay boşluk ekle" 20684 20685#: lazarusidestrconsts.lvlgraphaddverticalspacingar 20686msgid "Add vertical spacing around nodes" 20687msgstr "Düğümlerin etrafına dikey boşluklar ekleyin" 20688 20689#: lazarusidestrconsts.lvlgraphextraspacing 20690msgid "Extra spacing (x/y)" 20691msgstr "Ekstra boşluk (x/y)" 20692 20693#: lazarusidestrconsts.lvlgraphnamesabovenode 20694msgid "Names above node" 20695msgstr "Düğüm üzerindeki adlar" 20696 20697#: lazarusidestrconsts.lvlgraphoptabsolutelimi 20698msgid "Absolute limit for height of levels" 20699msgstr "Seviye yüksekliği için mutlak limit" 20700 20701#: lazarusidestrconsts.lvlgraphoptcrossings 20702msgid "Crossings" 20703msgstr "Geçişler" 20704 20705#: lazarusidestrconsts.lvlgraphoptedgelen 20706msgid "Edge len" 20707msgstr "Kenar uzunluğu" 20708 20709#: lazarusidestrconsts.lvlgraphoptedges 20710msgid "Edges" 20711msgstr "Kenarlar" 20712 20713#: lazarusidestrconsts.lvlgraphoptinfo 20714msgid "Info" 20715msgstr "Bilgi" 20716 20717#: lazarusidestrconsts.lvlgraphoptlevels 20718msgctxt "lazarusidestrconsts.lvlgraphoptlevels" 20719msgid "Levels" 20720msgstr "Seviyeler" 20721 20722#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl 20723msgid "Limit height of Levels" 20724msgstr "Seviyelerin limit yüksekliği" 20725 20726#: lazarusidestrconsts.lvlgraphoptlimitrelativ 20727#, object-pascal-format 20728msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))" 20729msgstr "Düzeylerin yüksekliği için düğüm sayımına göre sınır.%0sLimit = min(3, val*sqrt(NodeCount))" 20730 20731#: lazarusidestrconsts.lvlgraphoptsplitpoints 20732msgid "Splitpoints" 20733msgstr "Ayrılma noktaları" 20734 20735#: lazarusidestrconsts.lvlgraphreducebackedges 20736msgid "Reduce backedges" 20737msgstr "Yedeklemeleri azalt" 20738 20739#: lazarusidestrconsts.lvlgraphshapecalculatelay 20740msgid "Calculate layout from high-edge" 20741msgstr "Düzeni yüksek kenardan hesapla" 20742 20743#: lazarusidestrconsts.lvlgraphshapecurved 20744msgid "Curved" 20745msgstr "Kavisli" 20746 20747#: lazarusidestrconsts.lvlgraphshapeedgesshape 20748msgid "Edges shape" 20749msgstr "Kenar şekli" 20750 20751#: lazarusidestrconsts.lvlgraphshapeedgessplitmo 20752msgid "Edges split mode" 20753msgstr "Kenarları bölme modu" 20754 20755#: lazarusidestrconsts.lvlgraphshapeminimizeedge 20756msgid "Minimize edges len" 20757msgstr "Kenarları küçült" 20758 20759#: lazarusidestrconsts.lvlgraphshapenodes 20760msgid "Nodes" 20761msgstr "Düğümler" 20762 20763#: lazarusidestrconsts.lvlgraphshapestraight 20764msgid "Straight" 20765msgstr "Düz" 20766 20767#: lazarusidestrconsts.lvlgraphsplitmergeathighe 20768msgid "Merge at highest" 20769msgstr "En yükseğe birleştirme" 20770 20771#: lazarusidestrconsts.lvlgraphsplitmergeatsourc 20772msgid "Merge at source" 20773msgstr "Kaynakta birleştir" 20774 20775#: lazarusidestrconsts.lvlgraphsplitmergeattarge 20776msgid "Merge at target" 20777msgstr "Hedefte Birleştir" 20778 20779#: lazarusidestrconsts.lvlgraphsplitnone 20780msgctxt "lazarusidestrconsts.lvlgraphsplitnone" 20781msgid "None" 20782msgstr "Yok" 20783 20784#: lazarusidestrconsts.lvlgraphsplitseparate 20785msgid "Separate" 20786msgstr "Ayrı" 20787 20788#: lazarusidestrconsts.lvlgraphstraightengraph 20789msgid "Straighten graph" 20790msgstr "Grafiği Düzleştir" 20791 20792#: lazarusidestrconsts.podaddpackageunittousessection 20793msgid "Add package unit to uses section" 20794msgstr "Kullanılan bölümlere paket birimi ekle" 20795 20796#: lazarusidestrconsts.regdlgbinary 20797msgctxt "lazarusidestrconsts.regdlgbinary" 20798msgid "Binary" 20799msgstr "İkili" 20800 20801#: lazarusidestrconsts.regdlgdecimal 20802msgctxt "lazarusidestrconsts.regdlgdecimal" 20803msgid "Decimal" 20804msgstr "Ondalık" 20805 20806#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters 20807msgid "Display type for selected Registers" 20808msgstr "Seçili Kayıt Cihazları İçin Ekran Tipi" 20809 20810#: lazarusidestrconsts.regdlgformat 20811msgid "Format" 20812msgstr "Biçim" 20813 20814#: lazarusidestrconsts.regdlghex 20815msgid "Hex" 20816msgstr "Hex" 20817 20818#: lazarusidestrconsts.regdlgoctal 20819msgid "Octal" 20820msgstr "Sekizli" 20821 20822#: lazarusidestrconsts.regdlgraw 20823msgid "Raw" 20824msgstr "Çiğ" 20825 20826#: lazarusidestrconsts.rsaddinverse 20827msgid "Add Inverse" 20828msgstr "Ters Ekle" 20829 20830#: lazarusidestrconsts.rsaddnewterm 20831msgid "Add new term" 20832msgstr "Yeni terim ekle" 20833 20834#: lazarusidestrconsts.rsattachto 20835msgid "Attach to" 20836msgstr "Ekle" 20837 20838#: lazarusidestrconsts.rsattributes 20839msgid "Attributes" 20840msgstr "Nitelikler" 20841 20842#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber 20843msgid "Automatically increase build number" 20844msgstr "Otomatik olarak üretim numarasını artır" 20845 20846#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint 20847msgid "Increased every time the project is compiled." 20848msgstr "Proje her derlendiğinde arttır." 20849 20850#: lazarusidestrconsts.rsbuild 20851msgid "&Build:" 20852msgstr "&Derle:" 20853 20854#: lazarusidestrconsts.rscharacterset 20855msgid "Character set:" 20856msgstr "Karakter takımı:" 20857 20858#: lazarusidestrconsts.rscloseall 20859msgid "Close all pages" 20860msgstr "Tüm sayfaları kapat" 20861 20862#: lazarusidestrconsts.rsclosecurrentpage 20863msgid "Close current page" 20864msgstr "Geçerli sayfayı kapat" 20865 20866#: lazarusidestrconsts.rscloseleft 20867msgid "Close page(s) on the left" 20868msgstr "Soldaki sayfaları kapat" 20869 20870#: lazarusidestrconsts.rscloseothers 20871msgid "Close other page(s)" 20872msgstr "Diğer sayfaları kapat" 20873 20874#: lazarusidestrconsts.rscloseright 20875msgid "Close page(s) on the right" 20876msgstr "Sağdaki sayfaları kapat" 20877 20878#: lazarusidestrconsts.rsconditionaldefines 20879msgid "Conditional defines" 20880msgstr "Koşullu tanımlar" 20881 20882#: lazarusidestrconsts.rscreatenewdefine 20883msgid "Create new define" 20884msgstr "Yeni tanım oluştur" 20885 20886#: lazarusidestrconsts.rsenablei18n 20887msgid "Enable i18n" 20888msgstr "I18n aktif" 20889 20890#: lazarusidestrconsts.rsenterpid 20891msgid "Enter PID" 20892msgstr "PID gir" 20893 20894#: lazarusidestrconsts.rsfilterthelistwithstring 20895msgid "Filter the lines in list with a string" 20896msgstr "Listedeki satırları bir string ile filtreleme" 20897 20898#: lazarusidestrconsts.rsfoundbutnotlistedhere 20899msgid "Found but not listed here: " 20900msgstr "Bulundu ancak burada listelenmedi: " 20901 20902#: lazarusidestrconsts.rsi18nexcluded 20903msgid "Excluded" 20904msgstr "Dışlanan" 20905 20906#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild 20907msgid "Force update PO files on next build" 20908msgstr "Bir sonraki derlemede PO dosyalarını zorla güncelle" 20909 20910#: lazarusidestrconsts.rsi18nidentifiers 20911msgid "Identifiers:" 20912msgstr "Tanımlayıcılar:" 20913 20914#: lazarusidestrconsts.rsi18noptions 20915msgid "i18n Options" 20916msgstr "i18n Seçenekleri" 20917 20918#: lazarusidestrconsts.rsi18noriginals 20919msgid "Originals:" 20920msgstr "Orjinaller:" 20921 20922#: lazarusidestrconsts.rsincludeversioninfohint 20923msgid "Version info is stored if the executable format supports it." 20924msgstr "Çalıştırılabilir biçim destekliyorsa sürüm bilgisi saklanır." 20925 20926#: lazarusidestrconsts.rsincludeversioninfoinexecutable 20927msgid "Include version info in executable" 20928msgstr "Sürüm bilgilerini çalıştırılabilir dosyaya ekle" 20929 20930#: lazarusidestrconsts.rslanguageafrikaans 20931msgid "Afrikaans" 20932msgstr "Afrika" 20933 20934#: lazarusidestrconsts.rslanguagearabic 20935msgid "Arabic" 20936msgstr "Arapça" 20937 20938#: lazarusidestrconsts.rslanguageautomatic 20939msgid "Automatic (or English)" 20940msgstr "Otomatik (veya İngilizce)" 20941 20942#: lazarusidestrconsts.rslanguagecatalan 20943msgid "Catalan" 20944msgstr "Katalan" 20945 20946#: lazarusidestrconsts.rslanguagechinese 20947msgid "Chinese" 20948msgstr "Çince" 20949 20950#: lazarusidestrconsts.rslanguageczech 20951msgid "Czech" 20952msgstr "Çek" 20953 20954#: lazarusidestrconsts.rslanguagedutch 20955msgid "Dutch" 20956msgstr "Flemenkçe" 20957 20958#: lazarusidestrconsts.rslanguageenglish 20959msgid "English" 20960msgstr "İngilizce" 20961 20962#: lazarusidestrconsts.rslanguagefinnish 20963msgid "Finnish" 20964msgstr "Fince" 20965 20966#: lazarusidestrconsts.rslanguagefrench 20967msgid "French" 20968msgstr "Fransızca" 20969 20970#: lazarusidestrconsts.rslanguagegerman 20971msgid "German" 20972msgstr "Almanca" 20973 20974#: lazarusidestrconsts.rslanguagehebrew 20975msgid "Hebrew" 20976msgstr "İbranice" 20977 20978#: