1msgid "" 2msgstr "" 3"Project-Id-Version: \n" 4"POT-Creation-Date: \n" 5"PO-Revision-Date: 2006-11-03 19:03+0100\n" 6"Last-Translator: J.Salvador Pérez <salvaperez@escomposlinux.org>\n" 7"Language-Team: \n" 8"MIME-Version: 1.0\n" 9"Content-Type: text/plain; charset=utf-8\n" 10"Content-Transfer-Encoding: 8bit\n" 11 12#: lazarusidestrconsts.dbgbreakgroupdlgcaption 13msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption" 14msgid "Select Groups" 15msgstr "" 16 17#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable 18msgid "Select groups to disable when breakpoint is hit" 19msgstr "" 20 21#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable 22msgid "Select groups to enable when breakpoint is hit" 23msgstr "" 24 25#: lazarusidestrconsts.dbgbreakpropertygroupnotfound 26#, object-pascal-format 27msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s" 28msgstr "" 29 30#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint 31#, object-pascal-format 32msgid "Address Breakpoint %s" 33msgstr "" 34 35#: lazarusidestrconsts.dbgeventbreakataddress 36#, object-pascal-format 37msgid "at $%s" 38msgstr "" 39 40#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline 41#, object-pascal-format 42msgid "at $%s: from origin %s line %d" 43msgstr "" 44 45#: lazarusidestrconsts.dbgeventbreakataddresssourceline 46#, object-pascal-format 47msgid "at $%s: %s line %d" 48msgstr "" 49 50#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint 51#, object-pascal-format 52msgid "Source Breakpoint %s" 53msgstr "" 54 55#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint 56#, object-pascal-format 57msgid "Unknown Breakpoint %s" 58msgstr "" 59 60#: lazarusidestrconsts.dbgeventbreakwatchpoint 61#, object-pascal-format 62msgid "Watchpoint %s" 63msgstr "" 64 65#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended 66#, object-pascal-format 67msgid "Unknown Watchpoint out of scope %s" 68msgstr "" 69 70#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered 71#, object-pascal-format 72msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\"" 73msgstr "" 74 75#: lazarusidestrconsts.dbgeventwatchscopeended 76#, object-pascal-format 77msgid "Watchpoint for \"%s\" out of scope %s" 78msgstr "" 79 80#: lazarusidestrconsts.dbgeventwatchtriggered 81#, object-pascal-format 82msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\"" 83msgstr "" 84 85#: lazarusidestrconsts.dlfmousepredefinedscheme 86msgid "Use predefined scheme" 87msgstr "" 88 89#: lazarusidestrconsts.dlfmouseresetall 90msgid "Reset all settings" 91msgstr "" 92 93#: lazarusidestrconsts.dlfmouseresetgutter 94msgid "Reset all gutter settings" 95msgstr "" 96 97#: lazarusidestrconsts.dlfmouseresettext 98msgid "Reset all text settings" 99msgstr "" 100 101#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint 102msgid "Add history point" 103msgstr "" 104 105#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu 106msgid "Context Menu" 107msgstr "" 108 109#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg 110msgid "Context Menu (debug)" 111msgstr "" 112 113#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab 114msgid "Context Menu (tab)" 115msgstr "" 116 117#: lazarusidestrconsts.dlfmousesimplebuttondeclaration 118msgid "Jumps to implementation" 119msgstr "" 120 121#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock 122msgid "Jumps to implementation/other block end" 123msgstr "" 124 125#: lazarusidestrconsts.dlfmousesimplebuttonhistback 126msgid "History back" 127msgstr "" 128 129#: lazarusidestrconsts.dlfmousesimplebuttonhistforw 130msgid "History forward" 131msgstr "" 132 133#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle 134msgid "Toggle extra Caret" 135msgstr "" 136 137#: lazarusidestrconsts.dlfmousesimplebuttonnothing 138msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing" 139msgid "Nothing/Default" 140msgstr "" 141 142#: lazarusidestrconsts.dlfmousesimplebuttonpaste 143msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste" 144msgid "Paste" 145msgstr "Enganxa" 146 147#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue 148#, object-pascal-format 149msgid "Continue %0:s (Bound to: %1:s)" 150msgstr "" 151 152#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain 153#, object-pascal-format 154msgid "Continue %0:s" 155msgstr "" 156 157#: lazarusidestrconsts.dlfmousesimplebuttonselect 158msgid "Select text" 159msgstr "" 160 161#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline 162msgid "Select text (lines)" 163msgstr "" 164 165#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken 166msgid "Select text (tokens)" 167msgstr "" 168 169#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword 170msgid "Select text (words)" 171msgstr "" 172 173#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn 174msgid "Select text (Column mode)" 175msgstr "" 176 177#: lazarusidestrconsts.dlfmousesimplebuttonselectline 178msgid "Select text (Line mode)" 179msgstr "" 180 181#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark 182msgid "Set free bookmark" 183msgstr "" 184 185#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull 186msgid "Select current Line (Full)" 187msgstr "" 188 189#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart 190msgid "Select current Line (Text)" 191msgstr "" 192 193#: lazarusidestrconsts.dlfmousesimplebuttonsetpara 194msgid "Select current Paragraph" 195msgstr "" 196 197#: lazarusidestrconsts.dlfmousesimplebuttonsetword 198msgid "Select current Word" 199msgstr "" 200 201#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset 202msgid "Reset zoom" 203msgstr "" 204 205#: lazarusidestrconsts.dlfmousesimplediff 206msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" 207msgstr "" 208 209#: lazarusidestrconsts.dlfmousesimplegenericsect 210msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" 211msgid "General" 212msgstr "General" 213 214#: lazarusidestrconsts.dlfmousesimplegutterleftdown 215msgid "Standard, All actions (breakpoint, fold) on mouse down" 216msgstr "" 217 218#: lazarusidestrconsts.dlfmousesimplegutterleftup 219msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" 220msgstr "" 221 222#: lazarusidestrconsts.dlfmousesimplegutterleftupright 223msgid "Extended, Actions, right gutter half only" 224msgstr "" 225 226#: lazarusidestrconsts.dlfmousesimplegutterlines 227msgid "Use line numbers to select lines" 228msgstr "" 229 230#: lazarusidestrconsts.dlfmousesimpleguttersect 231msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" 232msgid "Gutter" 233msgstr "" 234 235#: lazarusidestrconsts.dlfmousesimplerightmovecaret 236msgid "Right button click includes caret move" 237msgstr "" 238 239#: lazarusidestrconsts.dlfmousesimpletextsect 240msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" 241msgid "Text" 242msgstr "Text" 243 244#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel 245msgid "Alt-Ctrl Button" 246msgstr "" 247 248#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel 249msgid "Alt-Ctrl Wheel" 250msgstr "" 251 252#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel 253msgid "Alt Button" 254msgstr "" 255 256#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel 257msgid "Alt Wheel" 258msgstr "" 259 260#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel 261msgid "Ctrl Button" 262msgstr "" 263 264#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel 265msgid "Ctrl Wheel" 266msgstr "" 267 268#: lazarusidestrconsts.dlfmousesimpletextsectdrag 269msgid "Drag selection (copy/paste)" 270msgstr "" 271 272#: lazarusidestrconsts.dlfmousesimpletextsectextra1label 273msgid "Extra-1 Button" 274msgstr "" 275 276#: lazarusidestrconsts.dlfmousesimpletextsectextra2label 277msgid "Extra-2 Button" 278msgstr "" 279 280#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel 281msgid "Alt Double" 282msgstr "" 283 284#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel 285msgid "Ctrl Double" 286msgstr "" 287 288#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel 289msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" 290msgid "Double" 291msgstr "" 292 293#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel 294msgid "Shift Double" 295msgstr "" 296 297#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel 298msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" 299msgid "Quad" 300msgstr "" 301 302#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel 303msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel" 304msgid "Triple" 305msgstr "" 306 307#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel 308msgid "Middle Button" 309msgstr "" 310 311#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn 312msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn" 313msgid "Middle" 314msgstr "" 315 316#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1 317msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1" 318msgid "Extra 1" 319msgstr "" 320 321#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2 322msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2" 323msgid "Extra 2" 324msgstr "" 325 326#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel 327msgid "Horizontal-Wheel" 328msgstr "" 329 330#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod 331msgid "Left 1" 332msgstr "" 333 334#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti 335msgid "Left 2" 336msgstr "" 337 338#: lazarusidestrconsts.dlfmousesimpletextsectpageright 339msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright" 340msgid "Right" 341msgstr "Dreta" 342 343#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel 344msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel" 345msgid "Wheel" 346msgstr "" 347 348#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel 349msgid "Right Button" 350msgstr "" 351 352#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel 353msgid "Shift-Alt-Ctrl Button" 354msgstr "" 355 356#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel 357msgid "Shift-Alt-Ctrl" 358msgstr "" 359 360#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel 361msgid "Shift-Alt Button" 362msgstr "" 363 364#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel 365msgid "Shift-Alt Wheel" 366msgstr "" 367 368#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel 369msgid "Shift-Ctrl Button" 370msgstr "" 371 372#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel 373msgid "Shift-Ctrl Wheel" 374msgstr "" 375 376#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel 377msgid "Shift Button" 378msgstr "" 379 380#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel 381msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel" 382msgid "Wheel" 383msgstr "" 384 385#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel 386msgid "Shift Wheel" 387msgstr "" 388 389#: lazarusidestrconsts.dlfmousesimplewarning 390msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" 391msgstr "" 392 393#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef 394msgid "Scroll horizontal (System speed)" 395msgstr "" 396 397#: lazarusidestrconsts.dlfmousesimplewheelhsrollline 398msgid "Scroll horizontal (Single line)" 399msgstr "" 400 401#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage 402msgid "Scroll horizontal (Page)" 403msgstr "" 404 405#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf 406msgid "Scroll horizontal (Half page)" 407msgstr "" 408 409#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless 410msgid "Scroll horizontal (Page, less one line)" 411msgstr "" 412 413#: lazarusidestrconsts.dlfmousesimplewheelnothing 414msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing" 415msgid "Nothing/Default" 416msgstr "" 417 418#: lazarusidestrconsts.dlfmousesimplewheelsrolldef 419msgid "Scroll (System speed)" 420msgstr "" 421 422#: lazarusidestrconsts.dlfmousesimplewheelsrollline 423msgid "Scroll (Single line)" 424msgstr "" 425 426#: lazarusidestrconsts.dlfmousesimplewheelsrollpage 427msgid "Scroll (Page)" 428msgstr "" 429 430#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf 431msgid "Scroll (Half page)" 432msgstr "" 433 434#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless 435msgid "Scroll (Page, less one line)" 436msgstr "" 437 438#: lazarusidestrconsts.dlfmousesimplewheelzoom 439msgid "Zoom" 440msgstr "" 441 442#: lazarusidestrconsts.dlfnopredefinedscheme 443msgid "< None >" 444msgstr "" 445 446#: lazarusidestrconsts.dlfreadonlycolor 447msgctxt "lazarusidestrconsts.dlfreadonlycolor" 448msgid "Read Only" 449msgstr "Només lectura" 450 451#: lazarusidestrconsts.dlg1up2low 452msgid "Lowercase, first letter up" 453msgstr "Minúscules, primera lletra Maj." 454 455#: lazarusidestrconsts.dlgactivedesktop 456msgid "active" 457msgstr "" 458 459#: lazarusidestrconsts.dlgaddassignmentoperator 460msgid "Add assignment operator :=" 461msgstr "" 462 463#: lazarusidestrconsts.dlgaddhiattrbracketmatch 464msgid "Brackets highlight" 465msgstr "" 466 467#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree 468msgid "Code folding tree" 469msgstr "" 470 471#: lazarusidestrconsts.dlgaddhiattrdefault 472msgid "Default Text" 473msgstr "" 474 475#: lazarusidestrconsts.dlgaddhiattrdefaultwindow 476msgid "Default Text / Window" 477msgstr "" 478 479#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint 480msgid "Disabled breakpoint" 481msgstr "" 482 483#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint 484msgid "Enabled breakpoint" 485msgstr "" 486 487#: lazarusidestrconsts.dlgaddhiattrerrorline 488msgid "Error line" 489msgstr "" 490 491#: lazarusidestrconsts.dlgaddhiattrexecutionpoint 492msgid "Execution point" 493msgstr "" 494 495#: lazarusidestrconsts.dlgaddhiattrfoldedcode 496msgid "Folded code marker" 497msgstr "" 498 499#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline 500msgid "Fold start-line" 501msgstr "" 502 503#: lazarusidestrconsts.dlgaddhiattrgroupdefault 504msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" 505msgid "Global" 506msgstr "" 507 508#: lazarusidestrconsts.dlgaddhiattrgroupgutter 509msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" 510msgid "Gutter" 511msgstr "" 512 513#: lazarusidestrconsts.dlgaddhiattrgroupifdef 514msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef" 515msgid "IfDef" 516msgstr "IfDef" 517 518#: lazarusidestrconsts.dlgaddhiattrgroupline 519msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" 520msgid "Line" 521msgstr "Línia" 522 523#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors 524msgid "Outline Colors" 525msgstr "" 526 527#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit 528msgid "Syncron Edit" 529msgstr "" 530 531#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit 532msgid "Template Edit" 533msgstr "" 534 535#: lazarusidestrconsts.dlgaddhiattrgrouptext 536msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" 537msgid "Text" 538msgstr "Text" 539 540#: lazarusidestrconsts.dlgaddhiattrgutterseparator 541msgid "Gutter Separator" 542msgstr "" 543 544#: lazarusidestrconsts.dlgaddhiattrhiddencodeline 545msgid "Hide start-line" 546msgstr "" 547 548#: lazarusidestrconsts.dlgaddhiattrhighlightall 549msgid "Incremental others" 550msgstr "" 551 552#: lazarusidestrconsts.dlgaddhiattrhighlightprefix 553msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix" 554msgid "Highlight prefix" 555msgstr "" 556 557#: lazarusidestrconsts.dlgaddhiattrhighlightword 558msgid "Highlight current word" 559msgstr "" 560 561#: lazarusidestrconsts.dlgaddhiattrincrementalsearch 562msgid "Incremental search" 563msgstr "" 564 565#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint 566msgid "Invalid breakpoint" 567msgstr "" 568 569#: lazarusidestrconsts.dlgaddhiattrlinehighlight 570msgid "Current line highlight" 571msgstr "" 572 573#: lazarusidestrconsts.dlgaddhiattrlinenumber 574msgid "Line number" 575msgstr "" 576 577#: lazarusidestrconsts.dlgaddhiattrmodifiedline 578msgid "Modified line" 579msgstr "" 580 581#: lazarusidestrconsts.dlgaddhiattrmouselink 582msgid "Mouse link" 583msgstr "" 584 585#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color 586msgid "Level 10" 587msgstr "" 588 589#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color 590msgid "Level 1" 591msgstr "" 592 593#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color 594msgid "Level 2" 595msgstr "" 596 597#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color 598msgid "Level 3" 599msgstr "" 600 601#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color 602msgid "Level 4" 603msgstr "" 604 605#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color 606msgid "Level 5" 607msgstr "" 608 609#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color 610msgid "Level 6" 611msgstr "" 612 613#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color 614msgid "Level 7" 615msgstr "" 616 617#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color 618msgid "Level 8" 619msgstr "" 620 621#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color 622msgid "Level 9" 623msgstr "" 624 625#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea 626msgid "Selected Area" 627msgstr "" 628 629#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur 630msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" 631msgid "Active Cell" 632msgstr "" 633 634#: lazarusidestrconsts.dlgaddhiattrsyncroeditother 635msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" 636msgid "Other Cells" 637msgstr "" 638 639#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync 640msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" 641msgid "Syncronized Cells" 642msgstr "" 643 644#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur 645msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" 646msgid "Active Cell" 647msgstr "" 648 649#: lazarusidestrconsts.dlgaddhiattrtemplateeditother 650msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" 651msgid "Other Cells" 652msgstr "" 653 654#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync 655msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" 656msgid "Syncronized Cells" 657msgstr "" 658 659#: lazarusidestrconsts.dlgaddhiattrtextblock 660msgid "Text block" 661msgstr "" 662 663#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint 664msgid "Unknown breakpoint" 665msgstr "" 666 667#: lazarusidestrconsts.dlgaddhiattrwindowborder 668msgid "Window border" 669msgstr "" 670 671#: lazarusidestrconsts.dlgaddhiattrwordgroup 672msgid "Word-Brackets" 673msgstr "" 674 675#: lazarusidestrconsts.dlgaddhispecialvisiblechars 676msgid "Visualized Special Chars" 677msgstr "" 678 679#: lazarusidestrconsts.dlgaddnewmode 680msgid "Add new mode" 681msgstr "" 682 683#: lazarusidestrconsts.dlgaddsemicolon 684msgid "Add semicolon" 685msgstr "Afegeix punt i coma" 686 687#: lazarusidestrconsts.dlgadjusttopline 688msgid "Adjust top line due to comment in front" 689msgstr "Ajusta la línia de sobre a causa del comentari de davant" 690 691#: lazarusidestrconsts.dlgalphabetically 692msgid "Alphabetically" 693msgstr "Alfabèticament" 694 695#: lazarusidestrconsts.dlgalwaysvisiblecursor 696msgid "Always keep caret in visible area of editor" 697msgstr "" 698 699#: lazarusidestrconsts.dlgambigfileact 700msgid "Ambiguous file action:" 701msgstr "" 702 703#: lazarusidestrconsts.dlgambigwarn 704msgid "Warn on compile" 705msgstr "Avisa al compilar" 706 707#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown 708msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case." 709msgstr "" 710 711#: lazarusidestrconsts.dlgansicommenttab 712msgid "Ansi (* *)" 713msgstr "" 714 715#: lazarusidestrconsts.dlgapplicationsettings 716#, fuzzy 717#| msgid "Application Settings" 718msgid "Application settings" 719msgstr "Paràmetres de l'aplicació" 720 721#: lazarusidestrconsts.dlgassertcode 722#, fuzzy 723#| msgid "Include Assertion Code" 724msgid "Include assertion code" 725msgstr "Inclou el codi afirmat" 726 727#: lazarusidestrconsts.dlgassociateddebugdesktop 728#, object-pascal-format 729msgid "Associated debug desktop for \"%s\"" 730msgstr "" 731 732#: lazarusidestrconsts.dlgassociateddebugdesktophint 733msgid "If you select the desktop, the associated debug desktop will be selected as well." 734msgstr "" 735 736#: lazarusidestrconsts.dlgautocreateforms 737msgid "Auto-create forms:" 738msgstr "Crea les formes automàticament" 739 740#: lazarusidestrconsts.dlgautocreateformshint 741msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically." 742msgstr "" 743 744#: lazarusidestrconsts.dlgautocreatenewforms 745#, fuzzy 746#| msgid "When creating new forms, add them to auto-created forms" 747msgid "Auto-create new forms" 748msgstr "Quan es creen noves formes, afegeix-les a les formes creades automàticament" 749 750#: lazarusidestrconsts.dlgautodel 751msgid "Auto delete file" 752msgstr "Elimina el fitxer automàticament" 753 754#: lazarusidestrconsts.dlgautodisplayfuncproto 755msgid "Auto Display Function Prototypes" 756msgstr "" 757 758#: lazarusidestrconsts.dlgautohidecursor 759msgid "Hide mouse pointer when typing" 760msgstr "" 761 762#: lazarusidestrconsts.dlgautoindent 763msgctxt "lazarusidestrconsts.dlgautoindent" 764msgid "Auto indent" 765msgstr "" 766 767#: lazarusidestrconsts.dlgautoindentlink 768msgid "(Set up smart indent)" 769msgstr "" 770 771#: lazarusidestrconsts.dlgautoindenttype 772msgctxt "lazarusidestrconsts.dlgautoindenttype" 773msgid "Auto indent" 774msgstr "" 775 776#: lazarusidestrconsts.dlgautoremoveemptymethods 777msgid "Auto remove empty methods" 778msgstr "" 779 780#: lazarusidestrconsts.dlgautoren 781msgid "Auto rename file lowercase" 782msgstr "Canvia el nom del fitxer a minúscules automàticament" 783 784#: lazarusidestrconsts.dlgautosaveactivedesktop 785msgid "Auto save active desktop" 786msgstr "" 787 788#: lazarusidestrconsts.dlgautosaveactivedesktophint 789msgid "" 790"Save active desktop on IDE close\n" 791"Save debug desktop on IDE close and debug end" 792msgstr "" 793 794#: lazarusidestrconsts.dlgavailableforms 795msgid "Available forms:" 796msgstr "Formes disponibles:" 797 798#: lazarusidestrconsts.dlgavailableformshint 799msgid "These forms must be created and freed in the program code." 800msgstr "" 801 802#: lazarusidestrconsts.dlgavoidunnecessaryjumps 803msgid "Avoid unnecessary jumps" 804msgstr "" 805 806#: lazarusidestrconsts.dlgbackcolor 807msgid "Background" 808msgstr "Rerefons" 809 810#: lazarusidestrconsts.dlgbaknosubdirectory 811msgid "(no subdirectory)" 812msgstr "(Cap subdirectori)" 813 814#: lazarusidestrconsts.dlgbckupsubdir 815msgid "Same name (in subdirectory)" 816msgstr "El mateix nom (a un subdirectori)" 817 818#: lazarusidestrconsts.dlgbehindmethods 819msgid "Behind methods" 820msgstr "Darrera dels mètodes" 821 822#: lazarusidestrconsts.dlgblockgroupoptions 823#, fuzzy 824msgctxt "lazarusidestrconsts.dlgblockgroupoptions" 825msgid "Selection" 826msgstr "Selecció" 827 828#: lazarusidestrconsts.dlgblockindent 829msgid "Block indent (spaces)" 830msgstr "" 831 832#: lazarusidestrconsts.dlgblockindentkeys 833msgid "Block indent" 834msgstr "" 835 836#: lazarusidestrconsts.dlgblockindentlink 837msgid "(edit keys)" 838msgstr "" 839 840#: lazarusidestrconsts.dlgblockindenttypecopy 841msgid "Space/tab as prev Line" 842msgstr "" 843 844#: lazarusidestrconsts.dlgblockindenttypepos 845msgid "Position only" 846msgstr "" 847 848#: lazarusidestrconsts.dlgblockindenttypespace 849msgid "Spaces" 850msgstr "" 851 852#: lazarusidestrconsts.dlgblockindenttypetabonly 853msgid "Tabs, cut off" 854msgstr "" 855 856#: lazarusidestrconsts.dlgblockindenttypetabspace 857msgid "Tabs, then spaces" 858msgstr "" 859 860#: lazarusidestrconsts.dlgblocktabindent 861msgid "Block indent (tabs)" 862msgstr "" 863 864#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor 865msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0." 866msgstr "" 867 868#: lazarusidestrconsts.dlgbrackethighlight 869msgid "Bracket highlight" 870msgstr "" 871 872#: lazarusidestrconsts.dlgbracketmatchgroup 873msgid "Matching bracket and quote pairs" 874msgstr "" 875 876#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop 877msgid "You cannot use docked desktop in undocked environment and vice versa." 878msgstr "" 879 880#: lazarusidestrconsts.dlgcaretbackcolor 881msgid "Multi/2nd (NotXor)" 882msgstr "" 883 884#: lazarusidestrconsts.dlgcaretcolor 885msgctxt "lazarusidestrconsts.dlgcaretcolor" 886msgid "Caret" 887msgstr "" 888 889#: lazarusidestrconsts.dlgcaretforecolor 890msgid "Color (NotXor)" 891msgstr "" 892 893#: lazarusidestrconsts.dlgcaretgroupoptions 894msgid "Caret (Text Cursor)" 895msgstr "" 896 897#: lazarusidestrconsts.dlgcasesensitive 898msgctxt "lazarusidestrconsts.dlgcasesensitive" 899msgid "&Case sensitive" 900msgstr "" 901 902#: lazarusidestrconsts.dlgccocaption 903msgid "Checking compiler options" 904msgstr "" 905 906#: lazarusidestrconsts.dlgccoorphanedfilefound 907#, object-pascal-format 908msgid "orphaned file found: %s" 909msgstr "" 910 911#: lazarusidestrconsts.dlgccoresults 912msgid "Results" 913msgstr "" 914 915#: lazarusidestrconsts.dlgccotest 916msgctxt "lazarusidestrconsts.dlgccotest" 917msgid "Test" 918msgstr "Prova" 919 920#: lazarusidestrconsts.dlgccotestcheckingcompiler 921msgid "Test: Checking compiler ..." 922msgstr "" 923 924#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig 925msgid "Test: Checking compiler configuration ..." 926msgstr "" 927 928#: lazarusidestrconsts.dlgccotestcompilerdate 929msgid "Test: Checking compiler date ..." 930msgstr "" 931 932#: lazarusidestrconsts.dlgccotestcompilingemptyfile 933msgid "Test: Compiling an empty file ..." 934msgstr "" 935 936#: lazarusidestrconsts.dlgccotestrtlunits 937msgid "Test: Checking RTL units ..." 938msgstr "" 939 940#: lazarusidestrconsts.dlgccotestsrcinppupaths 941msgid "Test: Checking sources in fpc ppu search paths ..." 942msgstr "" 943 944#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile 945msgid "Test: Compiling an empty file" 946msgstr "" 947 948#: lazarusidestrconsts.dlgccousingconfigfile 949#, object-pascal-format 950msgid "using config file %s" 951msgstr "" 952 953#: lazarusidestrconsts.dlgcdtclassorder 954msgid "Class order" 955msgstr "Ordre de la classe" 956 957#: lazarusidestrconsts.dlgcdtlast 958msgid "Last" 959msgstr "Últim" 960 961#: lazarusidestrconsts.dlgcdtlower 962msgid "lowercase" 963msgstr "minúscules" 964 965#: lazarusidestrconsts.dlgcdtpreview 966#, fuzzy 967#| msgid "Preview (Max line length = 1)" 968msgid "Preview (max line length = 1)" 969msgstr "Visualització prèvia (long. màx. línia = 1)" 970 971#: lazarusidestrconsts.dlgcdtreadprefix 972msgid "Read prefix" 973msgstr "Prefix de llegir" 974 975#: lazarusidestrconsts.dlgcdtstoredpostfix 976msgid "Stored postfix" 977msgstr "Postfix de desat" 978 979#: lazarusidestrconsts.dlgcdtuppercase 980msgid "UPPERCASE" 981msgstr "MAJÚSCULES" 982 983#: lazarusidestrconsts.dlgcdtvariableprefix 984msgid "Variable prefix" 985msgstr "Prefix de la variable" 986 987#: lazarusidestrconsts.dlgcdtwriteprefix 988msgid "Write prefix" 989msgstr "Prefix d'escriure" 990 991#: lazarusidestrconsts.dlgcharcasefileact 992#, fuzzy 993#| msgid "Save As - auto rename pascal files lower case" 994msgid "Save As - auto rename Pascal files lower case" 995msgstr "Anomena i desa - fica el nom dels fitxers Pascal en minúscules" 996 997#: lazarusidestrconsts.dlgcheckandautosavefiles 998msgid "Check and Auto Save Files" 999msgstr "" 1000 1001#: lazarusidestrconsts.dlgcheckpackagesonformcreate 1002msgid "Check packages on form create" 1003msgstr "" 1004 1005#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint 1006msgid "The form may require a package to work. Install such a package automatically." 1007msgstr "" 1008 1009#: lazarusidestrconsts.dlgchscodetempl 1010msgid "Choose code template file (*.dci)" 1011msgstr "Tria un fitxer de plantilla (*.dci)" 1012 1013#: lazarusidestrconsts.dlgclosebuttonsnotebook 1014msgid "Show close buttons in notebook" 1015msgstr "Mostra els botons de tancar en el llibre de notes" 1016 1017#: lazarusidestrconsts.dlgclrscheme 1018msgid "Color Scheme" 1019msgstr "Esquema de Color" 1020 1021#: lazarusidestrconsts.dlgcmacro 1022#, fuzzy 1023#| msgid "C Style Macros (global)" 1024msgid "C style macros (global)" 1025msgstr "Macroinstruccions estil C (global)" 1026 1027#: lazarusidestrconsts.dlgcoansistr 1028#, fuzzy 1029#| msgid "Use ansi strings" 1030msgctxt "lazarusidestrconsts.dlgcoansistr" 1031msgid "Use Ansistrings" 1032msgstr "Utilitza Ansi Strings" 1033 1034#: lazarusidestrconsts.dlgcoasmstyle 1035msgid "Assembler style" 1036msgstr "" 1037 1038#: lazarusidestrconsts.dlgcocfgcmpmessages 1039#, fuzzy 1040msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" 1041msgid "Messages" 1042msgstr "Missatges" 1043 1044#: lazarusidestrconsts.dlgcochecksandassertion 1045msgid "Checks and assertion" 1046msgstr "" 1047 1048#: lazarusidestrconsts.dlgcocompilercommands 1049msgid "Compiler Commands" 1050msgstr "" 1051 1052#: lazarusidestrconsts.dlgcocops 1053#, fuzzy 1054#| msgid "C Style Operators (*=, +=, /= and -=)" 1055msgid "C style operators (*=, +=, /= and -=)" 1056msgstr "Operadors estil C (*=, +=, /= i -=)" 1057 1058#: lazarusidestrconsts.dlgcocreatemakefile 1059msgctxt "lazarusidestrconsts.dlgcocreatemakefile" 1060msgid "Create Makefile" 1061msgstr "Crea Makefile" 1062 1063#: lazarusidestrconsts.dlgcodebugging 1064#, fuzzy 1065#| msgid "Debugging info" 1066msgctxt "lazarusidestrconsts.dlgcodebugging" 1067msgid "Debugging" 1068msgstr "Depuració" 1069 1070#: lazarusidestrconsts.dlgcodebugpath 1071msgid "Debugger path addition (none):" 1072msgstr "Afegeix la trajectòria addicional del depurador (cap):" 1073 1074#: lazarusidestrconsts.dlgcodecreation 1075msgid "Code Creation" 1076msgstr "Creació del codi" 1077 1078#: lazarusidestrconsts.dlgcodefoldenableboth 1079msgid "Both" 1080msgstr "" 1081 1082#: lazarusidestrconsts.dlgcodefoldenablefold 1083msgid "Fold" 1084msgstr "" 1085 1086#: lazarusidestrconsts.dlgcodefoldenablehide 1087msgid "Hide" 1088msgstr "" 1089 1090#: lazarusidestrconsts.dlgcodefoldpopuporder 1091msgid "Reverse fold-order in Popup" 1092msgstr "" 1093 1094#: lazarusidestrconsts.dlgcogdb 1095#, fuzzy 1096#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)" 1097msgid "Generate info for the debugger (slower / increases exe-size)" 1098msgstr "Genera informació de depuració pel GDB (Compilació més lenta)" 1099 1100#: lazarusidestrconsts.dlgcoheaptrc 1101#, fuzzy 1102#| msgid "Use Heaptrc Unit (check for mem-leaks)" 1103msgid "Use Heaptrc unit (check for mem-leaks)" 1104msgstr "Utilitza unitat Heaptrc" 1105 1106#: lazarusidestrconsts.dlgcoincfiles 1107#, fuzzy 1108#| msgid "Include Files (-Fi):" 1109msgid "Include