lazarusidestrconsts.rslanguagehungarian 20979msgid "Hungarian" 20980msgstr "Macarca" 20981 20982#: lazarusidestrconsts.rslanguageindonesian 20983msgid "Indonesian" 20984msgstr "Endonezya" 20985 20986#: lazarusidestrconsts.rslanguageitalian 20987msgid "Italian" 20988msgstr "İtalyan" 20989 20990#: lazarusidestrconsts.rslanguagejapanese 20991msgid "Japanese" 20992msgstr "Japonca" 20993 20994#: lazarusidestrconsts.rslanguagelithuanian 20995msgid "Lithuanian" 20996msgstr "Litvanya" 20997 20998#: lazarusidestrconsts.rslanguageoptions 20999msgid "Language options" 21000msgstr "Dil seçenekleri" 21001 21002#: lazarusidestrconsts.rslanguagepolish 21003msgid "Polish" 21004msgstr "Polonya" 21005 21006#: lazarusidestrconsts.rslanguageportuguese 21007msgid "Portuguese" 21008msgstr "Portekizce" 21009 21010#: lazarusidestrconsts.rslanguageportuguesebr 21011msgid "Brazilian Portuguese" 21012msgstr "Brezilya Portekizcesi" 21013 21014#: lazarusidestrconsts.rslanguagerussian 21015msgid "Russian" 21016msgstr "Rusça" 21017 21018#: lazarusidestrconsts.rslanguageselection 21019msgid "Language selection:" 21020msgstr "Dil seçimi:" 21021 21022#: lazarusidestrconsts.rslanguageslovak 21023msgid "Slovak" 21024msgstr "Slovak" 21025 21026#: lazarusidestrconsts.rslanguagespanish 21027msgid "Spanish" 21028msgstr "İspanyol" 21029 21030#: lazarusidestrconsts.rslanguageturkish 21031msgid "Turkish" 21032msgstr "Türkçe" 21033 21034#: lazarusidestrconsts.rslanguageukrainian 21035msgid "Ukrainian" 21036msgstr "Ukrayna" 21037 21038#: lazarusidestrconsts.rsmajorversion 21039msgid "&Major version:" 21040msgstr "&Ana sürüm::" 21041 21042#: lazarusidestrconsts.rsminorversion 21043msgid "Mi&nor version:" 21044msgstr "Küçü&k sürüm:" 21045 21046#: lazarusidestrconsts.rsnewsearchwithsamecriteria 21047msgid "New search with same criteria" 21048msgstr "" 21049 21050#: lazarusidestrconsts.rsotherinfo 21051msgid "Other info" 21052msgstr "Diğer bilgi" 21053 21054#: lazarusidestrconsts.rspooutputdirectory 21055msgid "PO Output Directory:" 21056msgstr "PO Çıktı klasörü:" 21057 21058#: lazarusidestrconsts.rsrefreshthesearch 21059msgid "Refresh the search" 21060msgstr "" 21061 21062#: lazarusidestrconsts.rsresource 21063msgid "Resource" 21064msgstr "Kaynak" 21065 21066#: lazarusidestrconsts.rsresourceclear 21067msgid "Delete all resources?" 21068msgstr "Tüm kaynaklar silinsin mi?" 21069 21070#: lazarusidestrconsts.rsresourcefilename 21071msgid "File name" 21072msgstr "Dosya adı" 21073 21074#: lazarusidestrconsts.rsresourcetype 21075msgctxt "lazarusidestrconsts.rsresourcetype" 21076msgid "Type" 21077msgstr "Tür" 21078 21079#: lazarusidestrconsts.rsrevision 21080msgid "&Revision:" 21081msgstr "&Revizyon:" 21082 21083#: lazarusidestrconsts.rsselectaninheritedentry 21084msgid "Select an inherited entry" 21085msgstr "Devralınan bir girişi seçin" 21086 21087#: lazarusidestrconsts.rsversionnumbering 21088msgid "Version numbering" 21089msgstr "Sürüm numarası" 21090 21091#: lazarusidestrconsts.showoptions 21092msgid "Show options" 21093msgstr "Seçenekleri göster" 21094 21095#: lazarusidestrconsts.srkmcarhelpmenu 21096msgid "Help menu commands" 21097msgstr "Yardım menüsü komutları" 21098 21099#: lazarusidestrconsts.srkmcatcmdcmd 21100msgid "Command commands" 21101msgstr "Komut komutları" 21102 21103#: lazarusidestrconsts.srkmcatcodetools 21104msgid "CodeTools commands" 21105msgstr "Kod Araçları komutları" 21106 21107#: lazarusidestrconsts.srkmcatcolselection 21108msgid "Text column selection commands" 21109msgstr "Metin sütun seçme komutları" 21110 21111#: lazarusidestrconsts.srkmcatcursormoving 21112msgid "Cursor moving commands" 21113msgstr "İmleç hareketi komutları" 21114 21115#: lazarusidestrconsts.srkmcatediting 21116msgid "Text editing commands" 21117msgstr "Metin düzenleme komutları" 21118 21119#: lazarusidestrconsts.srkmcatfilemenu 21120msgid "File menu commands" 21121msgstr "Dosya menüsü komutları" 21122 21123#: lazarusidestrconsts.srkmcatfold 21124msgid "Text folding commands" 21125msgstr "Metin katlama komutları" 21126 21127#: lazarusidestrconsts.srkmcatmacrorecording 21128msgctxt "lazarusidestrconsts.srkmcatmacrorecording" 21129msgid "Macros" 21130msgstr "Makro" 21131 21132#: lazarusidestrconsts.srkmcatmarker 21133msgid "Text bookmark commands" 21134msgstr "Metin işaretleyici komutları" 21135 21136#: lazarusidestrconsts.srkmcatmulticaret 21137msgid "Multi caret commands" 21138msgstr "Çok satırlı komutlar" 21139 21140#: lazarusidestrconsts.srkmcatpackagemenu 21141msgid "Package menu commands" 21142msgstr "Paket menüsü komutları" 21143 21144#: lazarusidestrconsts.srkmcatprojectmenu 21145msgid "Project menu commands" 21146msgstr "Proje menüsü komutları" 21147 21148#: lazarusidestrconsts.srkmcatrunmenu 21149msgid "Run menu commands" 21150msgstr "Çalıştır menüsü komutları" 21151 21152#: lazarusidestrconsts.srkmcatsearchreplace 21153msgid "Text search and replace commands" 21154msgstr "Metin arama ve değiştirme komutları" 21155 21156#: lazarusidestrconsts.srkmcatselection 21157msgid "Text selection commands" 21158msgstr "Metin seçme komutları" 21159 21160#: lazarusidestrconsts.srkmcatsrcnotebook 21161msgid "Source Notebook commands" 21162msgstr "Kaynak Not Defteri komutları" 21163 21164#: lazarusidestrconsts.srkmcatsyncroedit 21165msgid "Syncron Editing" 21166msgstr "Senkronize Düzenle" 21167 21168#: lazarusidestrconsts.srkmcatsyncroeditoff 21169msgid "Syncron Editing (not in Cell)" 21170msgstr "Eşzamanlı Düzenle (Hücrede Değil)" 21171 21172#: lazarusidestrconsts.srkmcatsyncroeditsel 21173msgid "Syncron Editing (while selecting)" 21174msgstr "Eşzamanlı Düzenle (seçilirken)" 21175 21176#: lazarusidestrconsts.srkmcattemplateedit 21177msgid "Template Editing" 21178msgstr "Şablon Düzenle" 21179 21180#: lazarusidestrconsts.srkmcattemplateeditoff 21181msgid "Template Editing (not in Cell)" 21182msgstr "Şablon Düzenle (Hücre Değil)" 21183 21184#: lazarusidestrconsts.srkmcattoolmenu 21185msgid "Tools menu commands" 21186msgstr "Araçlar menüsü komutları" 21187 21188#: lazarusidestrconsts.srkmcatviewmenu 21189msgid "View menu commands" 21190msgstr "Menü komutlarını görüntüle" 21191 21192#: lazarusidestrconsts.srkmcommand 21193msgctxt "lazarusidestrconsts.srkmcommand" 21194msgid "Command:" 21195msgstr "Komut:" 21196 21197#: lazarusidestrconsts.srkmconflic 21198msgid "Conflict " 21199msgstr "Çakışma " 21200 21201#: lazarusidestrconsts.srkmecabortbuild 21202msgid "abort build" 21203msgstr "derlemeyi iptal et" 21204 21205#: lazarusidestrconsts.srkmecabstractmethods 21206msgid "Abstract Methods ..." 21207msgstr "Özet Yöntemler ..." 21208 21209#: lazarusidestrconsts.srkmecaddbpaddress 21210msgid "add address breakpoint" 21211msgstr "adres kesme noktası ekle" 21212 21213#: lazarusidestrconsts.srkmecaddbpsource 21214msgid "add source breakpoint" 21215msgstr "kaynak kesme noktası ekle" 21216 21217#: lazarusidestrconsts.srkmecaddbpwatchpoint 21218msgid "add data/watchpoint" 21219msgstr "veri/gözetleme noktası ekle" 21220 21221#: lazarusidestrconsts.srkmecaddjumppoint 21222msgid "Add Jump Point" 21223msgstr "Atlama Noktası Ekle" 21224 21225#: lazarusidestrconsts.srkmecaddwatch 21226msgid "add watch" 21227msgstr "izleme ekle" 21228 21229#: lazarusidestrconsts.srkmecattach 21230msgid "Attach to program" 21231msgstr "Programa ekle" 21232 21233#: lazarusidestrconsts.srkmecautocompletion 21234msgid "Code template completion" 21235msgstr "Kod şablonu tamamlama" 21236 21237#: lazarusidestrconsts.srkmecblockcopy 21238msgid "Copy Block" 21239msgstr "Bloğu Kopyala" 21240 21241#: lazarusidestrconsts.srkmecblockdelete 21242msgid "Delete Block" 21243msgstr "Bloğu Sil" 21244 21245#: lazarusidestrconsts.srkmecblockgotobegin 21246msgid "Goto Block begin" 21247msgstr "Blok başlangıcına git" 21248 21249#: lazarusidestrconsts.srkmecblockgotoend 21250msgid "Goto Block end" 21251msgstr "Blok sonuna git" 21252 21253#: lazarusidestrconsts.srkmecblockhide 21254msgid "Hide Block" 21255msgstr "Bloğu Gizle" 21256 21257#: lazarusidestrconsts.srkmecblockindent 21258msgid "Indent block" 21259msgstr "Girinti bloğu" 21260 21261#: lazarusidestrconsts.srkmecblockmove 21262msgid "Move Block" 21263msgstr "Bloğu Taşı" 21264 21265#: lazarusidestrconsts.srkmecblocksetbegin 21266msgid "Set block begin" 21267msgstr "Blok başlangıçını ayarla" 21268 21269#: lazarusidestrconsts.srkmecblocksetend 21270msgid "Set block end" 21271msgstr "Blok sonunu ayarla" 21272 21273#: lazarusidestrconsts.srkmecblockshow 21274msgid "Show Block" 21275msgstr "Bloğu göster" 21276 21277#: lazarusidestrconsts.srkmecblocktogglehide 21278msgid "Toggle block" 21279msgstr "Bloğu değiştir" 21280 21281#: lazarusidestrconsts.srkmecblockunindent 