files (-Fi):" 1110msgstr "Fitxers Inclosos (-Fi):" 1111 1112#: lazarusidestrconsts.dlgcoinfoforgdb 1113msgid "Debugger info" 1114msgstr "" 1115 1116#: lazarusidestrconsts.dlgcolibraries 1117msgid "Libraries (-Fl):" 1118msgstr "Biblioteques (-Fl):" 1119 1120#: lazarusidestrconsts.dlgcolinking 1121msgid "Linking" 1122msgstr "Enllaçament" 1123 1124#: lazarusidestrconsts.dlgcoloadsavehint 1125#, fuzzy 1126#| msgid "Load/Save" 1127msgctxt "lazarusidestrconsts.dlgcoloadsavehint" 1128msgid "Compiler options can be saved to an XML file." 1129msgstr "Carrega/Desa" 1130 1131#: lazarusidestrconsts.dlgcolor 1132msgid "Color" 1133msgstr "" 1134 1135#: lazarusidestrconsts.dlgcolorlink 1136msgid "(Edit Color)" 1137msgstr "" 1138 1139#: lazarusidestrconsts.dlgcolornotmodified 1140msgid "Not modified" 1141msgstr "" 1142 1143#: lazarusidestrconsts.dlgcolors 1144msgctxt "lazarusidestrconsts.dlgcolors" 1145msgid "Colors" 1146msgstr "Colors" 1147 1148#: lazarusidestrconsts.dlgcommandlineparams 1149msgid "Command line parameters (without application name)" 1150msgstr "Paràmetres de la línia d'ordres (sense nom d'aplicació)" 1151 1152#: lazarusidestrconsts.dlgcommentalignmaxdefault 1153msgid "Max indent for new line if prefix is based on start of comment on first comment line:" 1154msgstr "" 1155 1156#: lazarusidestrconsts.dlgcommentalignmaxtoken 1157msgid "Limit indent to" 1158msgstr "" 1159 1160#: lazarusidestrconsts.dlgcommentcontinue 1161msgid "Prefix comments on linebreak" 1162msgstr "" 1163 1164#: lazarusidestrconsts.dlgcommentcontinuematch 1165msgid "Match current line" 1166msgstr "" 1167 1168#: lazarusidestrconsts.dlgcommentcontinuematchasterisk 1169msgid "Match text including \"*\" of token \"(*\"" 1170msgstr "" 1171 1172#: lazarusidestrconsts.dlgcommentcontinuematchline 1173msgid "Match whole line" 1174msgstr "" 1175 1176#: lazarusidestrconsts.dlgcommentcontinuematchtext 1177#, object-pascal-format 1178msgid "Match text after token \"%s\"" 1179msgstr "" 1180 1181#: lazarusidestrconsts.dlgcommentcontinuematchtoken 1182#, object-pascal-format 1183msgid "Match text including token \"%s\"" 1184msgstr "" 1185 1186#: lazarusidestrconsts.dlgcommentcontinueprefix 1187msgid "Prefix new line" 1188msgstr "" 1189 1190#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault 1191msgid "Align Prefix at indent of previous line" 1192msgstr "" 1193 1194#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch 1195msgid "Align Prefix below start of comment on first comment line" 1196msgstr "" 1197 1198#: lazarusidestrconsts.dlgcommentcontinueprefixindnone 1199msgid "Do not indent prefix" 1200msgstr "" 1201 1202#: lazarusidestrconsts.dlgcommentindentgroupoptions 1203msgid "Comments and Strings" 1204msgstr "" 1205 1206#: lazarusidestrconsts.dlgcommentshlashextendalways 1207msgid "Extend if matched or not matched" 1208msgstr "" 1209 1210#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit 1211msgid "Extend if matched or not matched (not at EOL)" 1212msgstr "" 1213 1214#: lazarusidestrconsts.dlgcommentshlashextendmatch 1215msgid "Extend if matched" 1216msgstr "" 1217 1218#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit 1219msgid "Extend if matched and caret in the middle of text (not at EOL)" 1220msgstr "" 1221 1222#: lazarusidestrconsts.dlgcompilationandlinking 1223msgid "Compilation and Linking" 1224msgstr "" 1225 1226#: lazarusidestrconsts.dlgcompilermessage 1227msgid "Compiler messages" 1228msgstr "" 1229 1230#: lazarusidestrconsts.dlgcompilermessages 1231msgid "Compiler messages language file (*.msg)" 1232msgstr "" 1233 1234#: lazarusidestrconsts.dlgcompileroptions 1235msgctxt "lazarusidestrconsts.dlgcompileroptions" 1236msgid "Compiler Options" 1237msgstr "Opcions del compilador" 1238 1239#: lazarusidestrconsts.dlgcompleteproperties 1240msgid "Complete properties" 1241msgstr "Completa les propietats" 1242 1243#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected 1244msgid "Component under mouse cursor is first selected, then the popup menu commands work on it." 1245msgstr "" 1246 1247#: lazarusidestrconsts.dlgconfigandtarget 1248msgid "Config and Target" 1249msgstr "" 1250 1251#: lazarusidestrconsts.dlgconfigfiles 1252#, fuzzy 1253#| msgid "Config Files:" 1254msgid "Config files" 1255msgstr "Fitxers de configuració:" 1256 1257#: lazarusidestrconsts.dlgcootherdebugginginfo 1258msgid "Other debugging info" 1259msgstr "" 1260 1261#: lazarusidestrconsts.dlgcooverflow 1262msgid "Overflow" 1263msgstr "Sobreeiximent" 1264 1265#: lazarusidestrconsts.dlgcoparsing 1266msgid "Parsing" 1267msgstr "Analització" 1268 1269#: lazarusidestrconsts.dlgcopypastekeepfolds 1270msgid "Copy/Paste with fold info" 1271msgstr "" 1272 1273#: lazarusidestrconsts.dlgcopywordatcursoroncopynone 1274msgid "Copy current word when no selection exists" 1275msgstr "" 1276 1277#: lazarusidestrconsts.dlgcorange 1278msgctxt "lazarusidestrconsts.dlgcorange" 1279msgid "Range" 1280msgstr "Abast" 1281 1282#: lazarusidestrconsts.dlgcorelocatable 1283msgid "Relocatable" 1284msgstr "" 1285 1286#: lazarusidestrconsts.dlgcosetasdefault 1287msgid "Set compiler options as default" 1288msgstr "" 1289 1290#: lazarusidestrconsts.dlgcoshowerr 1291#, fuzzy 1292#| msgid "Show Errors" 1293msgid "Show errors" 1294msgstr "Mostra els errors" 1295 1296#: lazarusidestrconsts.dlgcoshowoptions 1297#, fuzzy 1298#| msgid "Show Options" 1299msgid "&Show Options" 1300msgstr "Mostra les opcions" 1301 1302#: lazarusidestrconsts.dlgcosmartlinkable 1303#, fuzzy 1304#| msgid "Smart Linkable" 1305msgid "Smart linkable" 1306msgstr "Enllaçament intel·ligent" 1307 1308#: lazarusidestrconsts.dlgcosources 1309#, fuzzy 1310#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" 1311msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)" 1312msgstr "Altres fonts (fitxers .pp/.pas, només utilitzat per l'IDE no pel compilador)" 1313 1314#: lazarusidestrconsts.dlgcostack 1315msgid "Stack" 1316msgstr "Pila" 1317 1318#: lazarusidestrconsts.dlgcostrip 1319#, fuzzy 1320#| msgid "Strip Symbols From Executable" 1321msgid "Strip symbols from executable" 1322msgstr "Elimina els símbols de l'executable" 1323 1324#: lazarusidestrconsts.dlgcosymboltype 1325msgid "Type of debug info" 1326msgstr "" 1327 1328#: lazarusidestrconsts.dlgcosymboltypeauto 1329msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" 1330msgid "Automatic" 1331msgstr "" 1332 1333#: lazarusidestrconsts.dlgcosymboltypedwarf2 1334msgid "Dwarf2" 1335msgstr "" 1336 1337#: lazarusidestrconsts.dlgcosymboltypedwarf2set 1338msgid "Dwarf with sets" 1339msgstr "" 1340 1341#: lazarusidestrconsts.dlgcosymboltypedwarf3 1342msgid "Dwarf3 (beta)" 1343msgstr "" 1344 1345#: lazarusidestrconsts.dlgcosymboltypestabs 1346msgid "Stabs" 1347msgstr "" 1348 1349#: lazarusidestrconsts.dlgcotrashvariables 1350msgid "Trash variables" 1351msgstr "" 1352 1353#: lazarusidestrconsts.dlgcounitstyle 1354#, fuzzy 1355#| msgid "Unit Style" 1356msgid "Unit style" 1357msgstr "Estil de la unitat:" 1358 1359#: lazarusidestrconsts.dlgcovalgrind 1360msgid "Generate code for valgrind" 1361msgstr "Genera codi pel Valgrind" 1362 1363#: lazarusidestrconsts.dlgcoverbosity 1364msgid "Verbosity" 1365msgstr "" 1366 1367#: lazarusidestrconsts.dlgcppinline 1368#, fuzzy 1369#| msgid "C++ Styled INLINE" 1370msgid "C++ styled INLINE" 1371msgstr "INLINE estil C++" 1372 1373#: lazarusidestrconsts.dlgcreatenewrunparameterssettings 1374msgid "Create new Run Parameters settings" 1375msgstr "" 1376 1377#: lazarusidestrconsts.dlgcurlycommenttab 1378msgid "Curly { }" 1379msgstr "" 1380 1381#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow 1382msgid "Currently respected by messages window, jump history and search results." 1383msgstr "" 1384 1385#: lazarusidestrconsts.dlgcursorbeyondeol 1386msgid "Cursor beyond EOL" 1387msgstr "El cursor darrera EOL" 1388 1389#: lazarusidestrconsts.dlgcursormoveclearsselection 1390msgid "Caret left/right clears selection (no move)" 1391msgstr "" 1392 1393#: lazarusidestrconsts.dlgcursorskipsselection 1394msgid "Caret skips selection" 1395msgstr "" 1396 1397#: lazarusidestrconsts.dlgcursorskipstab 1398msgid "Caret skips tabs" 1399msgstr "" 1400 1401#: lazarusidestrconsts.dlgcustomext 1402msgid "User defined extension (.pp.xxx)" 1403msgstr "Extensions definides per l'usuari (.pp.xxx)" 1404 1405#: lazarusidestrconsts.dlgdebugdesktop 1406msgid "debug" 1407msgstr "" 1408 1409#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption 1410msgid "Path Editor" 1411msgstr "" 1412 1413#: lazarusidestrconsts.dlgdebugtype 1414msgid "Debugger type and path" 1415msgstr "Tipus i trajectòria del depurador" 1416 1417#: lazarusidestrconsts.dlgdefaulteditorfont 1418msgid "Default editor font" 1419msgstr "Font de l'editor predeterminat" 1420 1421#: lazarusidestrconsts.dlgdefvaluecolor 1422msgid "Default Value" 1423msgstr "Valor per defecte" 1424 1425#: lazarusidestrconsts.dlgdeletemode 1426msgid "Delete mode" 1427msgstr "" 1428 1429#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption 1430#, fuzzy 1431msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption" 1432msgid "Delete" 1433msgstr "Elimina" 1434 1435#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint 1436msgid "Delete selected desktop" 1437msgstr "" 1438 1439#: lazarusidestrconsts.dlgdeltemplate 1440msgid "Delete template " 1441msgstr "Elimina la plantilla" 1442 1443#: lazarusidestrconsts.dlgdesktopbuttons 1444msgid "Buttons - " 1445msgstr "" 1446 1447#: lazarusidestrconsts.dlgdesktophints 1448msgid "Hints" 1449msgstr "" 1450 1451#: lazarusidestrconsts.dlgdesktopmenus 1452msgid "Menus - " 1453msgstr "" 1454 1455#: lazarusidestrconsts.dlgdesktopname 1456msgid "Desktop name" 1457msgstr "" 1458 1459#: lazarusidestrconsts.dlgdesktopsexported 1460#, object-pascal-format 1461msgid "%d desktop(s) successfully exported to \"%s\"" 1462msgstr "" 1463 1464#: lazarusidestrconsts.dlgdesktopsimported 1465#, object-pascal-format 1466msgid "%d desktop(s) successfully imported from \"%s\"" 1467msgstr "" 1468 1469#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor 1470msgid "Different values background" 1471msgstr "" 1472 1473#: lazarusidestrconsts.dlgdirection 1474msgid "Direction" 1475msgstr "Direcció" 1476 1477#: lazarusidestrconsts.dlgdisableantialiasing 1478msgid "Disable anti-aliasing" 1479msgstr "" 1480 1481#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep 1482msgid "Distance between grid points is the smallest step when moving a control." 1483msgstr "" 1484 1485#: lazarusidestrconsts.dlgdividercolordefault 1486msgid "Use right margin color" 1487msgstr "" 1488 1489#: lazarusidestrconsts.dlgdividerdrawdepth 1490msgid "Draw divider level" 1491msgstr "" 1492 1493#: lazarusidestrconsts.dlgdividernestcolor 1494msgid "Nested line color" 1495msgstr "" 1496 1497#: lazarusidestrconsts.dlgdividertopcolor 1498msgid "Line color" 1499msgstr "" 1500 1501#: lazarusidestrconsts.dlgdivpasbeginendname 1502msgid "Begin/End" 1503msgstr "" 1504 1505#: lazarusidestrconsts.dlgdivpasprocedurename 1506msgid "Procedure/Function" 1507msgstr "" 1508 1509#: lazarusidestrconsts.dlgdivpasstructglobalname 1510msgid "Class/Struct" 1511msgstr "" 1512 1513#: lazarusidestrconsts.dlgdivpasstructlocalname 1514msgid "Class/Struct (local)" 1515msgstr "" 1516 1517#: lazarusidestrconsts.dlgdivpastryname 1518msgid "Try/Except" 1519msgstr "" 1520 1521#: lazarusidestrconsts.dlgdivpasunitsectionname 1522msgid "Unit sections" 1523msgstr "" 1524 1525#: lazarusidestrconsts.dlgdivpasusesname 1526msgid "Uses clause" 1527msgstr "" 1528 1529#: lazarusidestrconsts.dlgdivpasvarglobalname 1530msgid "Var/Type" 1531msgstr "" 1532 1533#: lazarusidestrconsts.dlgdivpasvarlocalname 1534msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" 1535msgid "Var/Type (local)" 1536msgstr "" 1537 1538#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit 1539msgid "Draw the component's name below it." 1540msgstr "" 1541 1542#: lazarusidestrconsts.dlgedback 1543msgid "Back" 1544msgstr "Torna" 1545 1546#: lazarusidestrconsts.dlgedbold 1547msgid "Bold" 1548msgstr "Negreta" 1549 1550#: lazarusidestrconsts.dlgedbsubdir 1551msgid "Sub directory" 1552msgstr "Subdirectori" 1553 1554#: lazarusidestrconsts.dlgedcodetempl 1555#, fuzzy 1556#| msgid "Code templates" 1557msgctxt "lazarusidestrconsts.dlgedcodetempl" 1558msgid "Code Templates" 1559msgstr "Plantilles del codi" 1560 1561#: lazarusidestrconsts.dlgedcompleteblocks 1562msgid "Add close statement for Pascal blocks" 1563msgstr "" 1564 1565#: lazarusidestrconsts.dlgedcustomext 1566msgid "User defined extension" 1567msgstr "Extensió definida per l'usuari" 1568 1569#: lazarusidestrconsts.dlgeddelayinsec 1570#, object-pascal-format 1571msgid "(%s sec delay)" 1572msgstr "" 1573 1574#: lazarusidestrconsts.dlgeddisplay 1575msgid "Display" 1576msgstr "Visualitza a pantalla" 1577 1578#: lazarusidestrconsts.dlgedfiles 1579#, fuzzy 1580#| msgid "Editor files" 1581msgid "Editor Files" 1582msgstr "Fitxers de l'editor" 1583 1584#: lazarusidestrconsts.dlgedidcomlet 1585msgctxt "lazarusidestrconsts.dlgedidcomlet" 1586msgid "Identifier completion" 1587msgstr "Completa l'identificador" 1588 1589#: lazarusidestrconsts.dlgedinvert 1590msgid "Invert" 1591msgstr "" 1592 1593#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit 1594msgid "Ignore Locks, use longest unused editor" 1595msgstr "" 1596 1597#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit 1598msgid "Ignore Locks, if editor is current" 1599msgstr "" 1600 1601#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin 1602msgid "Ignore Locks, if editor in current window" 1603msgstr "" 1604 1605#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview 1606msgid "Locked, if text in view" 1607msgstr "" 1608 1609#: lazarusidestrconsts.dlgeditaccesscaptionunlocked 1610msgid "Unlocked" 1611msgstr "" 1612 1613#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview 1614msgid "Unlocked, if text in centered view" 1615msgstr "" 1616 1617#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin 1618msgid "New tab, existing or new window" 1619msgstr "" 1620 1621#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin 1622msgid "New tab in new window" 1623msgstr "" 1624 1625#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin 1626msgid "New tab in existing window" 1627msgstr "" 1628 1629#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit 1630msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." 1631msgstr "" 1632 1633#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit 1634msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." 1635msgstr "" 1636 1637#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin 1638msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." 1639msgstr "" 1640 1641#: lazarusidestrconsts.dlgeditaccessdesclockedinview 1642msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." 1643msgstr "" 1644 1645#: lazarusidestrconsts.dlgeditaccessdescunlocked 1646msgid "This option will use any not locked Editor." 1647msgstr "" 1648 1649#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview 1650msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." 1651msgstr "" 1652 1653#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin 1654msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested." 1655msgstr "" 1656 1657#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin 1658msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." 