21282msgid "Unindent block" 21283msgstr "Girintisiz blok" 21284 21285#: lazarusidestrconsts.srkmecbuild 21286msgid "build program/project" 21287msgstr "program/proje derle" 21288 21289#: lazarusidestrconsts.srkmecbuildfile 21290msgid "build file" 21291msgstr "dosya oluştur" 21292 21293#: lazarusidestrconsts.srkmecbuildlazarus 21294msgid "Build Lazarus" 21295msgstr "Lazarusu Oluştur" 21296 21297#: lazarusidestrconsts.srkmecbuildmanymodes 21298msgid "build many modes" 21299msgstr "birçok mod oluştur" 21300 21301#: lazarusidestrconsts.srkmecchar 21302msgid "Char" 21303msgstr "Karakter" 21304 21305#: lazarusidestrconsts.srkmeccleanupandbuild 21306msgid "clean up and build" 21307msgstr "temizle ve derle" 21308 21309#: lazarusidestrconsts.srkmecclearall 21310msgid "Delete whole text" 21311msgstr "Tüm metni sil" 21312 21313#: lazarusidestrconsts.srkmecclearallbookmark 21314msgid "Clear all Bookmarks" 21315msgstr "Tüm Yer İşaretlerini Temizle" 21316 21317#: lazarusidestrconsts.srkmecclearbookmarkforfile 21318msgid "Clear Bookmarks for current file" 21319msgstr "Geçerli dosya için Yer İşaretlerini Temizle" 21320 21321#: lazarusidestrconsts.srkmeccolseldown 21322msgid "Column Select Down" 21323msgstr "Sütun Seç Aşağı" 21324 21325#: lazarusidestrconsts.srkmeccolseleditorbottom 21326msgid "Column Select to absolute end" 21327msgstr "Sütun Mutlak sonuna seç" 21328 21329#: lazarusidestrconsts.srkmeccolseleditortop 21330msgid "Column Select to absolute beginning" 21331msgstr "Sütun Kesin başlangıçta seç" 21332 21333#: lazarusidestrconsts.srkmeccolselleft 21334msgid "Column Select Left" 21335msgstr "Sütun Seçimi Sola" 21336 21337#: lazarusidestrconsts.srkmeccolsellineend 21338msgid "Column Select Line End" 21339msgstr "Sütun Seçimi Satır Sonu" 21340 21341#: lazarusidestrconsts.srkmeccolsellinestart 21342msgid "Column Select Line Start" 21343msgstr "Sütun Seçimi Çizgi Başlat" 21344 21345#: lazarusidestrconsts.srkmeccolsellinetextstart 21346msgid "Column Select to text start in line" 21347msgstr "Satır başında metne sütun seç" 21348 21349#: lazarusidestrconsts.srkmeccolselpagebottom 21350msgid "Column Select Page Bottom" 21351msgstr "Sütun Seç Sayfa Alt" 21352 21353#: lazarusidestrconsts.srkmeccolselpagedown 21354msgid "Column Select Page Down" 21355msgstr "Sütun Sayfa Aşağı Seç" 21356 21357#: lazarusidestrconsts.srkmeccolselpagetop 21358msgid "Column Select Page Top" 21359msgstr "Sütun Seç Sayfa Üstü" 21360 21361#: lazarusidestrconsts.srkmeccolselpageup 21362msgid "Column Select Page Up" 21363msgstr "Sütun Sayfa Yukarı Seç" 21364 21365#: lazarusidestrconsts.srkmeccolselright 21366msgid "Column Select Right" 21367msgstr "Sütun Sağ Seç" 21368 21369#: lazarusidestrconsts.srkmeccolselup 21370msgid "Column Select Up" 21371msgstr "Sütun Yukarı Seç" 21372 21373#: lazarusidestrconsts.srkmeccolselwordleft 21374msgid "Column Select Word Left" 21375msgstr "Sütun Sol Kelimeyi Seçin" 21376 21377#: lazarusidestrconsts.srkmeccolselwordright 21378msgid "Column Select Word Right" 21379msgstr "Sütun Sağ Kelimeyi Seçin" 21380 21381#: lazarusidestrconsts.srkmeccolumnselect 21382msgid "Column selection mode" 21383msgstr "Sütun seçimi modu" 21384 21385#: lazarusidestrconsts.srkmeccompile 21386msgid "compile program/project" 21387msgstr "program/proje derle" 21388 21389#: lazarusidestrconsts.srkmecconfigbuildfile 21390msgid "config build file" 21391msgstr "yapılandırma dosyası oluştur" 21392 21393#: lazarusidestrconsts.srkmeccopy 21394msgctxt "lazarusidestrconsts.srkmeccopy" 21395msgid "Copy" 21396msgstr "Kopyala" 21397 21398#: lazarusidestrconsts.srkmeccopyadd 21399msgid "Copy (Add to Clipboard)" 21400msgstr "Kopyala (panoya kopyala)" 21401 21402#: lazarusidestrconsts.srkmeccopyaddcurrentline 21403msgid "Copy current line (Add to Clipboard)" 21404msgstr "Şimdiki satırı kopyala (panoya kopyala)" 21405 21406#: lazarusidestrconsts.srkmeccopycurrentline 21407msgid "Copy current line" 21408msgstr "Şimdiki satırı kopyala" 21409 21410#: lazarusidestrconsts.srkmeccopyeditornewwindow 21411msgid "Copy editor to new window" 21412msgstr "Editörü yeni pencereye kopyala" 21413 21414#: lazarusidestrconsts.srkmeccopyeditornextwindow 21415msgid "Copy editor to next free window" 21416msgstr "Düzenleyiciyi sonraki boş pencereye kopyala" 21417 21418#: lazarusidestrconsts.srkmeccopyeditorprevwindow 21419msgid "Copy editor to prior free window" 21420msgstr "Düzenleyiciyi önceki boş pencereye kopyala" 21421 21422#: lazarusidestrconsts.srkmeccut 21423msgctxt "lazarusidestrconsts.srkmeccut" 21424msgid "Cut" 21425msgstr "Kes" 21426 21427#: lazarusidestrconsts.srkmeccutadd 21428msgid "Cut (Add to Clipboard)" 21429msgstr "Kes (Panoya ekle)" 21430 21431#: lazarusidestrconsts.srkmeccutaddcurrentline 21432msgid "Cut current line (Add to Clipboard)" 21433msgstr "Şimdiki satırı kes (panoya kopyala)" 21434 21435#: lazarusidestrconsts.srkmeccutcurrentline 21436msgid "Cut current line" 21437msgstr "Şimdiki satırı kes" 21438 21439#: lazarusidestrconsts.srkmecdeletebol 21440msgid "Delete to beginning of line" 21441msgstr "Satırın başına kadar sil" 21442 21443#: lazarusidestrconsts.srkmecdeletechar 21444msgid "Delete char at cursor" 21445msgstr "İmleçteki karakteri sil" 21446 21447#: lazarusidestrconsts.srkmecdeleteeol 21448msgid "Delete to end of line" 21449msgstr "Satırın sonuna kadar sil" 21450 21451#: lazarusidestrconsts.srkmecdeletelastchar 21452msgid "Delete Last Char" 21453msgstr "Son Karakteri Sil" 21454 21455#: lazarusidestrconsts.srkmecdeletelastword 21456msgid "Delete to start of word" 21457msgstr "Sözcüğün başlangıcına sil" 21458 21459#: lazarusidestrconsts.srkmecdeleteline 21460msgid "Delete current line" 21461msgstr "Geçerli satırı sil" 21462 21463#: lazarusidestrconsts.srkmecdeleteword 21464msgid "Delete to end of word" 21465msgstr "Sözcüğün sonuna kadar sil" 21466 21467#: lazarusidestrconsts.srkmecdetach 21468msgid "Detach from program" 21469msgstr "Programdan kopma" 21470 21471#: lazarusidestrconsts.srkmecdiff 21472msgid "Diff" 21473msgstr "Diff" 21474 21475#: lazarusidestrconsts.srkmecdown 21476msgid "Move cursor down" 21477msgstr "İmleci aşağıya taşı" 21478 21479#: lazarusidestrconsts.srkmecduplicateline 21480msgid "Duplicate line (or lines in selection)" 21481msgstr "Yinelenen satır (veya seçimdeki satırlar)" 21482 21483#: lazarusidestrconsts.srkmecduplicateselection 21484msgid "Duplicate selection" 21485msgstr "Seçimi çoğalt" 21486 21487#: lazarusidestrconsts.srkmeceditorbottom 21488msgid "Move cursor to absolute end" 21489msgstr "İmleci mutlak sonuna getir" 21490 21491#: lazarusidestrconsts.srkmeceditortop 21492msgid "Move cursor to absolute beginning" 21493msgstr "İmleci mutlak başlangıca getir" 21494 21495#: lazarusidestrconsts.srkmecemptymethods 21496msgid "Empty Methods ..." 21497msgstr "Boş Yöntemler ..." 21498 21499#: lazarusidestrconsts.srkmecenvironmentoptions 21500msgid "IDE options" 21501msgstr "IDE seçenekleri" 21502 21503#: lazarusidestrconsts.srkmecevaluate 21504msgid "evaluate/modify" 21505msgstr "değiştir/ değerlendir" 21506 21507#: lazarusidestrconsts.srkmecextractproc 21508msgctxt "lazarusidestrconsts.srkmecextractproc" 21509msgid "Extract Procedure" 21510msgstr "Prosedürü çıkart" 21511 21512#: lazarusidestrconsts.srkmecexttool 21513#, object-pascal-format 21514msgid "External tool %d" 21515msgstr "Dış araç %d" 21516 21517#: lazarusidestrconsts.srkmecexttoolsettings 21518msgid "External tools settings" 21519msgstr "Harici araçlar ayarları" 21520 21521#: lazarusidestrconsts.srkmecfind 21522msgid "Find Text" 21523msgstr "Metni Bul" 21524 21525#: lazarusidestrconsts.srkmecfindblockotherend 21526msgid "Find block other end" 21527msgstr "Blok diğer ucunu bul" 21528 21529#: lazarusidestrconsts.srkmecfindblockstart 21530msgid "Find block start" 21531msgstr "Blok başlangıcını bul" 21532 21533#: lazarusidestrconsts.srkmecfinddeclaration 21534msgid "Find Declaration" 21535msgstr "Bildirimi Bul" 21536 21537#: lazarusidestrconsts.srkmecfindidentifierrefs 21538msgid "Find Identifier References" 21539msgstr "Tanımlayıcı Referanslarını Bul" 21540 21541#: lazarusidestrconsts.srkmecfindinfiles 21542msgid "Find in Files" 21543msgstr "Dosyalarda Bul" 21544 21545#: lazarusidestrconsts.srkmecfindnext 21546msgid "Find Next" 21547msgstr "Sonrakini Bul" 21548 21549#: lazarusidestrconsts.srkmecfindnextwordoccurrence 21550msgid "Find Next Word Occurrence" 21551msgstr "Sonraki kelime oluşumunu bul" 21552 21553#: lazarusidestrconsts.srkmecfindoverloads 21554msgid "Find Overloads" 21555msgstr "Aşırı yük bul" 21556 21557#: lazarusidestrconsts.srkmecfindoverloadscapt 21558msgid "Find Overloads ..." 21559msgstr "Aşırı Yük Bulun ..." 