1659msgstr "" 1660 1661#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin 1662msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet." 1663msgstr "" 1664 1665#: lazarusidestrconsts.dlgedital 1666msgid "Italic" 1667msgstr "Itàlica" 1668 1669#: lazarusidestrconsts.dlgeditorfontsize 1670msgid "Editor font size" 1671msgstr "" 1672 1673#: lazarusidestrconsts.dlgeditoroptions 1674msgctxt "lazarusidestrconsts.dlgeditoroptions" 1675msgid "Editor options" 1676msgstr "" 1677 1678#: lazarusidestrconsts.dlgeditschemdefaults 1679msgid "Scheme globals" 1680msgstr "" 1681 1682#: lazarusidestrconsts.dlgedmisc 1683#, fuzzy 1684msgctxt "lazarusidestrconsts.dlgedmisc" 1685msgid "Miscellaneous" 1686msgstr "Miscel·lània" 1687 1688#: lazarusidestrconsts.dlgedoff 1689msgid "Off" 1690msgstr "" 1691 1692#: lazarusidestrconsts.dlgedon 1693msgid "On" 1694msgstr "" 1695 1696#: lazarusidestrconsts.dlgedtabindent 1697msgid "Tab and Indent" 1698msgstr "" 1699 1700#: lazarusidestrconsts.dlgedunder 1701msgid "Underline" 1702msgstr "Subratllat" 1703 1704#: lazarusidestrconsts.dlgelementattributes 1705msgid "Element Attributes" 1706msgstr "" 1707 1708#: lazarusidestrconsts.dlgendkeyjumpstoneareststart 1709msgid "End key jumps to nearest end" 1710msgstr "" 1711 1712#: lazarusidestrconsts.dlgenvask 1713msgid "Ask" 1714msgstr "Demana" 1715 1716#: lazarusidestrconsts.dlgenvbackuphelpnote 1717msgid "Notes: Project files are all files in the project directory" 1718msgstr "Nota: Els fitxers del projecte son tots els fitxers del directori del projecte" 1719 1720#: lazarusidestrconsts.dlgenvbckup 1721msgid "Backup" 1722msgstr "Còpia de seguretat" 1723 1724#: lazarusidestrconsts.dlgenvfiles 1725msgid "Files" 1726msgstr "Fitxers" 1727 1728#: lazarusidestrconsts.dlgenvgrid 1729msgid "Grid" 1730msgstr "Graella" 1731 1732#: lazarusidestrconsts.dlgenvidestartup 1733msgid "IDE Startup" 1734msgstr "" 1735 1736#: lazarusidestrconsts.dlgenvlanguage 1737msgctxt "lazarusidestrconsts.dlgenvlanguage" 1738msgid "Language" 1739msgstr "Llenguatge" 1740 1741#: lazarusidestrconsts.dlgenvlanguagehint 1742msgid "Language of all IDE strings. Restart IDE after changing it for best result." 1743msgstr "" 1744 1745#: lazarusidestrconsts.dlgenvlguidelines 1746msgid "Guide lines" 1747msgstr "Línies de la guia" 1748 1749#: lazarusidestrconsts.dlgenvmisc 1750msgctxt "lazarusidestrconsts.dlgenvmisc" 1751msgid "Miscellaneous" 1752msgstr "Miscel·lània" 1753 1754#: lazarusidestrconsts.dlgenvnone 1755msgctxt "lazarusidestrconsts.dlgenvnone" 1756msgid "None" 1757msgstr "Cap" 1758 1759#: lazarusidestrconsts.dlgenvotherfiles 1760#, fuzzy 1761#| msgid "Other files" 1762msgid "Other Files" 1763msgstr "Altres fitxers" 1764 1765#: lazarusidestrconsts.dlgenvproject 1766#, fuzzy 1767#| msgid "Project" 1768msgid "Tabs for project" 1769msgstr "Projecte" 1770 1771#: lazarusidestrconsts.dlgenvtype 1772msgctxt "lazarusidestrconsts.dlgenvtype" 1773msgid "Type" 1774msgstr "Tipus" 1775 1776#: lazarusidestrconsts.dlgeofocusmessagesatcompilation 1777msgid "Focus messages at compilation" 1778msgstr "" 1779 1780#: lazarusidestrconsts.dlgextracharspacing 1781msgid "Extra character spacing" 1782msgstr "" 1783 1784#: lazarusidestrconsts.dlgextralinespacing 1785msgid "Extra line spacing" 1786msgstr "Espaiat extra entre línies" 1787 1788#: lazarusidestrconsts.dlgextsymb 1789msgid "Use external debug symbols file" 1790msgstr "" 1791 1792#: lazarusidestrconsts.dlgfileassociationinos 1793msgid "Opening Files from OS" 1794msgstr "" 1795 1796#: lazarusidestrconsts.dlgfileexts 1797msgid "File extensions" 1798msgstr "Extensions d'Arxiu" 1799 1800#: lazarusidestrconsts.dlgfiles 1801#, object-pascal-format 1802msgid "%s files" 1803msgstr "" 1804 1805#: lazarusidestrconsts.dlgfilterall 1806#, fuzzy 1807msgctxt "lazarusidestrconsts.dlgfilterall" 1808msgid "All files" 1809msgstr "Tots els fitxers" 1810 1811#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile 1812msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile" 1813msgid "CodeTools template file" 1814msgstr "" 1815 1816#: lazarusidestrconsts.dlgfilterdcifile 1817msgid "DCI file" 1818msgstr "" 1819 1820#: lazarusidestrconsts.dlgfilterdelphiform 1821msgid "Delphi form" 1822msgstr "" 1823 1824#: lazarusidestrconsts.dlgfilterdelphipackage 1825msgctxt "lazarusidestrconsts.dlgfilterdelphipackage" 1826msgid "Delphi package" 1827msgstr "" 1828 1829#: lazarusidestrconsts.dlgfilterdelphiproject 1830#, fuzzy 1831msgctxt "lazarusidestrconsts.dlgfilterdelphiproject" 1832msgid "Delphi project" 1833msgstr "Projecte Delphi" 1834 1835#: lazarusidestrconsts.dlgfilterdelphiunit 1836msgctxt "lazarusidestrconsts.dlgfilterdelphiunit" 1837msgid "Delphi unit" 1838msgstr "" 1839 1840#: lazarusidestrconsts.dlgfilterexecutable 1841msgctxt "lazarusidestrconsts.dlgfilterexecutable" 1842msgid "Executable" 1843msgstr "" 1844 1845#: lazarusidestrconsts.dlgfilterfpcmessagefile 1846msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile" 1847msgid "FPC message file" 1848msgstr "" 1849 1850#: lazarusidestrconsts.dlgfilterhtml 1851msgid "HTML files" 1852msgstr "" 1853 1854#: lazarusidestrconsts.dlgfilterimagesbitmap 1855msgid "Bitmap images" 1856msgstr "" 1857 1858#: lazarusidestrconsts.dlgfilterimagespixmap 1859msgid "Pixmap images" 1860msgstr "" 1861 1862#: lazarusidestrconsts.dlgfilterimagespng 1863msgid "PNG images" 1864msgstr "" 1865 1866#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings 1867msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings" 1868msgid "Lazarus Desktop Settings" 1869msgstr "" 1870 1871#: lazarusidestrconsts.dlgfilterlazaruseditorfile 1872msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile" 1873msgid "Editor file types" 1874msgstr "" 1875 1876#: lazarusidestrconsts.dlgfilterlazarusfile 1877#, fuzzy 1878#| msgid "Lazarus File" 1879msgctxt "lazarusidestrconsts.dlgfilterlazarusfile" 1880msgid "Lazarus file" 1881msgstr "Arxiu Lazarus" 1882 1883#: lazarusidestrconsts.dlgfilterlazarusform 1884#, fuzzy 1885msgctxt "lazarusidestrconsts.dlgfilterlazarusform" 1886msgid "Lazarus form" 1887msgstr "Forma Lazarus" 1888 1889#: lazarusidestrconsts.dlgfilterlazarusinclude 1890msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude" 1891msgid "Lazarus include file" 1892msgstr "" 1893 1894#: lazarusidestrconsts.dlgfilterlazarusotherfile 1895msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile" 1896msgid "Lazarus other file" 1897msgstr "" 1898 1899#: lazarusidestrconsts.dlgfilterlazaruspackage 1900#, fuzzy 1901msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage" 1902msgid "Lazarus package" 1903msgstr "Paquet Lazarus" 1904 1905#: lazarusidestrconsts.dlgfilterlazarusproject 1906#, fuzzy 1907msgctxt "lazarusidestrconsts.dlgfilterlazarusproject" 1908msgid "Lazarus project" 1909msgstr "Projecte Lazarus" 1910 1911#: lazarusidestrconsts.dlgfilterlazarusprojectsource 1912#, fuzzy 1913msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource" 1914msgid "Lazarus project source" 1915msgstr "Font de projecte Lazarus" 1916 1917#: lazarusidestrconsts.dlgfilterlazarussession 1918msgid "Lazarus session" 1919msgstr "" 1920 1921#: lazarusidestrconsts.dlgfilterlazarusunit 1922#, fuzzy 1923msgctxt "lazarusidestrconsts.dlgfilterlazarusunit" 1924msgid "Lazarus unit" 1925msgstr "Unitat Lazarus" 1926 1927#: lazarusidestrconsts.dlgfilterpascalfile 1928msgctxt "lazarusidestrconsts.dlgfilterpascalfile" 1929msgid "Pascal file" 1930msgstr "" 1931 1932#: lazarusidestrconsts.dlgfilterprograms 1933msgctxt "lazarusidestrconsts.dlgfilterprograms" 1934msgid "Programs" 1935msgstr "" 1936 1937#: lazarusidestrconsts.dlgfilterxml 1938#, fuzzy 1939msgctxt "lazarusidestrconsts.dlgfilterxml" 1940msgid "XML files" 1941msgstr "Arxius XML" 1942 1943#: lazarusidestrconsts.dlgfindtextatcursor 1944msgid "Find text at cursor" 1945msgstr "Cerca el text al cursor" 1946 1947#: lazarusidestrconsts.dlgfolddiffchunk 1948msgid "Chunk" 1949msgstr "" 1950 1951#: lazarusidestrconsts.dlgfolddiffchunksect 1952msgid "Chunk section" 1953msgstr "" 1954 1955#: lazarusidestrconsts.dlgfoldhtmlasp 1956msgid "ASP" 1957msgstr "" 1958 1959#: lazarusidestrconsts.dlgfoldhtmlcomment 1960msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" 1961msgid "Comment" 1962msgstr "" 1963 1964#: lazarusidestrconsts.dlgfoldhtmlnode 1965msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" 1966msgid "Node" 1967msgstr "" 1968 1969#: lazarusidestrconsts.dlgfoldlfmitem 1970msgid "Item" 1971msgstr "" 1972 1973#: lazarusidestrconsts.dlgfoldlfmlist 1974msgid "List <>" 1975msgstr "" 1976 1977#: lazarusidestrconsts.dlgfoldlfmobject 1978msgid "Object (inherited, inline)" 1979msgstr "" 1980 1981#: lazarusidestrconsts.dlgfoldlocalpasvartype 1982msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" 1983msgid "Var/Type (local)" 1984msgstr "" 1985 1986#: lazarusidestrconsts.dlgfoldpasansicomment 1987msgid "Comment (* *)" 1988msgstr "" 1989 1990#: lazarusidestrconsts.dlgfoldpasasm 1991msgid "Asm" 1992msgstr "" 1993 1994#: lazarusidestrconsts.dlgfoldpasbeginend 1995msgid "Begin/End (nested)" 1996msgstr "" 1997 1998#: lazarusidestrconsts.dlgfoldpasborcomment 1999msgid "Comment { }" 2000msgstr "" 2001 2002#: lazarusidestrconsts.dlgfoldpascase 2003msgid "Case" 2004msgstr "" 2005 2006#: lazarusidestrconsts.dlgfoldpasclass 2007msgid "Class/Object" 2008msgstr "" 2009 2010#: lazarusidestrconsts.dlgfoldpasclasssection 2011msgid "public/private" 2012msgstr "" 2013 2014#: lazarusidestrconsts.dlgfoldpasexcept 2015msgid "Except/Finally" 2016msgstr "" 2017 2018#: lazarusidestrconsts.dlgfoldpasfordo 2019msgid "For/Do" 2020msgstr "" 2021 2022#: lazarusidestrconsts.dlgfoldpasifdef 2023msgid "{$IfDef}" 2024msgstr "" 2025 2026#: lazarusidestrconsts.dlgfoldpasifthen 2027msgid "If/Then/Else" 2028msgstr "" 2029 2030#: lazarusidestrconsts.dlgfoldpasnestedcomment 2031msgid "Nested Comment" 2032msgstr "" 2033 2034#: lazarusidestrconsts.dlgfoldpasprocbeginend 2035msgid "Begin/End (procedure)" 2036msgstr "" 2037 2038#: lazarusidestrconsts.dlgfoldpasprocedure 2039msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" 2040msgid "Procedure" 2041msgstr "Procediment" 2042 2043#: lazarusidestrconsts.dlgfoldpasprogram 2044msgctxt "lazarusidestrconsts.dlgfoldpasprogram" 2045msgid "Program" 2046msgstr "programa" 2047 2048#: lazarusidestrconsts.dlgfoldpasrecord 2049msgctxt "lazarusidestrconsts.dlgfoldpasrecord" 2050msgid "Record" 2051msgstr "" 2052 2053#: lazarusidestrconsts.dlgfoldpasrepeat 2054msgctxt "lazarusidestrconsts.dlgfoldpasrepeat" 2055msgid "Repeat" 2056msgstr "" 2057 2058#: lazarusidestrconsts.dlgfoldpasslashcomment 2059msgid "Comment //" 2060msgstr "" 2061 2062#: lazarusidestrconsts.dlgfoldpastry 2063msgid "Try" 2064msgstr "" 2065 2066#: lazarusidestrconsts.dlgfoldpasunit 2067msgctxt "lazarusidestrconsts.dlgfoldpasunit" 2068msgid "Unit" 2069msgstr "Unitat" 2070 2071#: lazarusidestrconsts.dlgfoldpasunitsection 2072msgid "Unit section" 2073msgstr "" 2074 2075#: lazarusidestrconsts.dlgfoldpasuserregion 2076msgid "{%Region}" 2077msgstr "" 2078 2079#: lazarusidestrconsts.dlgfoldpasuses 2080msgctxt "lazarusidestrconsts.dlgfoldpasuses" 2081msgid "Uses" 2082msgstr "" 2083 2084#: lazarusidestrconsts.dlgfoldpasvartype 2085msgid "Var/Type (global)" 2086msgstr "" 2087 2088#: lazarusidestrconsts.dlgfoldpaswhiledo 2089msgid "While/Do" 2090msgstr "" 2091 2092#: lazarusidestrconsts.dlgfoldpaswithdo 2093msgid "With/Do" 2094msgstr "" 2095 2096#: lazarusidestrconsts.dlgfoldxmlcdata 2097msgid "CData" 2098msgstr "" 2099 2100#: lazarusidestrconsts.dlgfoldxmlcomment 2101msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" 2102msgid "Comment" 2103msgstr "" 2104 2105#: lazarusidestrconsts.dlgfoldxmldoctype 2106msgid "DocType" 2107msgstr "" 2108 2109#: lazarusidestrconsts.dlgfoldxmlnode 2110msgctxt "lazarusidestrconsts.dlgfoldxmlnode" 2111msgid "Node" 2112msgstr "" 2113 2114#: lazarusidestrconsts.dlgfoldxmlprocess 2115msgid "Processing Instruction" 2116msgstr "" 2117 2118#: lazarusidestrconsts.dlgforcedpiscalingindesigntime 2119msgid "Force DPI scaling in design-time" 2120msgstr "" 2121 2122#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint 2123msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account." 2124msgstr "" 2125 2126#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror 2127msgid "The running Lazarus instance cannot accept any files." 2128msgstr "" 2129 2130#: lazarusidestrconsts.dlgforecolor 2131msgid "Foreground" 2132msgstr "Color primer pla " 2133 2134#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector 2135msgid "Change Object Inspector contents on clicking form title bar" 2136msgstr "" 2137 2138#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint 2139msgid "Show a form's properties in Object Inspector by clicking on its title bar." 2140msgstr "" 2141 2142#: lazarusidestrconsts.dlgforwardprocsinsertpolicy 2143msgid "Procedure insert policy" 2144msgstr "Política d'inserir procediments" 2145 2146#: lazarusidestrconsts.dlgforwardprocskeeporder 2147msgid "Keep order of procedures" 2148msgstr "Manté l'ordre dels procediments" 2149 2150#: lazarusidestrconsts.dlgfpcexecutable 2151#, object-pascal-format 2152msgid "Compiler executable (e.g. %s)" 2153msgstr "" 2154 2155#: lazarusidestrconsts.dlgfpcsrcpath 2156msgid "FPC source directory" 2157msgstr "Directori del codi font del FPC" 2158 2159#: lazarusidestrconsts.dlgfppkgconfigurationfile 2160msgid "Fppkg configuration file (e.g. fppkg.cfg)" 2161msgstr "" 2162 2163#: lazarusidestrconsts.dlgframecolor 2164msgid "Text-mark" 2165msgstr "" 2166 2167#: lazarusidestrconsts.dlgfrmeditor 2168msgid "Form Editor" 2169msgstr "Editor de forma" 2170 2171#: lazarusidestrconsts.dlgfrombeginning 2172msgid "From b&eginning" 2173msgstr "" 2174 2175#: lazarusidestrconsts.dlgfromcursor 2176msgid "From c&ursor" 2177msgstr "" 2178 2179#: lazarusidestrconsts.dlgglobal 2180msgid "&Global" 2181msgstr "" 2182 2183#: lazarusidestrconsts.dlggprof 2184msgid "Generate code for gprof" 2185msgstr "Genera codi pel gprof" 2186 2187#: lazarusidestrconsts.dlggrabbercolor 2188msgid "Grabber color" 2189msgstr "Color capturador" 2190 2191#: lazarusidestrconsts.dlggrayeddesktopsdocked 2192msgid "Grayed desktops are for docked environment." 2193msgstr "" 2194 2195#: lazarusidestrconsts.dlggrayeddesktopsundocked 2196msgid "Grayed desktops are for undocked environment." 2197msgstr "" 2198 2199#: lazarusidestrconsts.dlggridcolor 2200msgid "Grid color" 2201msgstr "Color de la graella" 2202 2203#: lazarusidestrconsts.dlggridconsistsofsmalldots 2204msgid "Grid consists of small dots which help aligning controls." 