21560 21561#: lazarusidestrconsts.srkmecfindprevious 21562msgid "Find Previous" 21563msgstr "Önceki Bul" 21564 21565#: lazarusidestrconsts.srkmecfindprevwordoccurrence 21566msgid "Find Previous Word Occurrence" 21567msgstr "Önceki kelime oluşumunu bul" 21568 21569#: lazarusidestrconsts.srkmecfindproceduredefinition 21570msgid "Find Procedure Definiton" 21571msgstr "Prosedür Tanımını Bul" 21572 21573#: lazarusidestrconsts.srkmecfindproceduremethod 21574msgid "Find Procedure Method" 21575msgstr "Prosedür Yöntemi Bul" 21576 21577#: lazarusidestrconsts.srkmecfoldcurrent 21578msgid "Fold at Cursor" 21579msgstr "İmlece Katla" 21580 21581#: lazarusidestrconsts.srkmecfoldlevel 21582#, object-pascal-format 21583msgid "Fold to Level %d" 21584msgstr "Katlama seviyesi %d" 21585 21586#: lazarusidestrconsts.srkmecgotoeditor 21587#, object-pascal-format 21588msgid "Go to editor %d" 21589msgstr "Editöre git %d" 21590 21591#: lazarusidestrconsts.srkmecgotoincludedirective 21592msgid "Go to include directive of current include file" 21593msgstr "Geçerli dosya dahil etme direktifini eklemek için gidin" 21594 21595#: lazarusidestrconsts.srkmecgotolinenumber 21596msgid "Go to Line Number" 21597msgstr "Satır Numarasına Git" 21598 21599#: lazarusidestrconsts.srkmecgotomarker 21600#, object-pascal-format 21601msgid "Go to bookmark %d" 21602msgstr "İşaretleyiciye git %d" 21603 21604#: lazarusidestrconsts.srkmecgotoxy 21605msgid "Goto XY" 21606msgstr "XY ye git" 21607 21608#: lazarusidestrconsts.srkmecguessmisplacedifdef 21609msgid "Guess Misplaced $IFDEF" 21610msgstr "Sanırım Yanlış Yerleştirilmiş $IFDEF" 21611 21612#: lazarusidestrconsts.srkmechalfwordleft 21613msgid "Move cursor part-word left (e.g. CamelCase)" 21614msgstr "İmleci kısmi-sola hareket ettir (örneğin CamelCase)" 21615 21616#: lazarusidestrconsts.srkmechalfwordright 21617msgid "Move cursor part-word right (e.g. CamelCase)" 21618msgstr "İmleci kısmi-sağa hareket ettir (örneğin CamelCase)" 21619 21620#: lazarusidestrconsts.srkmecimestr 21621msgid "Ime Str" 21622msgstr "Ime Str" 21623 21624#: lazarusidestrconsts.srkmecinsertchangelogentry 21625msgid "Insert ChangeLog entry" 21626msgstr "ChangeLog girişini ekle" 21627 21628#: lazarusidestrconsts.srkmecinsertcharacter 21629msgid "Insert from Charactermap" 21630msgstr "Karakter Haritasından Ekle" 21631 21632#: lazarusidestrconsts.srkmecinsertcvsauthor 21633msgid "Insert CVS keyword Author" 21634msgstr "CVS anahtar kelime Yazarını Ekle" 21635 21636#: lazarusidestrconsts.srkmecinsertcvsdate 21637msgid "Insert CVS keyword Date" 21638msgstr "CVS anahtar kelimesini tarih ekle" 21639 21640#: lazarusidestrconsts.srkmecinsertcvsheader 21641msgid "Insert CVS keyword Header" 21642msgstr "CVS anahtar kelime Üstbilgisini Ekle" 21643 21644#: lazarusidestrconsts.srkmecinsertcvsid 21645msgid "Insert CVS keyword ID" 21646msgstr "CVS anahtar kelime kimliğini ekle" 21647 21648#: lazarusidestrconsts.srkmecinsertcvslog 21649msgid "Insert CVS keyword Log" 21650msgstr "CVS anahtar kelime Günlüğü ekle" 21651 21652#: lazarusidestrconsts.srkmecinsertcvsname 21653msgid "Insert CVS keyword Name" 21654msgstr "CVS anahtar kelime Adını ekle" 21655 21656#: lazarusidestrconsts.srkmecinsertcvsrevision 21657msgid "Insert CVS keyword Revision" 21658msgstr "CVS anahtar kelime Revizyon ekle" 21659 21660#: lazarusidestrconsts.srkmecinsertcvssource 21661msgid "Insert CVS keyword Source" 21662msgstr "CVS anahtar kelime Kaynağı Ekle" 21663 21664#: lazarusidestrconsts.srkmecinsertdatetime 21665msgid "Insert current date and time" 21666msgstr "Geçerli tarih ve saati ekle" 21667 21668#: lazarusidestrconsts.srkmecinsertfilename 21669msgid "Insert Full Filename" 21670msgstr "Tam Dosya Adı Girin" 21671 21672#: lazarusidestrconsts.srkmecinsertgplnotice 21673msgid "Insert GPL notice" 21674msgstr "GPL bildirimini ekle" 21675 21676#: lazarusidestrconsts.srkmecinsertgplnoticetranslated 21677msgid "Insert GPL notice (translated)" 21678msgstr "GPL bildirimini ekle (çevrilmiş)" 21679 21680#: lazarusidestrconsts.srkmecinsertguid 21681msgid "Insert a GUID" 21682msgstr "Bir GUID ekle" 21683 21684#: lazarusidestrconsts.srkmecinsertlgplnotice 21685msgid "Insert LGPL notice" 21686msgstr "LGPL bildirimini ekleyin" 21687 21688#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated 21689msgid "Insert LGPL notice (translated)" 21690msgstr "LGPL bildirimini ekleyin (tercüme edildi)" 21691 21692#: lazarusidestrconsts.srkmecinsertline 21693msgid "Break line, leave cursor" 21694msgstr "Satır sonu, imleci bırak" 21695 21696#: lazarusidestrconsts.srkmecinsertmitnotice 21697msgid "Insert MIT notice" 21698msgstr "MIT bildirimi ekle" 21699 21700#: lazarusidestrconsts.srkmecinsertmitnoticetranslated 21701msgid "Insert MIT notice (translated)" 21702msgstr "MIT bildirimi ekle (çevrilmiş)" 21703 21704#: lazarusidestrconsts.srkmecinsertmode 21705msgid "Insert Mode" 21706msgstr "Mod ekle" 21707 21708#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice 21709msgid "Insert modified LGPL notice" 21710msgstr "Değiştirilmiş LGPL bildirimini ekle" 21711 21712#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated 21713msgid "Insert modified LGPL notice (translated)" 21714msgstr "Değiştirilmiş LGPL bildirimini ekle (çevrilmiş)" 21715 21716#: lazarusidestrconsts.srkmecinsertusername 21717msgid "Insert current username" 21718msgstr "Mevcut kullanıcı adını ekle" 21719 21720#: lazarusidestrconsts.srkmecinspect 21721msgid "inspect" 21722msgstr "denetle" 21723 21724#: lazarusidestrconsts.srkmecinvertassignment 21725msgctxt "lazarusidestrconsts.srkmecinvertassignment" 21726msgid "Invert Assignment" 21727msgstr "Atamayı Ters Çevir" 21728 21729#: lazarusidestrconsts.srkmeckeymapleft 21730msgctxt "lazarusidestrconsts.srkmeckeymapleft" 21731msgid "Left" 21732msgstr "Sol" 21733 21734#: lazarusidestrconsts.srkmeckeymapright 21735msgctxt "lazarusidestrconsts.srkmeckeymapright" 21736msgid "Right" 21737msgstr "Sağ" 21738 21739#: lazarusidestrconsts.srkmecleft 21740msgid "Move cursor left" 21741msgstr "İmleci sola taşı" 21742 21743#: lazarusidestrconsts.srkmeclinebreak 21744msgid "Break line and move cursor" 21745msgstr "Satır sonu ve imleci hareket ettir" 21746 21747#: lazarusidestrconsts.srkmeclineend 21748msgid "Move cursor to line end" 21749msgstr "İmleci satır sonuna taşı" 21750 21751#: lazarusidestrconsts.srkmeclineselect 21752msgid "Line selection mode" 21753msgstr "Hat seçme modu" 21754 21755#: lazarusidestrconsts.srkmeclinestart 21756msgid "Move cursor to line start" 21757msgstr "İmleci satır başlangıcına taşı" 21758 21759#: lazarusidestrconsts.srkmeclinetextstart 21760msgid "Move cursor to text start in line" 21761msgstr "İmleci, satırdaki metnin başlangıcına taşı" 21762 21763#: lazarusidestrconsts.srkmeclockeditor 21764msgid "Lock Editor" 21765msgstr "Editörü Kilitle" 21766 21767#: lazarusidestrconsts.srkmecmakeresourcestring 21768msgid "Make Resource String" 21769msgstr "Kaynak Stringi Oluşturun" 21770 21771#: lazarusidestrconsts.srkmecmatchbracket 21772msgid "Go to matching bracket" 21773msgstr "Eşleşen ayraça git" 21774 21775#: lazarusidestrconsts.srkmecmoveeditorleft 21776msgid "Move editor left" 21777msgstr "Editörü sola taşı" 21778 21779#: lazarusidestrconsts.srkmecmoveeditorleftmost 21780msgid "Move editor leftmost" 21781msgstr "Editörü en sola kaydır" 21782 21783#: lazarusidestrconsts.srkmecmoveeditornewwindow 21784msgid "Move editor to new window" 21785msgstr "Editörü yeni pencereye taşı" 21786 21787#: lazarusidestrconsts.srkmecmoveeditornextwindow 21788msgid "Move editor to next free window" 21789msgstr "Editörü bir sonraki boş pencereye taşı" 21790 21791#: lazarusidestrconsts.srkmecmoveeditorprevwindow 21792msgid "Move editor to prior free window" 21793msgstr "Editörü önce boş pencereye taşı" 21794 21795#: lazarusidestrconsts.srkmecmoveeditorright 21796msgid "Move editor right" 21797msgstr "Editörü sağa taşı" 21798 21799#: lazarusidestrconsts.srkmecmoveeditorrightmost 21800msgid "Move editor rightmost" 21801msgstr "Editörün en sağına git" 21802 21803#: lazarusidestrconsts.srkmecmovelinedown 21804msgid "Move line down" 21805msgstr "Satırı aşağı taşı" 21806 21807#: lazarusidestrconsts.srkmecmovelineup 21808msgid "Move line up" 21809msgstr "Satırı yukarı taşı" 21810 21811#: lazarusidestrconsts.srkmecmoveselectdown 21812msgid "Move selection down" 21813msgstr "Seçileni aşağı taşı" 21814 21815#: lazarusidestrconsts.srkmecmoveselectleft 21816msgid "Move selection left" 21817msgstr "Seçileni sola taşı" 21818 21819#: lazarusidestrconsts.srkmecmoveselectright 21820msgid "Move selection right" 21821msgstr "Seçileni sağa taşı" 21822 21823#: lazarusidestrconsts.srkmecmoveselectup 21824msgid "Move selection up" 21825msgstr "Seçileni yukarı taşı" 21826 21827#: lazarusidestrconsts.srkmecmultipaste 21828msgctxt "lazarusidestrconsts.srkmecmultipaste" 21829msgid "MultiPaste" 21830msgstr "Çoklu Yapıştır" 21831 21832#: lazarusidestrconsts.srkmecnextbookmark 21833msgid "Next Bookmark" 21834msgstr "Sonraki Yer İşareti" 21835 21836#: lazarusidestrconsts.srkmecnexteditor 21837msgid "Go to next editor" 21838msgstr "Sonraki editöre git" 21839 21840#: lazarusidestrconsts.srkmecnexteditorinhistory 21841msgid "Go to next editor in history" 21842msgstr "Geçmişteki bir sonraki editöre geç" 21843 21844#: lazarusidestrconsts.srkmecnextsharededitor 21845msgid "Go to next editor with same Source" 21846msgstr "Aynı Kaynakta Sonraki Düzenleyiciye Git" 21847 21848#: lazarusidestrconsts.srkmecnextwindow 21849msgid "Go to next window" 21850msgstr "Bir sonraki pencereye git" 21851 21852#: lazarusidestrconsts.srkmecnormalselect 21853msgid "Normal selection mode" 21854msgstr "Normal seçim modu" 21855 21856#: lazarusidestrconsts.srkmecopenfileatcursor 21857msgid "Open File at Cursor" 21858msgstr "İmleçte Dosyayı Aç" 21859 21860#: lazarusidestrconsts.srkmecoverwritemode 21861msgid "Overwrite Mode" 21862msgstr "Üzerine Yazma Modu" 21863 21864#: lazarusidestrconsts.srkmecpagebottom 21865msgid "Move cursor to bottom of page" 21866msgstr "İmleci sayfanın altına getir" 21867 21868#: lazarusidestrconsts.srkmecpagedown 21869msgid "Move cursor down one page" 21870msgstr "İmleci bir sayfa aşağıya taşı" 21871 21872#: lazarusidestrconsts.srkmecpageleft 21873msgid "Move cursor left one page" 21874msgstr "İmleci bir sayfa sola taşı" 21875 21876#: lazarusidestrconsts.srkmecpageright 21877msgid "Move cursor right one page" 21878msgstr "İmleci bir sayfa sağa taşı" 21879 21880#: lazarusidestrconsts.srkmecpagetop 21881msgid "Move cursor to top of page" 21882msgstr "İmleci sayfanın üstüne getir" 21883 21884#: lazarusidestrconsts.srkmecpageup 21885msgid "Move cursor up one page" 21886msgstr "İmleci bir sayfa yukarı taşı" 21887 21888#: lazarusidestrconsts.srkmecpaste 21889msgctxt "lazarusidestrconsts.srkmecpaste" 21890msgid "Paste" 21891msgstr "Yapıştır" 21892 21893#: lazarusidestrconsts.srkmecpasteascolumns 21894msgid "Paste (as Columns)" 21895msgstr "" 21896 21897#: lazarusidestrconsts.srkmecpause 21898msgid "pause program" 21899msgstr "programı duraklat" 21900 21901#: lazarusidestrconsts.srkmecpluginmulticaretclearall 21902msgid "Clear all extra carets" 21903msgstr "Tüm ekstra şapka işaretini temizle" 21904 21905#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove 21906msgid "Cursor keys clear all extra carets" 21907msgstr "İmleç tuşlarını tüm ekstra şapka işaretinden temizle" 21908 21909#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall 21910msgid "Cursor keys move all extra carets" 21911msgstr "İmleç tuşlarını tüm ekstra şapka işaretine taşır" 21912 21913#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret 21914msgid "Add extra caret" 21915msgstr "Ekstra şapka işareti ekle" 21916 21917#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret 21918msgid "Toggle extra caret" 21919msgstr "Ekstra şapka işareti arasında geçiş yap" 21920 21921#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret 21922msgid "Remove extra caret" 21923msgstr "Ekstra şapka işaretini kaldır" 21924 21925#: lazarusidestrconsts.srkmecprevbookmark 21926msgid "Previous Bookmark" 21927msgstr "Önceki Yer İşareti" 21928 21929#: lazarusidestrconsts.srkmecpreveditor 21930msgid "Go to prior editor" 21931msgstr "Önceki düzenleyiciye git" 21932 21933#: lazarusidestrconsts.srkmecpreveditorinhistory 21934msgid "Go to previous editor in history" 21935msgstr "Geçmişte önceki editöre git" 21936 21937#: lazarusidestrconsts.srkmecprevsharededitor 21938msgid "Go to prior editor with same Source" 21939msgstr "Aynı Kaynaktan Önceki Düzenleyiciye Git" 21940 21941#: lazarusidestrconsts.srkmecprevwindow 21942msgid "Go to prior window" 21943msgstr "Önceki pencereye git" 21944 21945#: lazarusidestrconsts.srkmecquickcompile 21946msgid "quick compile, no linking" 21947msgstr "hızlı derle, bağlantı yok" 21948 21949#: lazarusidestrconsts.srkmecremovebreakpoint 21950msgid "remove breakpoint" 21951msgstr "kesme noktasını kaldır" 21952 21953#: lazarusidestrconsts.srkmecremoveemptymethods 21954msgid "Remove Empty Methods" 21955msgstr "Boş Yöntemleri Kaldır" 21956 21957#: lazarusidestrconsts.srkmecremoveunusedunits 21958msgid "Remove Unused Units" 21959msgstr "Kullanılmayan Birimleri Kaldır" 21960 21961#: lazarusidestrconsts.srkmecrenameidentifier 21962msgid "Rename Identifier" 21963msgstr "Tanımlayıcıyı Yeniden Adlandır" 21964 21965#: lazarusidestrconsts.srkmecreplace 21966msgid "Replace Text" 21967msgstr "Metni Değiştir" 21968 21969#: lazarusidestrconsts.srkmecreportingbug 21970msgid "Reporting a bug" 21971msgstr "Bir hatayı bildir" 21972 21973#: lazarusidestrconsts.srkmecresetdebugger 21974msgid "reset debugger" 21975msgstr "hata ayıklayıcıyı sıfırlayın" 21976 21977#: lazarusidestrconsts.srkmecright 21978msgid "Move cursor right" 21979msgstr "İmleci sağa taşı" 21980 21981#: lazarusidestrconsts.srkmecrun 21982msgid "run program" 21983msgstr "programı çalıştır" 21984 21985#: lazarusidestrconsts.srkmecrunfile 21986msgid "run file" 21987msgstr "dosya çalıştır" 21988 21989#: lazarusidestrconsts.srkmecrunparameters 21990msgid "run parameters" 21991msgstr "parametreleri çalıştır" 21992 21993#: lazarusidestrconsts.srkmecrunwithoutdebugging 21994msgid "run without debugging" 21995msgstr "hata ayıklamasız çalıştır" 21996 21997#: lazarusidestrconsts.srkmecscrolldown 21998msgid "Scroll down one line" 21999msgstr "Bir satır aşağı kaydır" 22000 22001#: lazarusidestrconsts.srkmecscrollleft 22002msgid "Scroll left one char" 22003msgstr "Sola kaydır" 22004 22005#: lazarusidestrconsts.srkmecscrollright 22006msgid "Scroll right one char" 22007msgstr "Sağa kaydır" 22008 22009#: lazarusidestrconsts.srkmecscrollup 22010msgid "Scroll up one line" 22011msgstr "Bir satır yukarı kaydır" 22012 22013#: lazarusidestrconsts.srkmecseldown 22014msgid "Select Down" 22015msgstr "Aşağı Seç" 22016 22017#: lazarusidestrconsts.srkmecselectall 22018msgctxt "lazarusidestrconsts.srkmecselectall" 22019msgid "Select All" 22020msgstr "Hepsini seç" 22021 22022#: lazarusidestrconsts.srkmecselectiontabs2spaces 22023msgid "Convert tabs to spaces in selection" 22024msgstr "Sekmeleri seçimde boşluklara dönüştür" 22025 22026#: lazarusidestrconsts.srkmecseleditorbottom 22027msgid "Select to absolute end" 22028msgstr "Mutlak son için seç" 22029 22030#: lazarusidestrconsts.srkmecseleditortop 22031msgid "Select to absolute beginning" 22032msgstr "Mutlak başlangıç için seç" 22033 22034#: lazarusidestrconsts.srkmecselgotoxy 22035msgid "Select Goto XY" 22036msgstr "Seçiliye git XY" 22037 22038#: lazarusidestrconsts.srkmecselhalfwordleft 22039msgid "Select part-word left (e.g. CamelCase)" 22040msgstr "Parça sözcüğü soldan seçin (örneğin CamelCase)" 22041 22042#: lazarusidestrconsts.srkmecselhalfwordright 22043msgid "Select part-word right (e.g. CamelCase)" 22044msgstr "Parça sözcüğü sağdan seçin (örneğin CamelCase)" 22045 22046#: lazarusidestrconsts.srkmecselleft 22047msgid "Select Left" 22048msgstr "Sol Seç" 22049 22050#: lazarusidestrconsts.srkmecsellineend 22051msgctxt "lazarusidestrconsts.srkmecsellineend" 22052msgid "Select Line End" 22053msgstr "Satır Sonunu Seç" 22054 22055#: lazarusidestrconsts.srkmecsellinestart 22056msgctxt "lazarusidestrconsts.srkmecsellinestart" 22057msgid "Select Line Start" 22058msgstr "Satır Başını Seç" 22059 22060#: lazarusidestrconsts.srkmecsellinetextstart 22061msgid "Select to text start in line" 22062msgstr "Satırda metne başlamak için seçin" 22063 22064#: lazarusidestrconsts.srkmecselpagebottom 22065msgctxt "lazarusidestrconsts.srkmecselpagebottom" 22066msgid "Select Page Bottom" 22067msgstr "Sayfa Altını Seç" 22068 22069#: lazarusidestrconsts.srkmecselpagedown 22070msgid "Select Page Down" 22071msgstr "Sayfa Sonu Seç" 22072 22073#: lazarusidestrconsts.srkmecselpageleft 22074msgid "Select Page Left" 22075msgstr "Sayfa Solunu Seç" 22076 22077#: lazarusidestrconsts.srkmecselpageright 22078msgid "Select Page Right" 22079msgstr "Sayfayı Sağını Seç" 22080 22081#: lazarusidestrconsts.srkmecselpagetop 22082msgctxt "lazarusidestrconsts.srkmecselpagetop" 22083msgid "Select Page Top" 22084msgstr "Sayfa Üstünü Seç" 22085 22086#: lazarusidestrconsts.srkmecselpageup 22087msgid "Select Page Up" 22088msgstr "Sayfa Başı Seç" 22089 22090#: lazarusidestrconsts.srkmecselright 22091msgid "Select Right" 22092msgstr "Sağ Seç" 22093 22094#: lazarusidestrconsts.srkmecselsmartwordleft 22095msgid "Smart select word left (start/end of word)" 22096msgstr "Akıllı kelime seç sol (kelimenin başlangıcı / bitişi)" 22097 22098#: lazarusidestrconsts.srkmecselsmartwordright 22099msgid "Smart select word right (start/end of word)" 22100msgstr "Akıllı kelime seç sağ (kelimenin başlangıcı / bitişi)" 22101 22102#: lazarusidestrconsts.srkmecselsticky 22103msgid "Start sticky selecting" 22104msgstr "Yapışkan seçimi başlat" 22105 22106#: lazarusidestrconsts.srkmecselstickycol 22107msgid "Start sticky selecting (Columns)" 22108msgstr "Yapışkan seçimi başlat (Sütunlar)" 22109 22110#: lazarusidestrconsts.srkmecselstickyline 22111msgid "Start sticky selecting (Line)" 22112msgstr "Yapışkan seçimi başlat (Hat)" 22113 22114#: lazarusidestrconsts.srkmecselstickystop 22115msgid "Stop sticky selecting" 22116msgstr "Yapışkan seçimi durdur" 22117 22118#: lazarusidestrconsts.srkmecselup 22119msgid "Select Up" 22120msgstr "Yukarı Seç" 22121 22122#: lazarusidestrconsts.srkmecselwordendleft 22123msgid "Select word-end left" 22124msgstr "Sözcük sonu solu seç" 22125 22126#: lazarusidestrconsts.srkmecselwordendright 22127msgid "Select word-end right" 22128msgstr "Sözcük sonu sağı seç" 22129 22130#: lazarusidestrconsts.srkmecselwordleft 22131msgctxt "lazarusidestrconsts.srkmecselwordleft" 22132msgid "Select Word Left" 22133msgstr "Soldan Sözcük Seçin" 22134 22135#: lazarusidestrconsts.srkmecselwordright 22136msgctxt "lazarusidestrconsts.srkmecselwordright" 22137msgid "Select Word Right" 22138msgstr "Sağdan Sözcük Seçin" 22139 22140#: lazarusidestrconsts.srkmecsetfreebookmark 22141msgid "Set a free Bookmark" 22142msgstr "Serbest bir Yer İşareti ayarla" 22143 22144#: lazarusidestrconsts.srkmecsetmarker 22145#, object-pascal-format 22146msgid "Set bookmark %d" 22147msgstr "İşaretçi %d 'yi ayarla" 22148 22149#: lazarusidestrconsts.srkmecshifttab 22150msgid "Shift Tab" 22151msgstr "Shift Sekmesi" 22152 22153#: lazarusidestrconsts.srkmecshowabstractmethods 22154msgid "Show Abstract Methods" 22155msgstr "Soyut Metotları Göster" 22156 22157#: lazarusidestrconsts.srkmecshowcodecontext 22158msgid "Show Code Context" 22159msgstr "Kod Bağlamını Göster" 22160 22161#: lazarusidestrconsts.srkmecshowexecutionpoint 22162msgid "show execution point" 22163msgstr "yürütme noktasını göster" 22164 22165#: lazarusidestrconsts.srkmecsmartwordleft 22166msgid "Smart move cursor left (start/end of word)" 22167msgstr "Akıllı hareket imleci sola (kelimenin başlangıcı / bitişi)" 22168 22169#: lazarusidestrconsts.srkmecsmartwordright 22170msgid "Smart move cursor right (start/end of word)" 22171msgstr "Akıllı imleci sağa hareket ettirin (kelimenin başlangıcı / bitişi)" 22172 22173#: lazarusidestrconsts.srkmecstopprogram 22174msgid "stop program" 22175msgstr "programı durdur" 22176 22177#: lazarusidestrconsts.srkmecsynmacroplay 22178msgid "Play Macro" 22179msgstr "Makro Oynat" 22180 22181#: lazarusidestrconsts.srkmecsynmacrorecord 22182msgid "Record Macro" 22183msgstr "Makro Kaydet" 22184 22185#: lazarusidestrconsts.srkmecsynpsyncroedcellend 22186msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" 22187msgid "Goto last pos in cell" 22188msgstr "Hücrenin son konumuna git" 22189 22190#: lazarusidestrconsts.srkmecsynpsyncroedcellhome 22191msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" 22192msgid "Goto first pos in cell" 22193msgstr "Hücrenin ilk konumuna git" 22194 22195#: lazarusidestrconsts.srkmecsynpsyncroedcellselect 22196msgid "Select Cell" 22197msgstr "Hücreyi seçin" 22198 22199#: lazarusidestrconsts.srkmecsynpsyncroedescape 22200msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" 22201msgid "Escape" 22202msgstr "Kaçış" 22203 22204#: lazarusidestrconsts.srkmecsynpsyncroednextcell 22205msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" 22206msgid "Next Cell" 22207msgstr "Bir Sonraki Hücre" 22208 22209#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel 22210msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" 22211msgid "Next Cell (all selected)" 22212msgstr "Sonraki Hücre (tüm seçilenler)" 22213 22214#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell 22215msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell" 22216msgid "Next Cell (firsts only)" 22217msgstr "Sonraki Hücre (yalnızca ilkler)" 22218 22219#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel 22220msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel" 22221msgid "Next Cell (all selected / firsts only)" 22222msgstr "Sonraki Hücre (tüm seçilenler / yalnızca ilkler)" 22223 22224#: lazarusidestrconsts.srkmecsynpsyncroedprevcell 22225msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" 22226msgid "Previous Cell" 22227msgstr "Önceki Hücre" 22228 22229#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel 22230msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" 22231msgid "Previous Cell (all selected)" 22232msgstr "Önceki Hücre (tüm seçilenler)" 22233 22234#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell 22235msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell" 22236msgid "Previous Cell (firsts only)" 22237msgstr "Önceki Hücre (yalnızca ilkler)" 22238 22239#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel 22240msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel" 22241msgid "Previous Cell (all selected / firsts only)" 22242msgstr "Önceki Hücre (tüm seçilenler / sadece ilkler)" 22243 22244#: lazarusidestrconsts.srkmecsynpsyncroedstart 22245msgid "Start Syncro edit" 22246msgstr "Syncro düzenlenmeye başla" 22247 22248#: lazarusidestrconsts.srkmecsynptmpledcellend 22249msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" 22250msgid "Goto last pos in cell" 22251msgstr "Hücrenin son konumuna git" 22252 22253#: lazarusidestrconsts.srkmecsynptmpledcellhome 22254msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" 22255msgid "Goto first pos in cell" 22256msgstr "Hücrenin ilk konumuna git" 22257 22258#: lazarusidestrconsts.srkmecsynptmpledcellselect 22259msgid "Select cell" 22260msgstr "Hücreyi seçin" 22261 22262#: lazarusidestrconsts.srkmecsynptmpledescape 22263msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" 22264msgid "Escape" 22265msgstr "Kaçış" 22266 22267#: lazarusidestrconsts.srkmecsynptmpledfinish 22268msgid "Finish" 22269msgstr "Bitiş" 22270 22271#: lazarusidestrconsts.srkmecsynptmplednextcell 22272msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" 22273msgid "Next Cell" 22274msgstr "Bir Sonraki Hücre" 22275 22276#: lazarusidestrconsts.srkmecsynptmplednextcellrotate 22277msgid "Next Cell (rotate)" 22278msgstr "Sonraki Hücre (döndür)" 22279 22280#: lazarusidestrconsts.srkmecsynptmplednextcellsel 22281msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" 22282msgid "Next Cell (all selected)" 22283msgstr "Sonraki Hücre (tüm seçilenler)" 22284 22285#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate 22286msgid "Next Cell (rotate / all selected)" 22287msgstr "Sonraki Hücre (döndür / tüm seçilenler)" 22288 22289#: lazarusidestrconsts.srkmecsynptmplednextfirstcell 22290msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell" 22291msgid "Next Cell (firsts only)" 22292msgstr "Sonraki Hücre (yalnızca ilkler)" 22293 22294#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate 22295msgid "Next Cell (rotate / firsts only)" 22296msgstr "Sonraki Hücre (yalnızca ilk önce döndür / döndür)" 22297 22298#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel 22299msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel" 22300msgid "Next Cell (all selected / firsts only)" 22301msgstr "Sonraki Hücre (tüm seçilenler / yalnızca ilkler)" 22302 22303#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate 22304msgid "Next Cell (rotate / all selected / firsts only)" 22305msgstr "Sonraki Hücre (döndür / tüm seçilenler / sadece ilkler)" 22306 22307#: lazarusidestrconsts.srkmecsynptmpledprevcell 22308msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" 22309msgid "Previous Cell" 22310msgstr "Önceki Hücre" 22311 22312#: lazarusidestrconsts.srkmecsynptmpledprevcellsel 22313msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" 22314msgid "Previous Cell (all selected)" 22315msgstr "Önceki Hücre (tüm seçilenler)" 22316 22317#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell 22318msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell" 22319msgid "Previous Cell (firsts only)" 22320msgstr "Önceki Hücre (yalnızca ilkler)" 22321 22322#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel 22323msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel" 22324msgid "Previous Cell (all selected / firsts only)" 22325msgstr "Önceki Hücre (tüm seçilenler / sadece ilkler)" 22326 22327#: lazarusidestrconsts.srkmecsyntaxcheck 22328msgid "Syntax Check" 22329msgstr "Sözdizimi Kontrolü" 22330 22331#: lazarusidestrconsts.srkmectoggleassembler 22332msgid "View assembler" 22333msgstr "Montajcıyı görüntüle" 22334 22335#: lazarusidestrconsts.srkmectogglebreakpoint 22336msgid "toggle breakpoint" 22337msgstr "kesme noktası değiştir" 22338 22339#: lazarusidestrconsts.srkmectogglebreakpointenabled 22340msgid "enable/disable breakpoint" 22341msgstr "kesme noktasını etkinleştir/pasifleştir" 22342 22343#: lazarusidestrconsts.srkmectogglebreakpoints 22344msgid "View breakpoints" 22345msgstr "Kesme noktalarını görüntüle" 22346 22347#: lazarusidestrconsts.srkmectogglecallstack 22348msgid "View call stack" 22349msgstr "Çağrı yığınını görüntüle" 22350 22351#: lazarusidestrconsts.srkmectogglecodebrowser 22352msgid "View code browser" 22353msgstr "Kod tarayıcıyı görüntüle" 22354 22355#: lazarusidestrconsts.srkmectogglecodeexpl 22356msgid "View Code Explorer" 22357msgstr "Kod Gezgini'ni görüntüle" 22358 22359#: lazarusidestrconsts.srkmectogglecomppalette 22360msgid "View component palette" 22361msgstr "Bileşen paletini görüntüle" 22362 22363#: lazarusidestrconsts.srkmectoggledebuggerout 22364msgid "View debugger output" 22365msgstr "Hata ayıklayıcı çıktısını görüntüle" 22366 22367#: lazarusidestrconsts.srkmectoggleformunit 22368msgid "Switch between form and unit" 22369msgstr "Form ve birim arasında geçiş" 22370 22371#: lazarusidestrconsts.srkmectogglefpdoceditor 22372msgid "View Documentation Editor" 22373msgstr "Belge Düzenleyiciyi Görüntüle" 22374 22375#: lazarusidestrconsts.srkmectoggleidespeedbtns 22376msgid "View IDE speed buttons" 22377msgstr "IDE hızlı düğmelerini görüntüle" 22378 22379#: lazarusidestrconsts.srkmectogglelocals 22380msgid "View local variables" 22381msgstr "Yerel değişkenleri görüntüle" 22382 22383#: lazarusidestrconsts.srkmectogglemarker 22384#, object-pascal-format 22385msgid "Toggle bookmark %d" 22386msgstr "İşaretçi %d 'yi değiştir" 22387 22388#: lazarusidestrconsts.srkmectogglemarkupword 22389msgid "Toggle Current-Word highlight" 22390msgstr "Geçerli Kelime vurgusunu değiştir" 22391 22392#: lazarusidestrconsts.srkmectogglemessages 22393msgid "View messages" 22394msgstr "Mesajları görüntüle" 22395 22396#: lazarusidestrconsts.srkmectogglemode 22397msgid "Toggle Mode" 22398msgstr "Geçiş Modu" 22399 22400#: lazarusidestrconsts.srkmectoggleobjectinsp 22401msgid "View Object Inspector" 22402msgstr "Nesne Gösterimi Müfettişini Görüntüle" 22403 22404#: lazarusidestrconsts.srkmectoggleregisters 22405msgid "View registers" 22406msgstr "Kayıtları görüntüle" 22407 22408#: lazarusidestrconsts.srkmectogglerestrictionbrowser 22409msgid "View restriction browser" 22410msgstr "Görüntüleme kısıtlama tarayıcısı" 22411 22412#: lazarusidestrconsts.srkmectogglesearchresults 22413msgid "View Search Results" 22414msgstr "Arama Sonuçlarını Görüntüle" 22415 22416#: lazarusidestrconsts.srkmectogglesourceeditor 22417msgid "View Source Editor" 22418msgstr "Kaynak Düzenleyiciyi Görüntüle" 22419 22420#: lazarusidestrconsts.srkmectogglewatches 22421msgid "View watches" 22422msgstr "Saatleri görüntüle" 22423 22424#: lazarusidestrconsts.srkmecunfoldall 22425msgctxt "lazarusidestrconsts.srkmecunfoldall" 22426msgid "Unfold all" 22427msgstr "Hepsini aç" 22428 22429#: lazarusidestrconsts.srkmecunfoldcurrent 22430msgid "Unfold at Cursor" 22431msgstr "İmleçte Aç" 22432 22433#: lazarusidestrconsts.srkmecunknown 22434msgid "unknown editor command" 22435msgstr "bilinmeyen editör komutu" 22436 22437#: lazarusidestrconsts.srkmecunusedunits 22438msgid "Unused Units ..." 22439msgstr "Kullanılmayan Birimler ..." 22440 22441#: lazarusidestrconsts.srkmecup 22442msgid "Move cursor up" 22443msgstr "İmleci yukarı taşı" 22444 22445#: lazarusidestrconsts.srkmecviewanchoreditor 22446msgid "View anchor editor" 22447msgstr "Çapa editörünü görüntüle" 22448 22449#: lazarusidestrconsts.srkmecviewcomponents 22450msgid "View components" 22451msgstr "Bileşenleri görüntüleme" 22452 22453#: lazarusidestrconsts.srkmecvieweditormacros 22454msgid "View editor macros" 22455msgstr "Editör makrolarını görüntüle" 22456 22457#: lazarusidestrconsts.srkmecviewforms 22458msgid "View forms" 22459msgstr "Formları görüntüle" 22460 22461#: lazarusidestrconsts.srkmecviewhistory 22462msgctxt "lazarusidestrconsts.srkmecviewhistory" 22463msgid "View History" 22464msgstr "Geçmişi Görüntüle" 22465 22466#: lazarusidestrconsts.srkmecviewpseudoterminal 22467msgid "View console in/output" 22468msgstr "Terminal Çıkışını Görüntüle" 22469 22470#: lazarusidestrconsts.srkmecviewtaborder 22471msgid "View Tab Order" 22472msgstr "Görünüm Sekmesi Sırası" 22473 22474#: lazarusidestrconsts.srkmecviewthreads 22475msgctxt "lazarusidestrconsts.srkmecviewthreads" 22476msgid "View Threads" 22477msgstr "Konuları Görüntüle" 22478 22479#: lazarusidestrconsts.srkmecviewunitdependencies 22480msgid "View unit dependencies" 22481msgstr "Birim bağımlılıklarını görüntüle" 22482 22483#: lazarusidestrconsts.srkmecviewunitinfo 22484msgid "View unit information" 22485msgstr "Birim bilgilerini görüntüle" 22486 22487#: lazarusidestrconsts.srkmecviewunits 22488msgid "View units" 22489msgstr "Birimleri görüntüle" 22490 22491#: lazarusidestrconsts.srkmecwordcompletion 22492msgid "Word Completion" 22493msgstr "Kelime Tamamlama" 22494 22495#: lazarusidestrconsts.srkmecwordendleft 22496msgid "Move cursor word-end left" 22497msgstr "İmleç kelimesi-bitiş sola taşı" 22498 22499#: lazarusidestrconsts.srkmecwordendright 22500msgid "Move cursor word-end right" 22501msgstr "İmleç kelime sonunu sağa taşı" 22502 22503#: lazarusidestrconsts.srkmecwordleft 22504msgid "Move cursor word left" 22505msgstr "İmleç kelimesini sola taşı" 22506 22507#: lazarusidestrconsts.srkmecwordright 22508msgid "Move cursor word right" 22509msgstr "İmleci sağa taşır" 22510 22511#: lazarusidestrconsts.srkmeczoomin 22512msgid "Zoom in" 22513msgstr "Yakınlaştır" 22514 22515#: lazarusidestrconsts.srkmeczoomout 22516msgid "Zoom out" 22517msgstr "Uzaklaştır" 22518 22519#: lazarusidestrconsts.srkmeditforcmd 22520msgid "Edit keys of command" 22521msgstr "Komut tuşlarını düzenle" 22522 22523#: lazarusidestrconsts.synfcontinuewithnextmouseupaction 22524msgid "Continue with next mouse up action" 22525msgstr "Bir sonraki fare yukarı hareketle devam et" 22526 22527#: lazarusidestrconsts.synffoldcomments 22528msgid "Fold comments" 22529msgstr "Yorumları katla" 22530 22531#: lazarusidestrconsts.synffoldcommentsinselection 22532msgid "Fold comments in selection" 22533msgstr "Seçimdeki yorumları katla" 22534 22535#: lazarusidestrconsts.synffoldinactiveifdef 22536msgid "Fold inactive Ifdef" 22537msgstr "Pasif Ifdef katla" 22538 22539#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate 22540msgid "Fold inactive Ifdef (exclude mixed state)" 22541msgstr "Pasif Ifdef'i katla(karma durumu hariç)" 22542 22543#: lazarusidestrconsts.synffoldinactiveifdefinselection 22544msgid "Fold inactive Ifdef in selection" 22545msgstr "Seçilen pasif ifdef'i katla" 22546 22547#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate 22548msgid "Fold inactive Ifdef in selection (exclude mixed state)" 22549msgstr "Seçilen pasif ifdef'i katla (karma durum hariç)" 22550 22551#: lazarusidestrconsts.synfhidecomments 22552msgid "Hide comments" 22553msgstr "Yorumları gizle" 22554 22555#: lazarusidestrconsts.synfhidecommentsinselection 22556msgid "Hide comments in selection" 22557msgstr "Seçilen yorumları gizle" 22558 22559#: lazarusidestrconsts.synfmatchactionbuttonofmousedown 22560msgid "Match action button of mouse down" 22561msgstr "Fareyle eşleşen eylem düğmesi aşağı" 22562 22563#: lazarusidestrconsts.synfmatchactionlineofmousedown 22564msgid "Match action line of mouse down" 22565msgstr "Fare hareket çizgisini aşağıya ile eşleştir" 22566 22567#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown 22568msgid "Match action modifiers of mouse down" 22569msgstr "Fareyle aşağı hareket eylemi değiştiricileri" 22570 22571#: lazarusidestrconsts.synfmatchactionposofmousedown 22572msgid "Match action pos of mouse down" 22573msgstr "Farenin hareket pos'unu aşağıya ile eşleştir" 22574 22575#: lazarusidestrconsts.synfsearchallactionofmousedown 22576msgid "Search all action of mouse down" 22577msgstr "Farenin tüm hareketlerini aşağıya doğru ara" 22578 22579#: lazarusidestrconsts.synfunfoldactiveifdef 22580msgid "Unfold active Ifdef" 22581msgstr "Etkin Ifdef'i aç" 22582 22583#: lazarusidestrconsts.synfunfoldactiveifdefinselection 22584msgid "Unfold active Ifdef in selection" 22585msgstr "Seçilen aktif Ifdef'i aç" 22586 22587#: lazarusidestrconsts.synfunfoldall 