2205msgstr "" 2206 2207#: lazarusidestrconsts.dlggridx 2208msgid "Grid size X" 2209msgstr "Tamany X de la graella" 2210 2211#: lazarusidestrconsts.dlggridxhint 2212msgid "Horizontal grid step size" 2213msgstr "Tamany horitzontal del pas de la graella" 2214 2215#: lazarusidestrconsts.dlggridy 2216msgid "Grid size Y" 2217msgstr "Tamany Y de la graella" 2218 2219#: lazarusidestrconsts.dlggridyhint 2220msgid "Vertical grid step size" 2221msgstr "Tamany vertical del pas de la graella" 2222 2223#: lazarusidestrconsts.dlggroupcodeexplorer 2224#, fuzzy 2225msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" 2226msgid "Code Explorer" 2227msgstr "Explorador del codi" 2228 2229#: lazarusidestrconsts.dlggroupcodetools 2230msgid "Codetools" 2231msgstr "" 2232 2233#: lazarusidestrconsts.dlggroupdebugger 2234msgctxt "lazarusidestrconsts.dlggroupdebugger" 2235msgid "Debugger" 2236msgstr "" 2237 2238#: lazarusidestrconsts.dlggroupeditor 2239msgid "Editor" 2240msgstr "" 2241 2242#: lazarusidestrconsts.dlggroupenvironment 2243msgctxt "lazarusidestrconsts.dlggroupenvironment" 2244msgid "Environment" 2245msgstr "Entorn" 2246 2247#: lazarusidestrconsts.dlggroupundo 2248msgid "Group Undo" 2249msgstr "" 2250 2251#: lazarusidestrconsts.dlgguidelines 2252msgid "Show Guide Lines" 2253msgstr "Mostra les línies de la guia" 2254 2255#: lazarusidestrconsts.dlgguidelineshint 2256msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown." 2257msgstr "" 2258 2259#: lazarusidestrconsts.dlggutter 2260msgctxt "lazarusidestrconsts.dlggutter" 2261msgid "Gutter" 2262msgstr "" 2263 2264#: lazarusidestrconsts.dlgguttercollapsedcolor 2265msgid "Collapsed" 2266msgstr "" 2267 2268#: lazarusidestrconsts.dlgguttercolor 2269msgid "Gutter Color" 2270msgstr "Color del canal" 2271 2272#: lazarusidestrconsts.dlggutteredgecolor 2273msgid "Gutter Edge Color" 2274msgstr "" 2275 2276#: lazarusidestrconsts.dlggutterseparatorindex 2277msgid "Gutter separator index" 2278msgstr "" 2279 2280#: lazarusidestrconsts.dlghalfpagescroll 2281msgid "Half page scroll" 2282msgstr "Desplaça mitja pàgina" 2283 2284#: lazarusidestrconsts.dlgheapandstacksize 2285msgid "Heap and stack sizes" 2286msgstr "" 2287 2288#: lazarusidestrconsts.dlgheapsize 2289#, fuzzy 2290#| msgid "Heap Size" 2291msgid "Heap size" 2292msgstr "Tamany del montícul" 2293 2294#: lazarusidestrconsts.dlgheightofonepropertyingrid 2295msgid "Height of one property in the grid." 2296msgstr "" 2297 2298#: lazarusidestrconsts.dlgheightpos 2299msgid "Height:" 2300msgstr "Alçada" 2301 2302#: lazarusidestrconsts.dlghideideonrun 2303msgid "Hide IDE windows on run" 2304msgstr "Amaga les finestres de l'IDE durant l'execució" 2305 2306#: lazarusidestrconsts.dlghideideonrunhint 2307msgid "Do not show the IDE at all while program is running." 2308msgstr "" 2309 2310#: lazarusidestrconsts.dlghidesingletabinnotebook 2311msgid "Hide tab in single page windows" 2312msgstr "" 2313 2314#: lazarusidestrconsts.dlghighlightcolor 2315msgid "Highlight Color" 2316msgstr "" 2317 2318#: lazarusidestrconsts.dlghighlightfontcolor 2319msgid "Highlight Font Color" 2320msgstr "" 2321 2322#: lazarusidestrconsts.dlghighlightleftofcursor 2323msgid "Left Of Caret" 2324msgstr "" 2325 2326#: lazarusidestrconsts.dlghighlightrightofcursor 2327msgid "Right Of Caret" 2328msgstr "" 2329 2330#: lazarusidestrconsts.dlghintsparametersendernotused 2331msgid "Show hints for parameter \"Sender\" not used" 2332msgstr "" 2333 2334#: lazarusidestrconsts.dlghintsunused 2335#, fuzzy 2336#| msgid "Show Hints for unused units in main source" 2337msgid "Show hints for unused units in main" 2338msgstr "Mostra els suggeriments per les unitats no utilitzades en la font principal" 2339 2340#: lazarusidestrconsts.dlghomekeyjumpstoneareststart 2341msgid "Home key jumps to nearest start" 2342msgstr "La tecla d'inici salta al començament més proper" 2343 2344#: lazarusidestrconsts.dlghostapplication 2345msgid "Host application" 2346msgstr "Aplicació de l'amfitrió" 2347 2348#: lazarusidestrconsts.dlgidentifiercompletion 2349#, fuzzy 2350#| msgid "Identifier completion" 2351msgctxt "lazarusidestrconsts.dlgidentifiercompletion" 2352msgid "Identifier Completion" 2353msgstr "Completa l'identificador" 2354 2355#: lazarusidestrconsts.dlgidentifierpolicy 2356msgid "Identifier policy" 2357msgstr "Política d'identificador" 2358 2359#: lazarusidestrconsts.dlgideoptions 2360msgid "IDE Options" 2361msgstr "" 2362 2363#: lazarusidestrconsts.dlgifdefblockactive 2364msgid "Active $IFDEF code" 2365msgstr "" 2366 2367#: lazarusidestrconsts.dlgifdefblockinactive 2368msgid "Inactive $IFDEF code" 2369msgstr "" 2370 2371#: lazarusidestrconsts.dlgifdefblocktmpactive 2372msgid "Included mixed state $IFDEF code" 2373msgstr "" 2374 2375#: lazarusidestrconsts.dlgifdefnodeactive 2376msgid "Active $IFDEF node" 2377msgstr "" 2378 2379#: lazarusidestrconsts.dlgifdefnodeinactive 2380msgid "Inactive $IFDEF node" 2381msgstr "" 2382 2383#: lazarusidestrconsts.dlgifdefnodetmpactive 2384msgid "Included mixed state $IFDEF node" 2385msgstr "" 2386 2387#: lazarusidestrconsts.dlgimportdesktopexists 2388msgid "" 2389"A desktop with the same name already exists.\n" 2390"Please confirm the desktop name:" 2391msgstr "" 2392 2393#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl 2394msgid "Include code templates" 2395msgstr "" 2396 2397#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix 2398msgid "Include identifiers containing prefix" 2399msgstr "" 2400 2401#: lazarusidestrconsts.dlgincludesystemvariables 2402msgid "Include system variables" 2403msgstr "Inclou les variables del sistema" 2404 2405#: lazarusidestrconsts.dlgincludewordstoidentcompl 2406msgid "Include words" 2407msgstr "" 2408 2409#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude 2410msgid "don't include" 2411msgstr "" 2412 2413#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits 2414msgid "from all units" 2415msgstr "" 2416 2417#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit 2418msgid "from current unit" 2419msgstr "" 2420 2421#: lazarusidestrconsts.dlgindentsindentgroupoptions 2422msgid "Indent" 2423msgstr "" 2424 2425#: lazarusidestrconsts.dlgindentstabsgroupoptions 2426msgid "Tabs" 2427msgstr "" 2428 2429#: lazarusidestrconsts.dlginfrontofmethods 2430msgid "In front of methods" 2431msgstr "Davant dels mètodes" 2432 2433#: lazarusidestrconsts.dlginitdoneonly 2434msgid "Constructor name must be 'init' (destructor must be 'done')" 2435msgstr "El nom del constructor ha de ser 'init' (el del destructor ha de ser 'done')" 2436 2437#: lazarusidestrconsts.dlginsertclassparts 2438msgid "Insert class parts" 2439msgstr "" 2440 2441#: lazarusidestrconsts.dlginsertimplementation 2442msgid "Implementation" 2443msgstr "" 2444 2445#: lazarusidestrconsts.dlginsertinterface 2446msgid "Interface" 2447msgstr "" 2448 2449#: lazarusidestrconsts.dlginsertmethods 2450msgid "Insert method implementations" 2451msgstr "" 2452 2453#: lazarusidestrconsts.dlginsertsection 2454msgid "Insert into Uses section of" 2455msgstr "" 2456 2457#: lazarusidestrconsts.dlginsspaceafter 2458msgid "Insert space after" 2459msgstr "Insereix espai després de" 2460 2461#: lazarusidestrconsts.dlginsspacefront 2462msgid "Insert space in front of" 2463msgstr "Insereix espai davant de" 2464 2465#: lazarusidestrconsts.dlgintvinsec 2466msgid "Interval in secs" 2467msgstr "Interval en seg." 2468 2469#: lazarusidestrconsts.dlgjumpcodeblockpos 2470msgid "Vertical position for a code block jump in % (0=top, 100=bottom)" 2471msgstr "" 2472 2473#: lazarusidestrconsts.dlgjumpingetc 2474msgid "Jumping (e.g. Method Jumping)" 2475msgstr "Salt (p.ex. Salta mètodes)" 2476 2477#: lazarusidestrconsts.dlgjumpsinglelinepos 2478msgid "Vertical position for a single line jump in % (0=top, 100=bottom)" 2479msgstr "" 2480 2481#: lazarusidestrconsts.dlgjumptomethodbody 2482msgid "Jump directly to method body" 2483msgstr "" 2484 2485#: lazarusidestrconsts.dlgkeepcursorx 2486msgid "Keep caret X position when navigating up/down" 2487msgstr "" 2488 2489#: lazarusidestrconsts.dlgkeylink 2490msgid "(Edit Key)" 2491msgstr "" 2492 2493#: lazarusidestrconsts.dlgkeymapping 2494msgid "Key Mappings" 2495msgstr "Accessos ràpids" 2496 2497#: lazarusidestrconsts.dlgkeymappingerrors 2498msgid "Key mapping errors" 2499msgstr "Errors dels accessos ràpids" 2500 2501#: lazarusidestrconsts.dlgkeywordpolicy 2502msgid "Keyword policy" 2503msgstr "Política de paraula clau" 2504 2505#: lazarusidestrconsts.dlglabelgoto 2506msgid "Allow LABEL and GOTO" 2507msgstr "Permet LABEL i GOTO" 2508 2509#: lazarusidestrconsts.dlglang 2510msgctxt "lazarusidestrconsts.dlglang" 2511msgid "Language" 2512msgstr "Llenguatge" 2513 2514#: lazarusidestrconsts.dlglast 2515msgid "Last (i.e. at end of source)" 2516msgstr "Últim (p.ex. al final del codi font)" 2517 2518#: lazarusidestrconsts.dlglazarusdir 2519msgid "Lazarus directory (default for all projects)" 2520msgstr "Directori Lazarus (predeterminat per a tots els projectes)" 2521 2522#: lazarusidestrconsts.dlglazarusinstances 2523msgid "Lazarus instances" 2524msgstr "" 2525 2526#: lazarusidestrconsts.dlglefttopclr 2527#, fuzzy 2528#| msgid "Guid lines Left,Top" 2529msgid "Guide lines Left,Top" 2530msgstr "Color per esquerra, amunt" 2531 2532#: lazarusidestrconsts.dlglevel1opt 2533msgid "1 (quick, debugger friendly with small limitations)" 2534msgstr "" 2535 2536#: lazarusidestrconsts.dlglevel2opt 2537msgid "2 (-O1 + quick optimizations)" 2538msgstr "" 2539 2540#: lazarusidestrconsts.dlglevel3opt 2541msgid "3 (-O2 + slow optimizations)" 2542msgstr "" 2543 2544#: lazarusidestrconsts.dlglevel4opt 2545msgid "4 (-O3 + aggressive optimizations, beware)" 2546msgstr "" 2547 2548#: lazarusidestrconsts.dlglevelnoneopt 2549#, fuzzy 2550#| msgid "Level 0 (no extra optimizations)" 2551msgid "0 (no optimization, for debugging)" 2552msgstr "Nivell 0 (sense optimitzacions extres)" 2553 2554#: lazarusidestrconsts.dlglinesplitting 2555msgid "Line Splitting" 2556msgstr "Divisió entre línies" 2557 2558#: lazarusidestrconsts.dlglinksmart 2559#, fuzzy 2560#| msgid "Link Smart" 2561msgid "Link smart" 2562msgstr "Enllaçament intel·ligent" 2563 2564#: lazarusidestrconsts.dlglnumsbct 2565#, fuzzy 2566#| msgid "Display Line Numbers in Run-time Error Backtraces" 2567msgid "Display line numbers in run-time error backtraces" 2568msgstr "Mostra els números de línia en errors en temps d'execució en seguiments inversos" 2569 2570#: lazarusidestrconsts.dlgmainmenu 2571msgid "Main Menu" 2572msgstr "Menú principal" 2573 2574#: lazarusidestrconsts.dlgmainviewforms 2575#, fuzzy 2576#| msgid "View project forms" 2577msgid "View Project Forms" 2578msgstr "Mostra les formes del projecte" 2579 2580#: lazarusidestrconsts.dlgmainviewframes 2581msgid "View Project Frames" 2582msgstr "" 2583 2584#: lazarusidestrconsts.dlgmainviewunits 2585#, fuzzy 2586#| msgid "View project units" 2587msgctxt "lazarusidestrconsts.dlgmainviewunits" 2588msgid "View Project Units" 2589msgstr "Mostra les unitats del projecte" 2590 2591#: lazarusidestrconsts.dlgmakeexecutable 2592msgid "\"Make\" executable" 2593msgstr "" 2594 2595#: lazarusidestrconsts.dlgmanagedesktops 2596msgid "Manage desktops" 2597msgstr "" 2598 2599#: lazarusidestrconsts.dlgmargingutter 2600msgid "Margin and gutter" 2601msgstr "Marge i canal" 2602 2603#: lazarusidestrconsts.dlgmarkercolor 2604msgid "Marker color" 2605msgstr "Color del marcador" 2606 2607#: lazarusidestrconsts.dlgmarkupfoldcolor 2608msgid "Vertical-mark" 2609msgstr "" 2610 2611#: lazarusidestrconsts.dlgmarkupgroup 2612msgid "Highlight all occurrences of Word under Caret" 2613msgstr "" 2614 2615#: lazarusidestrconsts.dlgmarkupoutline 2616msgid "Outline (global)" 2617msgstr "" 2618 2619#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor 2620msgid "Warning: There are no colors configured for the selected language" 2621msgstr "" 2622 2623#: lazarusidestrconsts.dlgmarkupuserdefined 2624msgctxt "lazarusidestrconsts.dlgmarkupuserdefined" 2625msgid "User defined markup" 2626msgstr "" 2627 2628#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption 2629msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption" 2630msgid "Delete" 2631msgstr "Elimina" 2632 2633#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt 2634#, object-pascal-format 2635msgid "Delete list \"%s\"?" 2636msgstr "" 2637 2638#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd 2639msgid "Add Word or Term" 2640msgstr "" 2641 2642#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove 2643msgid "Remove Word or Term" 2644msgstr "" 2645 2646#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle 2647msgid "Toggle Word or Term" 2648msgstr "" 2649 2650#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate 2651msgid "Duplicate Term" 2652msgstr "" 2653 2654#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg 2655#, object-pascal-format 2656msgid "The term %s already exists. Duplicates will be removed when the list is saved." 2657msgstr "" 2658 2659#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist 2660msgid "Add/Remove in all editors" 2661msgstr "" 2662 2663#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel 2664msgid "Delete list" 2665msgstr "" 2666 2667#: lazarusidestrconsts.dlgmarkupuserdefinedlistname 2668msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname" 2669msgid "Name" 2670msgstr "Nom" 2671 2672#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew 2673msgid "Add list" 2674msgstr "" 2675 2676#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase 2677msgid "Case sensitive" 2678msgstr "" 2679 2680#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound 2681msgid "Set bound at term end" 2682msgstr "" 2683 2684#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound 2685msgid "Set bound at term start" 2686msgstr "" 2687 2688#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen 2689msgid "Ignore bounds for terms longer than" 2690msgstr "" 2691 2692#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect 2693msgid "selection" 2694msgstr "" 2695 2696#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword 2697msgid "current word" 2698msgstr "" 2699 2700#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts 2701msgid "Settings for terms added by key" 2702msgstr "" 2703 2704#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect 2705msgid "Smart match selection bounds" 2706msgstr "" 2707 2708#: lazarusidestrconsts.dlgmarkupuserdefinednewname 2709msgid "New list" 2710msgstr "" 2711 2712#: lazarusidestrconsts.dlgmarkupuserdefinednolists 2713msgid "No lists" 2714msgstr "" 2715 2716#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel 2717msgid "Select ..." 2718msgstr "" 2719 2720#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys 2721msgid "Key Settings" 2722msgstr "" 2723 2724#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain 2725msgid "Main settings" 2726msgstr "" 2727 2728#: lazarusidestrconsts.dlgmarkupwordbracket 2729msgid "Keyword brackets on caret (global)" 2730msgstr "" 2731 2732#: lazarusidestrconsts.dlgmarkupwordfulllen 2733msgid "Match whole words, if length is less or equal to:" 2734msgstr "" 2735 2736#: lazarusidestrconsts.dlgmarkupwordnokeyword 2737msgid "Ignore keywords" 2738msgstr "" 2739 2740#: lazarusidestrconsts.dlgmarkupwordnotimer 2741msgid "Disable timer for markup current word" 2742msgstr "" 2743 2744#: lazarusidestrconsts.dlgmarkupwordtrim 2745msgid "Trim spaces (when highlighting current selection)" 2746msgstr "" 2747 2748#: lazarusidestrconsts.dlgmaxcntr 2749msgid "Maximum counter" 2750msgstr "Número màxim de comptador" 2751 2752#: lazarusidestrconsts.dlgmaxlinelength 2753msgid "Max line length:" 2754msgstr "Longitud màxima de la línia" 2755 2756#: lazarusidestrconsts.dlgmaxrecentfiles 2757msgid "Max recent files" 2758msgstr "Núm.màx. de fitxers recents" 2759 2760#: lazarusidestrconsts.dlgmaxrecenthint 2761msgid "Value 0 means unlimited." 2762msgstr "" 2763 2764#: lazarusidestrconsts.dlgmaxrecentprojs 2765msgid "Max recent project files" 2766msgstr "Màx.fitxers projecte recents" 2767 2768#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod 2769msgid "Middle-click-modifier to close all other tabs" 2770msgstr "" 2771 2772#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod 2773msgid "Middle-click-modifier to close tabs on the right" 2774msgstr "" 2775 2776#: lazarusidestrconsts.dlgmixmethodsandproperties 2777msgid "Mix methods and properties" 2778msgstr "Barreja els mètodes i les propietats" 2779 2780#: lazarusidestrconsts.dlgmode 2781msgid "Mode" 2782msgstr "" 2783 2784#: lazarusidestrconsts.dlgmouseaction 2785msgid "Mouse Action" 2786msgstr "" 2787 2788#: lazarusidestrconsts.dlgmouseoptbtn1 2789msgctxt "lazarusidestrconsts.dlgmouseoptbtn1" 2790msgid "Single" 2791msgstr "" 2792 2793#: lazarusidestrconsts.dlgmouseoptbtn2 2794msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" 2795msgid "Double" 2796msgstr "" 2797 2798#: lazarusidestrconsts.dlgmouseoptbtn3 2799msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" 2800msgid "Triple" 2801msgstr "" 2802 2803#: lazarusidestrconsts.dlgmouseoptbtn4 2804msgctxt "lazarusidestrconsts.dlgmouseoptbtn4" 2805msgid "Quad" 2806msgstr "" 2807 2808#: lazarusidestrconsts.dlgmouseoptbtnany 2809msgid "Any" 2810msgstr "" 2811 2812#: lazarusidestrconsts.dlgmouseoptbtnextra1 2813msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1" 2814msgid "Extra 1" 2815msgstr "" 2816 2817#: lazarusidestrconsts.dlgmouseoptbtnextra2 2818msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2" 2819msgid "Extra 2" 2820msgstr "" 2821 2822#: lazarusidestrconsts.dlgmouseoptbtnleft 2823msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" 2824msgid "Left" 2825msgstr "Esquerra" 2826 2827#: lazarusidestrconsts.dlgmouseoptbtnmiddle 2828msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" 2829msgid "Middle" 2830msgstr "" 2831 2832#: lazarusidestrconsts.dlgmouseoptbtnmoddef 2833msgid "Make Fallback" 2834msgstr "" 2835 2836#: lazarusidestrconsts.dlgmouseoptbtnright 2837msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" 2838msgid "Right" 2839msgstr "Dreta" 2840 2841#: lazarusidestrconsts.dlgmouseoptbtnwheeldown 2842msgid "Wheel down" 2843msgstr "" 2844 2845#: lazarusidestrconsts.dlgmouseoptbtnwheelleft 2846msgid "Wheel left" 2847msgstr "" 2848 2849#: lazarusidestrconsts.dlgmouseoptbtnwheelright 2850msgid "Wheel right" 2851msgstr "" 2852 2853#: lazarusidestrconsts.dlgmouseoptbtnwheelup 2854msgid "Wheel up" 2855msgstr "" 2856 2857#: lazarusidestrconsts.dlgmouseoptcapture 2858msgid "Capture" 2859msgstr "" 2860 2861#: lazarusidestrconsts.dlgmouseoptcaretmove 2862msgid "Move Caret (extra)" 2863msgstr "" 2864 2865#: lazarusidestrconsts.dlgmouseoptcheckupdown 2866msgid "Act on Mouse up" 2867msgstr "" 2868 2869#: lazarusidestrconsts.dlgmouseoptdescaction 2870msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" 2871msgid "Action" 2872msgstr "" 2873 2874#: lazarusidestrconsts.dlgmouseoptdescbutton 2875msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" 2876msgid "Click" 2877msgstr "" 2878 2879#: lazarusidestrconsts.dlgmouseoptdlgtitle 2880msgid "Edit Mouse" 2881msgstr "" 2882 2883#: lazarusidestrconsts.dlgmouseopterrordup 2884msgid "Duplicate Entry" 2885msgstr "" 2886 2887#: lazarusidestrconsts.dlgmouseopterrorduptext 2888msgid "This entry conflicts with an existing entry" 2889msgstr "" 2890 2891#: lazarusidestrconsts.dlgmouseoptheadalt 2892msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" 2893msgid "Alt" 2894msgstr "Alt" 2895 2896#: lazarusidestrconsts.dlgmouseoptheadbtn 2897msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" 2898msgid "Button" 2899msgstr "" 2900 2901#: lazarusidestrconsts.dlgmouseoptheadcaret 2902msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret" 2903msgid "Caret" 2904msgstr "" 2905 2906#: lazarusidestrconsts.dlgmouseoptheadcontext 2907msgid "Context" 2908msgstr "" 2909 2910#: lazarusidestrconsts.dlgmouseoptheadcount 2911msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" 2912msgid "Click" 2913msgstr "" 2914 2915#: lazarusidestrconsts.dlgmouseoptheadctrl 2916msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" 2917msgid "Ctrl" 2918msgstr "Ctrl" 2919 2920#: lazarusidestrconsts.dlgmouseoptheaddesc 2921msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" 2922msgid "Action" 2923msgstr "" 2924 2925#: lazarusidestrconsts.dlgmouseoptheaddir 2926msgid "Up/Down" 2927msgstr "" 2928 2929#: lazarusidestrconsts.dlgmouseoptheadopt 2930msgid "Option" 2931msgstr "" 2932 2933#: lazarusidestrconsts.dlgmouseoptheadorder 2934msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" 2935msgid "Order" 2936msgstr "" 2937 2938#: lazarusidestrconsts.dlgmouseoptheadpriority 2939msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" 2940msgid "Priority" 2941msgstr "" 2942 2943#: lazarusidestrconsts.dlgmouseoptheadshift 2944msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" 2945msgid "Shift" 2946msgstr "Tecla de majúscules" 2947 2948#: lazarusidestrconsts.dlgmouseoptions 2949msgctxt "lazarusidestrconsts.dlgmouseoptions" 2950msgid "Mouse" 2951msgstr "" 2952 2953#: lazarusidestrconsts.dlgmouseoptionsadv 2954msgid "Advanced" 2955msgstr "" 2956 2957#: lazarusidestrconsts.dlgmouseoptionsyncommand 2958msgid "IDE-Command" 2959msgstr "" 2960 2961#: lazarusidestrconsts.dlgmouseoptmodalt 2962msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" 2963msgid "Alt" 2964msgstr "Alt" 2965 2966#: lazarusidestrconsts.dlgmouseoptmodctrl 2967msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" 2968msgid "Ctrl" 2969msgstr "Ctrl" 2970 2971#: lazarusidestrconsts.dlgmouseoptmodkeyfalse 2972msgid "n" 2973msgstr "" 2974 2975#: lazarusidestrconsts.dlgmouseoptmodkeyignore 2976msgid "-" 2977msgstr "" 2978 2979#: lazarusidestrconsts.dlgmouseoptmodkeytrue 2980msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" 2981msgid "Y" 2982msgstr "" 2983 2984#: lazarusidestrconsts.dlgmouseoptmodshift 2985msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" 2986msgid "Shift" 2987msgstr "Tecla de majúscules" 2988 2989#: lazarusidestrconsts.dlgmouseoptmovemousetrue 2990msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" 2991msgid "Y" 2992msgstr "" 2993 2994#: lazarusidestrconsts.dlgmouseoptnodeall 2995msgctxt "lazarusidestrconsts.dlgmouseoptnodeall" 2996msgid "All" 2997msgstr "" 2998 2999#: lazarusidestrconsts.dlgmouseoptnodegutter 3000msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" 3001msgid "Gutter" 3002msgstr "" 3003 3004#: lazarusidestrconsts.dlgmouseoptnodegutterchanges 3005msgid "Line Changes" 3006msgstr "" 3007 3008#: lazarusidestrconsts.dlgmouseoptnodegutterfold 3009msgid "Fold Tree" 3010msgstr "" 3011 3012#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol 3013msgid "Collapsed [+]" 3014msgstr "" 3015 3016#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp 3017msgid "Expanded [-]" 3018msgstr "" 3019 3020#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview 3021msgid "Overview" 3022msgstr "" 3023 3024#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks 3025msgid "Overview Mark" 3026msgstr "" 3027 3028#: lazarusidestrconsts.dlgmouseoptnodegutterlines 3029msgid "Line Numbers" 3030msgstr "" 3031 3032#: lazarusidestrconsts.dlgmouseoptnodemain 3033msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" 3034msgid "Text" 3035msgstr "Text" 3036 3037#: lazarusidestrconsts.dlgmouseoptnodeselect 3038msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" 3039msgid "Selection" 3040msgstr "Selecció" 3041 3042#: lazarusidestrconsts.dlgmouseoptopt2label 3043msgid "Opt" 3044msgstr "" 3045 3046#: lazarusidestrconsts.dlgmouseoptotheract 3047msgid "Other actions using the same button" 3048msgstr "" 3049 3050#: lazarusidestrconsts.dlgmouseoptotheracthint 3051msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." 3052msgstr "" 3053 3054#: lazarusidestrconsts.dlgmouseoptotheracttoggle 3055msgid "Filter Mod-Keys" 3056msgstr "" 3057 3058#: lazarusidestrconsts.dlgmouseoptpriorlabel 3059msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" 3060msgid "Priority" 3061msgstr "" 3062 3063#: lazarusidestrconsts.dlgmsgs 3064#, fuzzy 3065msgctxt "lazarusidestrconsts.dlgmsgs" 3066msgid "Messages" 3067msgstr "Missatges" 3068 3069#: lazarusidestrconsts.dlgmsgwincolorurgentdebug 3070#, fuzzy 3071msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug" 3072msgid "Debug" 3073msgstr "Depuració" 3074 3075#: lazarusidestrconsts.dlgmsgwincolorurgenterror 3076#, fuzzy 3077msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror" 3078msgid "Error" 3079msgstr "S'ha produït un error" 3080 3081#: lazarusidestrconsts.dlgmsgwincolorurgentfatal 3082msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal" 3083msgid "Fatal" 3084msgstr "" 3085 3086#: lazarusidestrconsts.dlgmsgwincolorurgenthint 3087msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint" 3088msgid "Hint" 3089msgstr "" 3090 3091#: lazarusidestrconsts.dlgmsgwincolorurgentimportant 3092msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant" 3093msgid "Important" 3094msgstr "" 3095 3096#: lazarusidestrconsts.dlgmsgwincolorurgentnone 3097msgid "Normal" 3098msgstr "" 3099 3100#: lazarusidestrconsts.dlgmsgwincolorurgentnote 3101msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote" 3102msgid "Note" 3103msgstr "" 3104 3105#: lazarusidestrconsts.dlgmsgwincolorurgentpanic 3106msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic" 3107msgid "Panic" 3108msgstr "" 3109 3110#: lazarusidestrconsts.dlgmsgwincolorurgentprogress 3111msgid "Time and statistics" 3112msgstr "" 3113 3114#: lazarusidestrconsts.dlgmsgwincolorurgentverbose 3115msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose" 3116msgid "Verbose" 3117msgstr "" 3118 3119#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2 3120msgid "Verbose 2" 3121msgstr "" 3122 3123#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3 3124msgid "Verbose 3" 3125msgstr "" 3126 3127#: lazarusidestrconsts.dlgmsgwincolorurgentwarning 3128msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning" 3129msgid "Warning" 3130msgstr "" 3131 3132#: lazarusidestrconsts.dlgmulticaretcolumnmode 3133msgid "Navigation keys move all carets (column-select)" 3134msgstr "" 3135 3136#: lazarusidestrconsts.dlgmulticaretdelskipcr 3137msgid "Skip delete key at EOL (do not join lines)" 3138msgstr "" 3139 3140#: lazarusidestrconsts.dlgmulticaretgroupoptions 3141msgid "Multi-caret" 3142msgstr "" 3143 3144#: lazarusidestrconsts.dlgmulticaretmode 3145msgid "Navigation keys move all carets" 3146msgstr "" 3147 3148#: lazarusidestrconsts.dlgmulticaretoncolumnselection 3149msgid "Enable multi-caret for column selection" 3150msgstr "" 3151 3152#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew 3153msgid "always start a new instance" 3154msgstr "" 3155 3156#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance 3157msgid "do not allow multiple instances" 3158msgstr "" 3159 3160#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning 3161msgid "open files in a running instance" 3162msgstr "" 3163 3164#: lazarusidestrconsts.dlgmultiselect 3165msgid "Multi Select" 3166msgstr "Sel·lecció múltiple" 3167 3168#: lazarusidestrconsts.dlgmultiwinaccessgroup 3169msgid "Jump target priority between multiple editors" 3170msgstr "" 3171 3172#: lazarusidestrconsts.dlgmultiwinaccessorder 3173msgid "Order to use for editors matching the same criteria" 3174msgstr "" 3175 3176#: lazarusidestrconsts.dlgmultiwinaccessorderedit 3177msgid "Most recent focused editor for this file" 3178msgstr "" 3179 3180#: lazarusidestrconsts.dlgmultiwinaccessorderwin 3181msgid "Editor (for file) in most recent focused window" 3182msgstr "" 3183 3184#: lazarusidestrconsts.dlgmultiwinaccesstype 3185msgid "Priority list of criteria to choose an editor:" 3186msgstr "" 3187 3188#: lazarusidestrconsts.dlgmultiwinoptions 3189msgid "Pages and Windows" 3190msgstr "" 3191 3192#: lazarusidestrconsts.dlgmultiwintabgroup 3193msgid "Notebook Tabs" 3194msgstr "" 3195 3196#: lazarusidestrconsts.dlgnaming 3197msgid "Naming" 3198msgstr "Anomenat" 3199 3200#: lazarusidestrconsts.dlgnewdesktop 3201msgid "New desktop ..." 3202msgstr "" 3203 3204#: lazarusidestrconsts.dlgnewprojecttype 3205msgid "New Project Type" 3206msgstr "" 3207 3208#: lazarusidestrconsts.dlgnoautomaticrenaming 3209#, fuzzy 3210#| msgid "no automatic renaming" 3211msgid "No automatic renaming" 3212msgstr "no canviïs el nom automàticament" 3213 3214#: lazarusidestrconsts.dlgnoavailableunits 3215msgid "No available units to add." 3216msgstr "" 3217 3218#: lazarusidestrconsts.dlgnobrackethighlight 3219msgid "No Highlight" 3220msgstr "" 3221 3222#: lazarusidestrconsts.dlgnonformbackgroundcolor 3223msgid "Other Designer background color (e. g. TDataModule)" 3224msgstr "" 3225 3226#: lazarusidestrconsts.dlgnotebooktabpos 3227msgid "Source notebook tabs position" 3228msgstr "" 3229 3230#: lazarusidestrconsts.dlgnotsplitlineafter 3231#, fuzzy 3232#| msgid "Do not split line after:" 3233msgid "Do not split line after" 3234msgstr "No separis la línia després de:" 3235 3236#: lazarusidestrconsts.dlgnotsplitlinefront 3237#, fuzzy 3238#| msgid "Do not split line In front of:" 3239msgid "Do not split line in front of" 3240msgstr "No separis la línia abans de:" 3241 3242#: lazarusidestrconsts.dlgnsprincipalclass 3243msgid "NSPrincipalClass" 3244msgstr "" 3245 3246#: lazarusidestrconsts.dlgobjinsp 3247#, fuzzy 3248msgctxt "lazarusidestrconsts.dlgobjinsp" 3249msgid "Object Inspector" 3250msgstr "Inspector dels objectes" 3251 3252#: lazarusidestrconsts.dlgoiitemheight 3253#, fuzzy 3254#| msgid "Item height" 3255msgid "Item height (0 = auto)" 3256msgstr "Alçada de l'element" 3257 3258#: lazarusidestrconsts.dlgoimiscellaneous 3259msgctxt "lazarusidestrconsts.dlgoimiscellaneous" 3260msgid "Miscellaneous" 3261msgstr "Miscel·lània" 3262 3263#: lazarusidestrconsts.dlgoispeedsettings 3264msgid "Speed settings" 3265msgstr "" 3266 3267#: lazarusidestrconsts.dlgoiusedefaultdelphisettings 3268msgid "Use default Delphi settings" 3269msgstr "" 3270 3271#: lazarusidestrconsts.dlgoiusedefaultlazarussettings 3272msgid "Use default Lazarus settings" 3273msgstr "" 3274 3275#: lazarusidestrconsts.dlgoptimizationlevels 3276msgid "Optimization levels" 3277msgstr "" 3278 3279#: lazarusidestrconsts.dlgotheroptimizations 3280msgid "Other optimizations" 3281msgstr "" 3282 3283#: lazarusidestrconsts.dlgotherunitfiles 3284#, fuzzy 3285#| msgid "Other unit files (-Fu) (delimiter is semicolon):" 3286msgid "Other unit files (-Fu):" 3287msgstr "Altres fitxers d'unitats (-Fu) (El delimitador és punt i coma):" 3288 3289#: lazarusidestrconsts.dlgoverviewgutterback1color 3290msgid "Background 1" 3291msgstr "" 3292 3293#: lazarusidestrconsts.dlgoverviewgutterback2color 3294msgid "Background 2" 3295msgstr "" 3296 3297#: lazarusidestrconsts.dlgoverviewguttercolor 3298msgid "Overview Gutter" 3299msgstr "" 3300 3301#: lazarusidestrconsts.dlgoverviewgutterpagecolor 3302msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor" 3303msgid "Page" 3304msgstr "" 3305 3306#: lazarusidestrconsts.dlgoverwriteblock 3307msgid "Overwrite block" 3308msgstr "" 3309 3310#: lazarusidestrconsts.dlgoverwritedesktop 3311#, object-pascal-format 3312msgid "" 3313"Desktop with the name \"%s\" was found.\n" 3314"Should the old desktop be overwritten?" 