22588msgctxt "lazarusidestrconsts.synfunfoldall" 22589msgid "Unfold all" 22590msgstr "Hepsini aç" 22591 22592#: lazarusidestrconsts.synfunfoldallifdef 22593msgid "Unfold all Ifdef" 22594msgstr "Tüm Ifdef'leri aç" 22595 22596#: lazarusidestrconsts.synfunfoldallifdefinselection 22597msgid "Unfold all Ifdef in selection" 22598msgstr "Seçilen tüm Ifdef'i aç" 22599 22600#: lazarusidestrconsts.synfunfoldallinselection 22601msgid "Unfold all in selection" 22602msgstr "Seçilenin tümünü aç" 22603 22604#: lazarusidestrconsts.synfunfoldcomments 22605msgid "Unfold comments" 22606msgstr "Yorumları açın" 22607 22608#: lazarusidestrconsts.synfunfoldcommentsinselection 22609msgid "Unfold comments in selection" 22610msgstr "Seçilen yorumları aç" 22611 22612#: lazarusidestrconsts.synfunfoldinactiveifdef 22613msgid "Unfold inactive Ifdef" 22614msgstr "Pasif Ifdef'i aç" 22615 22616#: lazarusidestrconsts.synfunfoldinactiveifdefinselection 22617msgid "Unfold inactive Ifdef in selection" 22618msgstr "Seçilen pasif ifdef' i aç" 22619 22620#: lazarusidestrconsts.uefilerocap 22621msgid "File is readonly" 22622msgstr "Dosya salt okunur" 22623 22624#: lazarusidestrconsts.uefilerotext1 22625msgid "The file \"" 22626msgstr "Dosya \"" 22627 22628#: lazarusidestrconsts.uefilerotext2 22629msgid "\" is not writable." 22630msgstr "\" yazılabilir değil." 22631 22632#: lazarusidestrconsts.uelocked 22633msgid "Locked" 22634msgstr "Kilitli" 22635 22636#: lazarusidestrconsts.uemacrorecording 22637msgid "Recording" 22638msgstr "Kayıt" 22639 22640#: lazarusidestrconsts.uemacrorecordingpaused 22641msgid "Rec-pause" 22642msgstr "Kayıt-duraklat" 22643 22644#: lazarusidestrconsts.uemaddwatchatcursor 22645msgid "Add &Watch At Cursor" 22646msgstr "İmleç Ekleme ve İzleme" 22647 22648#: lazarusidestrconsts.uemaddwatchpointatcursor 22649msgid "Add Watch&Point At Cursor" 22650msgstr "İmleçte İzle ve Nokta Ekle" 22651 22652#: lazarusidestrconsts.uembookmarknset 22653#, object-pascal-format 22654msgid "Bookmark &%s: %s" 22655msgstr "Yer imi &%s: %s" 22656 22657#: lazarusidestrconsts.uembookmarknunset 22658#, object-pascal-format 22659msgid "Bookmark &%s" 22660msgstr "Yer imi &%s" 22661 22662#: lazarusidestrconsts.uembookmarknunsetdisabled 22663#, object-pascal-format 22664msgid "Bookmark %s" 22665msgstr "Yer imi %s" 22666 22667#: lazarusidestrconsts.uemcloseotherpages 22668msgid "Close All &Other Pages" 22669msgstr "&Diğer tüm sayfaları kapat" 22670 22671#: lazarusidestrconsts.uemcloseotherpagesplain 22672msgid "Close All Other Pages" 22673msgstr "Tüm D&iğer Sayfaları Kapat" 22674 22675#: lazarusidestrconsts.uemcloseotherpagesright 22676msgid "Close Pages on the &Right" 22677msgstr "&Sağdaki sayfaları kapat" 22678 22679#: lazarusidestrconsts.uemcloseotherpagesrightplain 22680msgid "Close Pages on the Right" 22681msgstr "Sağdaki sayfaları kapat" 22682 22683#: lazarusidestrconsts.uemclosepage 22684msgid "&Close Page" 22685msgstr "&Sayfayı kapat" 22686 22687#: lazarusidestrconsts.uemcopyfilename 22688msgid "Copy Filename" 22689msgstr "Dosya Adını Kopyala" 22690 22691#: lazarusidestrconsts.uemcopytonewwindow 22692msgid "Clone to New Window" 22693msgstr "Yeni Pencereye Klon" 22694 22695#: lazarusidestrconsts.uemcopytootherwindow 22696msgid "Clone to Other Window" 22697msgstr "Diğer Pencereye Klon Yap" 22698 22699#: lazarusidestrconsts.uemcopytootherwindownew 22700msgctxt "lazarusidestrconsts.uemcopytootherwindownew" 22701msgid "New Window" 22702msgstr "Yeni Pencere" 22703 22704#: lazarusidestrconsts.uemdebugword 22705msgctxt "lazarusidestrconsts.uemdebugword" 22706msgid "Debug" 22707msgstr "Hata ayıklama" 22708 22709#: lazarusidestrconsts.uemencoding 22710msgid "Encoding" 22711msgstr "Kodlama" 22712 22713#: lazarusidestrconsts.uemevaluatemodify 22714msgid "&Evaluate/Modify ..." 22715msgstr "&Değerlendir/Değiştir ..." 22716 22717#: lazarusidestrconsts.uemfinddeclaration 22718msgid "&Find Declaration" 22719msgstr "&Deklarasyon Bul" 22720 22721#: lazarusidestrconsts.uemfindinotherwindow 22722msgid "Find in other Window" 22723msgstr "Diğer Pencerede Bul" 22724 22725#: lazarusidestrconsts.uemgotobookmark 22726msgid "&Goto Bookmark" 22727msgstr "& Yer İmine Git" 22728 22729#: lazarusidestrconsts.uemgotobookmarks 22730msgid "Goto Bookmark ..." 22731msgstr "&Yer İmine Git." 22732 22733#: lazarusidestrconsts.uemhighlighter 22734msgid "Highlighter" 22735msgstr "İşaretleyici" 22736 22737#: lazarusidestrconsts.ueminspect 22738msgctxt "lazarusidestrconsts.ueminspect" 22739msgid "&Inspect ..." 22740msgstr "&Denetle..." 22741 22742#: lazarusidestrconsts.ueminvertassignment 22743msgctxt "lazarusidestrconsts.ueminvertassignment" 22744msgid "Invert Assignment" 22745msgstr "Atamayı Ters Çevir" 22746 22747#: lazarusidestrconsts.uemlineending 22748msgid "Line Ending" 22749msgstr "Satır Sona Erme" 22750 22751#: lazarusidestrconsts.uemlockpage 22752msgid "&Lock Page" 22753msgstr "&Sayfayı kilitle" 22754 22755#: lazarusidestrconsts.uemmovepageleft 22756msgid "Move Page Left" 22757msgstr "Sayfa Sola Taşı" 22758 22759#: lazarusidestrconsts.uemmovepageleftmost 22760msgid "Move Page Leftmost" 22761msgstr "Sayfa En Sola Taşı" 22762 22763#: lazarusidestrconsts.uemmovepageright 22764msgid "Move Page Right" 22765msgstr "Sayfayı Doğru Taşı" 22766 22767#: lazarusidestrconsts.uemmovepagerightmost 22768msgid "Move Page Rightmost" 22769msgstr "Sayfanın En Yakına Taşın" 22770 22771#: lazarusidestrconsts.uemmovetonewwindow 22772msgid "Move to New Window" 22773msgstr "Yeni Pencereye Taşı" 22774 22775#: lazarusidestrconsts.uemmovetootherwindow 22776msgid "Move to Other Window" 22777msgstr "Diğer Pencereye Taşı" 22778 22779#: lazarusidestrconsts.uemmovetootherwindownew 22780msgctxt "lazarusidestrconsts.uemmovetootherwindownew" 22781msgid "New Window" 22782msgstr "Yeni Pencere" 22783 22784#: lazarusidestrconsts.uemnextbookmark 22785msgid "Goto Next Bookmark" 22786msgstr "Sonraki Yer imine git" 22787 22788#: lazarusidestrconsts.uemodified 22789msgid "Modified" 22790msgstr "Değiştirilmiş" 22791 22792#: lazarusidestrconsts.uemopenfileatcursor 22793msgid "&Open File at Cursor" 22794msgstr "&İmleç Dosyasını Aç" 22795 22796#: lazarusidestrconsts.uemprevbookmark 22797msgid "Goto Previous Bookmark" 22798msgstr "Önceki Sık Kullanılana Git" 22799 22800#: lazarusidestrconsts.uemprocedurejump 22801msgid "Procedure Jump" 22802msgstr "Prosedür Atlama" 22803 22804#: lazarusidestrconsts.uemreadonly 22805msgctxt "lazarusidestrconsts.uemreadonly" 22806msgid "Read Only" 22807msgstr "Salt okunur" 22808 22809#: lazarusidestrconsts.uemrefactor 22810msgid "Refactoring" 22811msgstr "Yeniden düzenleme" 22812 22813#: lazarusidestrconsts.uemsetfreebookmark 22814msgctxt "lazarusidestrconsts.uemsetfreebookmark" 22815msgid "Set a Free Bookmark" 22816msgstr "Serbest Yer İşareti Oluşturun" 22817 22818#: lazarusidestrconsts.uemshowlinenumbers 22819msgid "Show Line Numbers" 22820msgstr "Satır Numaralarını Göster" 22821 22822#: lazarusidestrconsts.uemsource 22823msgctxt "lazarusidestrconsts.uemsource" 22824msgid "Source" 22825msgstr "Kaynak" 22826 22827#: lazarusidestrconsts.uemtogglebookmark 22828msgid "&Toggle Bookmark" 22829msgstr "&Yer imini değiştir" 22830 22831#: lazarusidestrconsts.uemtogglebookmarknset 22832#, object-pascal-format 22833msgid "Toggle Bookmark &%s: %s" 22834msgstr "Yer imini değiştir &%s: %s" 22835 22836#: lazarusidestrconsts.uemtogglebookmarknunset 22837#, object-pascal-format 22838msgid "Toggle Bookmark &%s" 22839msgstr "Yer imini değiştir &%s" 22840 22841#: lazarusidestrconsts.uemtogglebookmarks 22842msgid "Toggle Bookmark ..." 22843msgstr "Yer imini değiştir." 22844 22845#: lazarusidestrconsts.uemtogglebreakpoint 22846msgid "Toggle &Breakpoint" 22847msgstr "Kesme &noktası değiştir" 22848 22849#: lazarusidestrconsts.uemviewcallstack 22850msgctxt "lazarusidestrconsts.uemviewcallstack" 22851msgid "View Call Stack" 22852msgstr "Çağrı Yığını Göster" 22853 22854#: lazarusidestrconsts.uenotimplcap 22855msgid "Not implemented yet" 22856msgstr "Henüz uygulanmadı" 22857 22858#: lazarusidestrconsts.uepins 22859msgid "INS" 22860msgstr "INS" 22861 22862#: lazarusidestrconsts.uepovr 22863msgid "OVR" 22864msgstr "OVR" 22865 22866#: lazarusidestrconsts.uepreadonly 22867msgid "Readonly" 22868msgstr "Salt Okunur" 22869 22870#: lazarusidestrconsts.unitdepoptionsforpackage 22871msgid "Options for Package graph" 22872msgstr "Paket grafiği için seçenekleri" 22873 22874#: lazarusidestrconsts.unitdepoptionsforunit 22875msgid "Options for Unit graph" 22876msgstr "Birim grafiği için seçenekleri" 22877 22878#: lazarusidestrconsts.versioninfotitle 22879msgid "Version Info" 22880msgstr "Versiyon bilgisi" 22881 22882