3315msgstr "" 3316 3317#: lazarusidestrconsts.dlgpalhints 3318msgid "Hints for component palette" 3319msgstr "Suggeriments per a la paleta de components" 3320 3321#: lazarusidestrconsts.dlgpasext 3322#, fuzzy 3323#| msgid "Default pascal extension" 3324msgid "Default Pascal extension" 3325msgstr "Extensió Pascal predeterminada" 3326 3327#: lazarusidestrconsts.dlgpasextkeywords 3328msgid "Highlight control statements as keywords" 3329msgstr "" 3330 3331#: lazarusidestrconsts.dlgpasextkeywordsgroup 3332msgid "Extended Pascal Keyword Options" 3333msgstr "" 3334 3335#: lazarusidestrconsts.dlgpaskeywordsmarkup 3336msgid "Markup (on caret)" 3337msgstr "" 3338 3339#: lazarusidestrconsts.dlgpaskeywordsmatches 3340msgid "Matching Keywords" 3341msgstr "" 3342 3343#: lazarusidestrconsts.dlgpaskeywordsoutline 3344msgid "Outline" 3345msgstr "" 3346 3347#: lazarusidestrconsts.dlgpassoptslinker 3348#, fuzzy 3349#| msgid "Pass options to linker (delimiter is space)" 3350msgid "Pass options to linker with \"-k\", delimiter is space" 3351msgstr "Passa les opcions a l'enllaçador (el delimitador és l'espai)" 3352 3353#: lazarusidestrconsts.dlgpasstringkeywords 3354msgid "Highlight \"String\" keyword(s)" 3355msgstr "" 3356 3357#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault 3358msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" 3359msgid "Default" 3360msgstr "Predeterminat" 3361 3362#: lazarusidestrconsts.dlgpasstringkeywordsoptnone 3363msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" 3364msgid "None" 3365msgstr "Cap" 3366 3367#: lazarusidestrconsts.dlgpasstringkeywordsoptstring 3368msgid "Only \"String\"" 3369msgstr "" 3370 3371#: lazarusidestrconsts.dlgpersistentblock 3372msgid "Persistent block" 3373msgstr "" 3374 3375#: lazarusidestrconsts.dlgpersistentcursor 3376msgid "Visible caret in unfocused editor" 3377msgstr "" 3378 3379#: lazarusidestrconsts.dlgpersistentcursornoblink 3380msgid "Caret in unfocused editor does not blink" 3381msgstr "" 3382 3383#: lazarusidestrconsts.dlgpoansiutf8 3384msgid "ANSI codepage is UTF-8 (Windows 10 1903+)" 3385msgstr "" 3386 3387#: lazarusidestrconsts.dlgpoapplication 3388msgid "Application" 3389msgstr "Aplicació" 3390 3391#: lazarusidestrconsts.dlgpoasinvoker 3392msgid "as invoker (asInvoker)" 3393msgstr "" 3394 3395#: lazarusidestrconsts.dlgpoclearicon 3396msgid "&Clear Icon" 3397msgstr "" 3398 3399#: lazarusidestrconsts.dlgpocreateappbundle 3400msgid "Create Application Bundle" 3401msgstr "" 3402 3403#: lazarusidestrconsts.dlgpodebugger 3404msgctxt "lazarusidestrconsts.dlgpodebugger" 3405msgid "Debugger" 3406msgstr "" 3407 3408#: lazarusidestrconsts.dlgpodefaulticon 3409msgid "Load &Default" 3410msgstr "" 3411 3412#: lazarusidestrconsts.dlgpodpiawareness 3413msgid "DPI awareness" 3414msgstr "" 3415 3416#: lazarusidestrconsts.dlgpodpiawarenessoff 3417msgid "off" 3418msgstr "" 3419 3420#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor 3421msgid "Vista-8: off, 8.1+: per monitor" 3422msgstr "" 3423 3424#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor 3425msgid "Vista-8: on, 8.1+: per monitor" 3426msgstr "" 3427 3428#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2 3429msgid "Vista-8: on, 8.1/10+: per monitor/V2" 3430msgstr "" 3431 3432#: lazarusidestrconsts.dlgpodpiawarenesson 3433msgid "on" 3434msgstr "" 3435 3436#: lazarusidestrconsts.dlgpoexecutionlevel 3437msgid "Execution Level" 3438msgstr "" 3439 3440#: lazarusidestrconsts.dlgpofroms 3441msgid "Forms" 3442msgstr "Formes" 3443 3444#: lazarusidestrconsts.dlgpohighestavailable 3445msgid "highest available (highestAvailable)" 3446msgstr "" 3447 3448#: lazarusidestrconsts.dlgpoi18n 3449msgid "i18n" 3450msgstr "" 3451 3452#: lazarusidestrconsts.dlgpoicon 3453msgid "Icon:" 3454msgstr "" 3455 3456#: lazarusidestrconsts.dlgpoicondesc 3457#, object-pascal-format 3458msgid "(size: %d:%d, bpp: %d)" 3459msgstr "" 3460 3461#: lazarusidestrconsts.dlgpoicondescnone 3462msgctxt "lazarusidestrconsts.dlgpoicondescnone" 3463msgid "(none)" 3464msgstr "" 3465 3466#: lazarusidestrconsts.dlgpoloadicon 3467msgid "&Load Icon" 3468msgstr "" 3469 3470#: lazarusidestrconsts.dlgpolongpathaware 3471msgid "Long path awareness" 3472msgstr "" 3473 3474#: lazarusidestrconsts.dlgpomisc 3475msgctxt "lazarusidestrconsts.dlgpomisc" 3476msgid "Miscellaneous" 3477msgstr "Miscel·lània" 3478 3479#: lazarusidestrconsts.dlgporequireadministrator 3480msgid "require administrator (requireAdministrator)" 3481msgstr "" 3482 3483#: lazarusidestrconsts.dlgporesources 3484msgid "Resources" 3485msgstr "" 3486 3487#: lazarusidestrconsts.dlgposaveicon 3488msgid "&Save Icon" 3489msgstr "" 3490 3491#: lazarusidestrconsts.dlgposavesession 3492msgid "Session" 3493msgstr "Sessió" 3494 3495#: lazarusidestrconsts.dlgpotitle 3496msgid "Title:" 3497msgstr "Títol" 3498 3499#: lazarusidestrconsts.dlgpouiaccess 3500msgid "UI Access (uiAccess)" 3501msgstr "" 3502 3503#: lazarusidestrconsts.dlgpouseappbundle 3504msgid "Use Application Bundle for running and debugging" 3505msgstr "" 3506 3507#: lazarusidestrconsts.dlgpouselclscaling 3508msgid "Use LCL scaling (Hi-DPI)" 3509msgstr "" 3510 3511#: lazarusidestrconsts.dlgpousemanifest 3512msgid "Use manifest resource (and enable themes)" 3513msgstr "" 3514 3515#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick 3516msgid "Prefer double-click over single-click" 3517msgstr "" 3518 3519#: lazarusidestrconsts.dlgpriorities 3520msgid "Priorities" 3521msgstr "" 3522 3523#: lazarusidestrconsts.dlgproject 3524msgctxt "lazarusidestrconsts.dlgproject" 3525msgid "Project" 3526msgstr "" 3527 3528#: lazarusidestrconsts.dlgprojectoptions 3529msgid "Project Options" 3530msgstr "Opcions del projecte" 3531 3532#: lazarusidestrconsts.dlgprojectoptionsfor 3533#, object-pascal-format 3534msgid "Options for Project: %s" 3535msgstr "" 3536 3537#: lazarusidestrconsts.dlgprojecttoopenorcreate 3538msgid "Project to Open or Create" 3539msgstr "" 3540 3541#: lazarusidestrconsts.dlgprojfiles 3542#, fuzzy 3543#| msgid "Project files" 3544msgid "Project Files" 3545msgstr "Fitxers de projecte" 3546 3547#: lazarusidestrconsts.dlgpromptonreplace 3548msgid "&Prompt on replace" 3549msgstr "" 3550 3551#: lazarusidestrconsts.dlgpropertycompletion 3552msgid "Property completion" 3553msgstr "Ompleix les propietats" 3554 3555#: lazarusidestrconsts.dlgpropnamecolor 3556msgid "Property Name" 3557msgstr "Nom de propietat" 3558 3559#: lazarusidestrconsts.dlgqopenlastprj 3560#, fuzzy 3561#| msgid "Open last project at start" 3562msgid "Open last project and packages at start" 3563msgstr "Obre l'últim projecte a l'iniciar" 3564 3565#: lazarusidestrconsts.dlgqshowborderspacing 3566msgid "Show border spacing" 3567msgstr "" 3568 3569#: lazarusidestrconsts.dlgqshowgrid 3570msgid "Show grid" 3571msgstr "Mostra la graella" 3572 3573#: lazarusidestrconsts.dlgqsnaptogrid 3574msgid "Snap to grid" 3575msgstr "Ajusta a la graella" 3576 3577#: lazarusidestrconsts.dlgreallydeletedesktop 3578#, object-pascal-format 3579msgid "Really delete desktop \"%s\"?" 3580msgstr "" 3581 3582#: lazarusidestrconsts.dlgreferencecolor 3583msgid "Reference" 3584msgstr "" 3585 3586#: lazarusidestrconsts.dlgregularexpressions 3587msgid "Regular e&xpressions" 3588msgstr "" 3589 3590#: lazarusidestrconsts.dlgrenamedesktop 3591msgid "Rename desktop" 3592msgstr "" 3593 3594#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption 3595#, fuzzy 3596msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption" 3597msgid "Rename" 3598msgstr "Canvia el nom" 3599 3600#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint 3601msgid "Rename selected desktop" 3602msgstr "" 3603 3604#: lazarusidestrconsts.dlgreplaceall 3605msgid "Replace &All" 3606msgstr "Reemplaça Tot" 3607 3608#: lazarusidestrconsts.dlgreplacewith 3609#, fuzzy 3610#| msgid "&Replace with" 3611msgid "Replace wit&h" 3612msgstr "&Reemplaça amb" 3613 3614#: lazarusidestrconsts.dlgreport 3615msgid "Report" 3616msgstr "Informa" 3617 3618#: lazarusidestrconsts.dlgreset 3619msgctxt "lazarusidestrconsts.dlgreset" 3620msgid "Reset" 3621msgstr "" 3622 3623#: lazarusidestrconsts.dlgresetall 3624msgid "Reset all" 3625msgstr "" 3626 3627#: lazarusidestrconsts.dlgrightbottomclr 3628#, fuzzy 3629#| msgid "color for right, bottom" 3630msgid "Guide lines Right,Bottom" 3631msgstr "Color per dreta, avall" 3632 3633#: lazarusidestrconsts.dlgrightclickselects 3634#, fuzzy 3635#| msgid "Right Click selects" 3636msgid "Right click selects" 3637msgstr "Clic dret selecciona" 3638 3639#: lazarusidestrconsts.dlgrightmargin 3640msgid "Right margin" 3641msgstr "Marge dret" 3642 3643#: lazarusidestrconsts.dlgroworkingdirectory 3644msgid "Working directory" 3645msgstr "Directori de treball" 3646 3647#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren 3648msgid "Select grandchildren" 3649msgstr "" 3650 3651#: lazarusidestrconsts.dlgruberbandcreationcolor 3652#, fuzzy 3653#| msgid "Creation" 3654msgid "Rubberband Creation" 3655msgstr "Creació" 3656 3657#: lazarusidestrconsts.dlgruberbandselectioncolor 3658#, fuzzy 3659#| msgid "Selection" 3660msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" 3661msgid "Rubberband Selection" 3662msgstr "Selecció" 3663 3664#: lazarusidestrconsts.dlgrunninginstancemodalerror 3665#, object-pascal-format 3666msgid "" 3667"The running Lazarus instance cannot accept any files.\n" 3668"Do you want to open them in a new IDE instance?\n" 3669"\n" 3670"%s" 3671msgstr "" 3672 3673#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror 3674msgid "Lazarus instance is running but not responding." 3675msgstr "" 3676 3677#: lazarusidestrconsts.dlgrunodisplay 3678msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" 3679msgstr "Pantalla(no per win32, p.ex. 198.112.45.11:0, x.org:1, hydra:0.1)" 3680 3681#: lazarusidestrconsts.dlgrunoenvironment 3682msgctxt "lazarusidestrconsts.dlgrunoenvironment" 3683msgid "Environment" 3684msgstr "Entorn" 3685 3686#: lazarusidestrconsts.dlgrunolocal 3687msgid "Local" 3688msgstr "Local" 3689 3690#: lazarusidestrconsts.dlgrunosystemvariables 3691msgid "System variables" 3692msgstr "Variables del sistema" 3693 3694#: lazarusidestrconsts.dlgrunousedisplay 3695msgid "Use display" 3696msgstr "Utilitza la pantalla" 3697 3698#: lazarusidestrconsts.dlgrunouseroverrides 3699msgid "User overrides" 3700msgstr "L'usuari substitueix" 3701 3702#: lazarusidestrconsts.dlgrunparameters 3703#, fuzzy 3704#| msgid "Run parameters" 3705msgid "Run Parameters" 3706msgstr "Executa els paràmetres" 3707 3708#: lazarusidestrconsts.dlgsavecurrentdesktop 3709msgid "Save current desktop" 3710msgstr "" 3711 3712#: lazarusidestrconsts.dlgsavecurrentdesktopas 3713msgid "Save current desktop as" 3714msgstr "" 3715 3716#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption 3717msgid "Save active desktop as ..." 3718msgstr "" 3719 3720#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint 3721msgid "Save active desktop as" 3722msgstr "" 3723 3724#: lazarusidestrconsts.dlgsavedlinecolor 3725msgid "Saved line" 3726msgstr "" 3727 3728#: lazarusidestrconsts.dlgsaveeditorinfo 3729msgid "Save editor info for closed files" 3730msgstr "Desa l'informació de l'editor pels fitxers tancats" 3731 3732#: lazarusidestrconsts.dlgsaveeditorinfohint 3733msgid "The files are available in the \"Open Recent\" history list." 3734msgstr "" 3735 3736#: lazarusidestrconsts.dlgsaveeditorinfoproject 3737msgid "Save editor info only for project files" 3738msgstr "Desa l'informació de l'editor només per fitxers del projecte" 3739 3740#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint 3741msgid "Only files that belong to this project." 3742msgstr "" 3743 3744#: lazarusidestrconsts.dlgsavein 3745msgid "Save in" 3746msgstr "" 3747 3748#: lazarusidestrconsts.dlgscrollbyoneless 3749msgid "Scroll by one less" 3750msgstr "Desplaça un menys" 3751 3752#: lazarusidestrconsts.dlgscrollgroupoptions 3753msgid "Scrolling" 3754msgstr "" 3755 3756#: lazarusidestrconsts.dlgscrollhint 3757msgctxt "lazarusidestrconsts.dlgscrollhint" 3758msgid "Show scroll hint" 3759msgstr "Mostra el suggeriment deplaçat" 3760 3761#: lazarusidestrconsts.dlgscrollpastendfile 3762msgid "Scroll past end of file" 3763msgstr "Desplaça fins el final del fitxer" 3764 3765#: lazarusidestrconsts.dlgscrollpastendline 3766#, fuzzy 3767#| msgid "Scroll past end of line" 3768msgid "Allow caret to move past end of line" 3769msgstr "Desplaça fins el final de la línia" 3770 3771#: lazarusidestrconsts.dlgseachdirectorynotfound 3772#, object-pascal-format 3773msgid "Search directory \"%s\" not found." 3774msgstr "" 3775 3776#: lazarusidestrconsts.dlgsearchabort 3777msgid "Search terminated by user." 3778msgstr "L'usuari ha finalitzat la recerca." 3779 3780#: lazarusidestrconsts.dlgsearchcaption 3781#, fuzzy 3782#| msgid "Searching..." 3783msgid "Searching ..." 3784msgstr "Cercant..." 3785 3786#: lazarusidestrconsts.dlgsearchpaths 3787msgid "Paths" 3788msgstr "trajectòries" 3789 3790#: lazarusidestrconsts.dlgsearchscope 3791msgid "Search scope" 3792msgstr "" 3793 3794#: lazarusidestrconsts.dlgselectallchildcontrols 3795msgid "Select all child controls together with their parent." 3796msgstr "" 3797 3798#: lazarusidestrconsts.dlgselectallnoscroll 3799msgid "Do not scroll on Select-All / Paragraph or To-Brace" 3800msgstr "" 3801 3802#: lazarusidestrconsts.dlgselectedtext 3803msgid "&Selected text" 3804msgstr "" 3805 3806#: lazarusidestrconsts.dlgsetactivedesktopbtncaption 3807msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption" 3808msgid "Set active" 3809msgstr "" 3810 3811#: lazarusidestrconsts.dlgsetactivedesktopbtnhint 3812msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint" 3813msgid "Set active" 3814msgstr "" 3815 3816#: lazarusidestrconsts.dlgsetallelementdefault 3817msgid "Set all elements to default" 3818msgstr "Predetermina tots els elements" 3819 3820#: lazarusidestrconsts.dlgsetelementdefault 3821msgid "Set element to default" 3822msgstr "Predetermina l'element" 3823 3824#: lazarusidestrconsts.dlgsetpropertyvariable 3825msgid "Set property Variable" 3826msgstr "Variable de propietat" 3827 3828#: lazarusidestrconsts.dlgsetpropertyvariablehint 3829msgid "The parameter name for the default setter procedure." 3830msgstr "" 3831 3832#: lazarusidestrconsts.dlgsetpropertyvariableisprefix 3833msgid "is prefix" 3834msgstr "" 3835 3836#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint 3837msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name." 3838msgstr "" 3839 3840#: lazarusidestrconsts.dlgsetpropertyvariableuseconst 3841msgid "use const" 3842msgstr "" 3843 3844#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint 3845msgid "If checked, the setter parameter is marked with \"const\"." 3846msgstr "" 3847 3848#: lazarusidestrconsts.dlgshowallunits 3849msgid "Show all units" 3850msgstr "" 3851 3852#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals 3853msgid "Show captions of nonvisual components" 3854msgstr "" 3855 3856#: lazarusidestrconsts.dlgshowcompiledprocedures 3857msgid "Show compiled procedures" 3858msgstr "Mostra els procediments compilats" 3859 3860#: lazarusidestrconsts.dlgshowcompilinglinenumbers 3861#, fuzzy 3862msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" 3863msgid "Show line numbers" 3864msgstr "Mostra els números de línia" 3865 3866#: lazarusidestrconsts.dlgshowconditionals 3867msgid "Show conditionals" 3868msgstr "Mostra els condicionals" 3869 3870#: lazarusidestrconsts.dlgshowdebuginfo 3871msgid "Show debug info" 3872msgstr "Mostra l'informació de la depuració" 3873 3874#: lazarusidestrconsts.dlgshowdesignerhints 3875msgid "Show designer hints" 3876msgstr "" 3877 3878#: lazarusidestrconsts.dlgshowdesignerhintshint 3879msgid "Hint shows control's position or size while moving or resizing it." 3880msgstr "" 3881 3882#: lazarusidestrconsts.dlgshoweverything 3883msgid "Show everything" 3884msgstr "Mostra-ho tot" 3885 3886#: lazarusidestrconsts.dlgshowexecutableinfo 3887msgid "Show executable info (Win32 only)" 3888msgstr "Mostra informació per l'executable (sols Win32)" 3889 3890#: lazarusidestrconsts.dlgshowfilenameincaption 3891msgid "Show file name in caption" 3892msgstr "" 3893 3894#: lazarusidestrconsts.dlgshowgeneralinfo 3895msgid "Show general info" 3896msgstr "Mostra l'informació general" 3897 3898#: lazarusidestrconsts.dlgshowgutterhints 3899msgid "Show gutter hints" 3900msgstr "Mostra els suggeriments sense importància" 3901 3902#: lazarusidestrconsts.dlgshowhint 3903#, fuzzy 3904#| msgid "Show Hints" 3905msgctxt "lazarusidestrconsts.dlgshowhint" 3906msgid "Show hints" 3907msgstr "Mostra les indicacions" 3908 3909#: lazarusidestrconsts.dlgshowingwindows 3910msgid "Showing Windows" 3911msgstr "" 3912 3913#: lazarusidestrconsts.dlgshowlinenumbers 3914msgctxt "lazarusidestrconsts.dlgshowlinenumbers" 3915msgid "Show line numbers" 3916msgstr "Mostra els números de línia" 3917 3918#: lazarusidestrconsts.dlgshowmessagesicons 3919msgid "Show Messages Icons" 3920msgstr "" 3921 3922#: lazarusidestrconsts.dlgshownotes 3923#, fuzzy 3924#| msgid "Show Notes" 3925msgid "Show notes" 3926msgstr "Mostra les notes" 3927 3928#: lazarusidestrconsts.dlgshowsummary 3929msgid "Show summary" 3930msgstr "Mostra el reportatge" 3931 3932#: lazarusidestrconsts.dlgshowtriedfiles 3933msgid "Show tried files" 3934msgstr "Mostra els fitxers escollits" 3935 3936#: lazarusidestrconsts.dlgshowusedfiles 3937msgid "Show used files" 3938msgstr "Mostra els fitxers utilitzats" 3939 3940#: lazarusidestrconsts.dlgshowwarnings 3941#, fuzzy 3942#| msgid "Show Warnings" 3943msgid "Show warnings" 3944msgstr "Mostra els avisos" 3945 3946#: lazarusidestrconsts.dlgsingletaskbarbutton 3947msgid "Show single button in TaskBar" 3948msgstr "" 3949 3950#: lazarusidestrconsts.dlgskipforwardclassdeclarations 3951msgid "Skip forward class declarations" 3952msgstr "" 3953 3954#: lazarusidestrconsts.dlgslashcommenttab 3955msgid "Slash //" 3956msgstr "" 3957 3958#: lazarusidestrconsts.dlgsmarttabs 3959msgid "Smart tabs" 3960msgstr "Tabuladors intel·ligents" 3961 3962#: lazarusidestrconsts.dlgsmbbehind 3963msgid "Symbol behind (.pp~)" 3964msgstr "Símbol darrera (.pp~)" 3965 3966#: lazarusidestrconsts.dlgsmbcounter 3967msgid "Counter (.pp;1)" 3968msgstr "Comptador (.pp;1)" 3969 3970#: lazarusidestrconsts.dlgsmbfront 3971msgid "Symbol in front (.~pp)" 3972msgstr "Símbol davant (.~pp)" 3973 3974#: lazarusidestrconsts.dlgsnapguidelines 3975msgid "Snap to Guide Lines" 3976msgstr "Ajusta a les línies de la guia" 3977 3978#: lazarusidestrconsts.dlgsnapguidelineshint 3979msgid "When a control is close to being aligned with another control, it snaps to the aligned position." 3980msgstr "" 3981 3982#: lazarusidestrconsts.dlgsourceedittabmultiline 3983msgid "Multiline tabs" 3984msgstr "" 3985 3986#: lazarusidestrconsts.dlgspacenotcosmos 3987msgctxt "lazarusidestrconsts.dlgspacenotcosmos" 3988msgid "Space" 3989msgstr "Espaiat" 3990 3991#: lazarusidestrconsts.dlgspbhints 3992msgid "Hints for main speed buttons (open, save, ...)" 3993msgstr "Suggeriments pels botons ràpids principals (obre, guarda, ...)" 3994 3995#: lazarusidestrconsts.dlgsrcedit 3996#, fuzzy 3997msgctxt "lazarusidestrconsts.dlgsrcedit" 3998msgid "Source Editor" 3999msgstr "Editor del codi font" 4000 4001#: lazarusidestrconsts.dlgsrorigin 4002msgid "Origin" 4003msgstr "Origen" 4004 4005#: lazarusidestrconsts.dlgstacksize 4006msgid "Stack size" 4007msgstr "" 4008 4009#: lazarusidestrconsts.dlgstatickeyword 4010#, fuzzy 4011#| msgid "Static Keyword in Objects" 4012msgid "Static keyword in objects" 4013msgstr "Paraula clau Static en els objectes" 4014 4015#: lazarusidestrconsts.dlgstopafternrerr 4016msgid "Stop after number of errors:" 4017msgstr "Atura després del nombre d'errors:" 4018 4019#: lazarusidestrconsts.dlgstringautoappend 4020msgid "Append text to close string" 4021msgstr "" 4022 4023#: lazarusidestrconsts.dlgstringautoprefix 4024msgid "Prefix string on new line" 4025msgstr "" 4026 4027#: lazarusidestrconsts.dlgstringbreakindenttab 4028msgid "String ''" 4029msgstr "" 4030 4031#: lazarusidestrconsts.dlgstringenableautocontinue 4032msgid "Extend strings on linebreak" 4033msgstr "" 4034 4035#: lazarusidestrconsts.dlgsubpropcolor 4036msgid "SubProperties" 4037msgstr "" 4038 4039#: lazarusidestrconsts.dlgsyntaxoptions 4040msgid "Syntax options" 4041msgstr "Opcions de la sintaxi" 4042 4043#: lazarusidestrconsts.dlgtabindent 4044msgid "Tab indents blocks" 4045msgstr "El tabulador sagna blocs" 4046 4047#: lazarusidestrconsts.dlgtabnumbersnotebook 4048msgid "Show tab numbers in notebook" 4049msgstr "" 4050 4051#: lazarusidestrconsts.dlgtabstospaces 4052msgid "Tabs to spaces" 4053msgstr "Tabuladors a espais" 4054 4055#: lazarusidestrconsts.dlgtabwidths 4056msgctxt "lazarusidestrconsts.dlgtabwidths" 4057msgid "Tab widths" 4058msgstr "" 4059 4060#: lazarusidestrconsts.dlgtargetcpufamily 4061msgid "Target CPU family" 4062msgstr "" 4063 4064#: lazarusidestrconsts.dlgtargetos 4065#, fuzzy 4066msgctxt "lazarusidestrconsts.dlgtargetos" 4067msgid "Target OS" 4068msgstr "SO de destinació" 4069 4070#: lazarusidestrconsts.dlgtargetplatform 4071msgid "Target platform" 4072msgstr "" 4073 4074#: lazarusidestrconsts.dlgtargetproc 4075msgid "Target processor" 4076msgstr "" 4077 4078#: lazarusidestrconsts.dlgtargetspecificoptions 4079msgid "Target-specific options" 4080msgstr "" 4081 4082#: lazarusidestrconsts.dlgtestprjdir 4083msgid "Directory for building test projects" 4084msgstr "Directori per a muntar els projectes de prova" 4085 4086#: lazarusidestrconsts.dlgtextstyle 4087msgid "Text-Style" 4088msgstr "" 4089 4090#: lazarusidestrconsts.dlgtexttofind 4091#, fuzzy 4092#| msgid "&Text to Find" 4093msgctxt "lazarusidestrconsts.dlgtexttofind" 4094msgid "&Text to find" 4095msgstr "Cerca el &text" 4096 4097#: lazarusidestrconsts.dlgthiselementusescolor 4098msgid "The element uses (and edits) the schemes:" 4099msgstr "" 4100 4101#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption 4102msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption" 4103msgid "Toggle as debug desktop" 4104msgstr "" 4105 4106#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint 4107msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint" 4108msgid "Toggle as debug desktop" 4109msgstr "" 4110 4111#: lazarusidestrconsts.dlgtopinfohint 4112msgid "Current Class/Proc Hint" 4113msgstr "" 4114 4115#: lazarusidestrconsts.dlgtrimspacetypecaption 4116msgid "Trim spaces style" 4117msgstr "" 4118 4119#: lazarusidestrconsts.dlgtrimspacetypecaretmove 4120msgid "Caret or Edit" 4121msgstr "" 4122 4123#: lazarusidestrconsts.dlgtrimspacetypeeditline 4124msgid "Line Edited" 4125msgstr "" 4126 4127#: lazarusidestrconsts.dlgtrimspacetypeleaveline 4128msgid "Leave line" 4129msgstr "" 4130 4131#: lazarusidestrconsts.dlgtrimspacetypeposonly 4132msgid "Position Only" 4133msgstr "" 4134 4135#: lazarusidestrconsts.dlgtrimtrailingspaces 4136msgid "Trim trailing spaces" 4137msgstr "Suprimeix els espais finals" 4138 4139#: lazarusidestrconsts.dlgundoaftersave 4140msgid "Undo after save" 4141msgstr "Desfés després de desar" 4142 4143#: lazarusidestrconsts.dlgundogroupoptions 4144msgid "Undo / Redo" 4145msgstr "" 4146 4147#: lazarusidestrconsts.dlgundolimit 4148msgid "Undo limit" 4149msgstr "" 4150 4151#: lazarusidestrconsts.dlgunitdepcaption 4152#, fuzzy 4153#| msgid "Unit dependencies" 4154msgctxt "lazarusidestrconsts.dlgunitdepcaption" 4155msgid "Unit Dependencies" 4156msgstr "Dependències de les unitats" 4157 4158#: lazarusidestrconsts.dlgunitdeprefresh 4159msgctxt "lazarusidestrconsts.dlgunitdeprefresh" 4160msgid "Refresh" 4161msgstr "Refresca" 4162 4163#: lazarusidestrconsts.dlgunitoutp 4164msgid "Unit output directory (-FU):" 4165msgstr "" 4166 4167#: lazarusidestrconsts.dlgunsavedlinecolor 4168msgid "Unsaved line" 4169msgstr "" 4170 4171#: lazarusidestrconsts.dlgusecodefolding 4172msgid "Code Folding" 4173msgstr "" 4174 4175#: lazarusidestrconsts.dlgusecustomconfig 4176msgid "Use additional compiler config file" 4177msgstr "" 4178 4179#: lazarusidestrconsts.dlgusedividerdraw 4180msgid "Divider Drawing" 4181msgstr "" 4182 4183#: lazarusidestrconsts.dlgusefpccfg 4184#, fuzzy 4185#| msgid "Use standard Compiler Config File (fpc.cfg)" 4186msgid "Use standard compiler config file (fpc.cfg)" 4187msgstr "Utilitza el fitxer de configuració normalitzat (fpc.cfg)" 4188 4189#: lazarusidestrconsts.dlgusehighlight 4190msgid "Use Highlight" 4191msgstr "" 4192 4193#: lazarusidestrconsts.dlguseiconsincompletionbox 4194msgid "Icons in code completion box" 4195msgstr "" 4196 4197#: lazarusidestrconsts.dlguselaunchingapp 4198msgid "Use launching application" 4199msgstr "Utilitza l'aplicació llançadora" 4200 4201#: lazarusidestrconsts.dlguseminimumime 4202msgid "IME handled by System" 4203msgstr "" 4204 4205#: lazarusidestrconsts.dlguserschemeerror 4206#, object-pascal-format 4207msgid "Failed to load user-scheme file %s" 4208msgstr "" 4209 4210#: lazarusidestrconsts.dlguseschemedefaults 4211msgid "- Scheme globals -" 4212msgstr "" 4213 4214#: lazarusidestrconsts.dlguseschemelocal 4215msgid "selected language" 4216msgstr "" 4217 4218#: lazarusidestrconsts.dlgusesyntaxhighlight 4219msgid "Use syntax highlight" 4220msgstr "Utilitza el ressaltat de sintaxi" 4221 4222#: lazarusidestrconsts.dlgusetabshistory 4223msgid "Use tab history when closing tabs" 4224msgstr "" 4225 4226#: lazarusidestrconsts.dlguseunitcaption 4227msgid "Add unit to Uses section" 4228msgstr "" 4229 4230#: lazarusidestrconsts.dlgvaluecolor 4231msgctxt "lazarusidestrconsts.dlgvaluecolor" 4232msgid "Value" 4233msgstr "Valor" 4234 4235#: lazarusidestrconsts.dlgverbosity 4236msgid "Verbosity during compilation:" 4237msgstr "Detall durant la compilació:" 4238 4239#: lazarusidestrconsts.dlgvisiblegutter 4240msgid "Visible gutter" 4241msgstr "Canal visible" 4242 4243#: lazarusidestrconsts.dlgvisiblerightmargin 4244msgid "Visible right margin" 4245msgstr "Marge dret visible" 4246 4247#: lazarusidestrconsts.dlgwholewordsonly 4248msgid "&Whole words only" 4249msgstr "" 4250 4251#: lazarusidestrconsts.dlgwidthpos 4252msgid "Width:" 4253msgstr "Ample" 4254 4255#: lazarusidestrconsts.dlgwin32guiapp 4256msgid "Win32 gui application" 4257msgstr "" 4258 4259#: lazarusidestrconsts.dlgwindow 4260msgctxt "lazarusidestrconsts.dlgwindow" 4261msgid "Window" 4262msgstr "Finestra" 4263 4264#: lazarusidestrconsts.dlgwordexceptions 4265msgid "Exceptions" 4266msgstr "" 4267 4268#: lazarusidestrconsts.dlgwordspolicies 4269msgctxt "lazarusidestrconsts.dlgwordspolicies" 4270msgid "Words" 4271msgstr "Paraules" 4272 4273#: lazarusidestrconsts.dlgwrdpreview 4274msgctxt "lazarusidestrconsts.dlgwrdpreview" 4275msgid "Preview" 4276msgstr "Visualització prèvia" 4277 4278#: lazarusidestrconsts.dlgwritefpclogo 4279#, fuzzy 4280#| msgid "Write an FPC logo" 4281msgid "Write FPC logo" 4282msgstr "Escriu un logotipus FPC" 4283 4284#: lazarusidestrconsts.fdinvalidmultiselectiontext 4285msgid "Multiselected components must be of a single form." 4286msgstr "Els components multi seleccionats han de ser d'una sola forma" 4287 4288#: lazarusidestrconsts.fdmalignmenu 4289msgid "Align ..." 4290msgstr "" 4291 4292#: lazarusidestrconsts.fdmdeleteselection 4293#, fuzzy 4294#| msgid "Delete selection" 4295msgid "Delete Selection" 4296msgstr "Elimina la selecció" 4297 4298#: lazarusidestrconsts.fdmmirrorhorizontal 4299#, fuzzy 4300#| msgid "Mirror horizontal" 4301msgid "Mirror Horizontal" 4302msgstr "Mirall horitzontal" 4303 4304#: lazarusidestrconsts.fdmmirrorvertical 4305#, fuzzy 4306#| msgid "Mirror vertical" 4307msgid "Mirror Vertical" 4308msgstr "Mirall vertical" 4309 4310#: lazarusidestrconsts.fdmorderbackone 4311#, fuzzy 4312#| msgid "Back one" 4313msgid "Back One" 4314msgstr "Enrere u" 4315 4316#: lazarusidestrconsts.fdmorderforwardone 4317#, fuzzy 4318#| msgid "Forward one" 4319msgid "Forward One" 4320msgstr "Endavant u" 4321 4322#: lazarusidestrconsts.fdmordermovetoback 4323#, fuzzy 4324#| msgid "Move to back" 4325msgid "Move to Back" 4326msgstr "Mou al fons" 4327 4328#: lazarusidestrconsts.fdmordermovetofront 4329#, fuzzy 4330#| msgid "Move to front" 4331msgid "Move to Front" 4332msgstr "Mou al front" 4333 4334#: lazarusidestrconsts.fdmresetmenu 4335msgid "Reset ..." 4336msgstr "" 4337 4338#: lazarusidestrconsts.fdmsaveformasxml 4339#, fuzzy 4340#| msgid "Save form as XML" 4341msgid "Save Form as XML" 4342msgstr "Desa forma com xml" 4343 4344#: lazarusidestrconsts.fdmscalemenu 4345msgid "Scale ..." 4346msgstr "" 4347 4348#: lazarusidestrconsts.fdmscaleword 4349msgid "Scale" 4350msgstr "Escala" 4351 4352#: lazarusidestrconsts.fdmselectall 4353msgctxt "lazarusidestrconsts.fdmselectall" 4354msgid "Select All" 4355msgstr "Selecciona-ho tot" 4356 4357#: lazarusidestrconsts.fdmsizemenu 4358msgid "Size ..." 4359msgstr "" 4360 4361#: lazarusidestrconsts.fdmsizeword 4362msgid "Size" 4363msgstr "Tamany" 4364 4365#: lazarusidestrconsts.fdmsnaptogridoption 4366msgid "Option: Snap to grid" 4367msgstr "Opció: Desplaça a graella" 4368 4369#: lazarusidestrconsts.fdmsnaptoguidelinesoption 4370msgid "Option: Snap to guide lines" 4371msgstr "Opció: Desplaça a línies de la guia" 4372 4373#: lazarusidestrconsts.fdmzorder 4374msgid "Z-order" 4375msgstr "" 4376 4377#: lazarusidestrconsts.gldhighlightbothsidesofcursor 4378msgid "On Both Sides" 4379msgstr "" 4380 4381#: lazarusidestrconsts.histdlgbtnclearhint 4382msgid "Clear all snapshots" 4383msgstr "" 4384 4385#: lazarusidestrconsts.histdlgbtnenablehint 4386msgid "Toggle view snapshot or current" 4387msgstr "" 4388 4389#: lazarusidestrconsts.histdlgbtnmakesnaphint 4390msgid "Take Snapshot" 4391msgstr "" 4392 4393#: lazarusidestrconsts.histdlgbtnpowerhint 4394msgid "Switch on/off automatic snapshots" 4395msgstr "" 4396 4397#: lazarusidestrconsts.histdlgbtnremovehint 4398msgid "Remove selected entry" 4399msgstr "" 4400 4401#: lazarusidestrconsts.histdlgbtnshowhisthint 4402msgid "View history" 4403msgstr "" 4404 4405#: lazarusidestrconsts.histdlgbtnshowsnaphint 4406msgid "View Snapshots" 4407msgstr "" 4408 4409#: lazarusidestrconsts.histdlgcolumnloc 4410msgctxt "lazarusidestrconsts.histdlgcolumnloc" 4411msgid "Location" 4412msgstr "" 4413 4414#: lazarusidestrconsts.histdlgcolumntime 4415msgid "Time" 4416msgstr "" 4417 4418#: lazarusidestrconsts.histdlgformname 4419msgctxt "lazarusidestrconsts.histdlgformname" 4420msgid "History" 4421msgstr "" 4422 4423#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi 4424msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." 4425msgstr "" 4426 4427#: lazarusidestrconsts.lisa2paddfiles 4428msgid "Add Files" 4429msgstr "Afegeix els fitxers" 4430 4431#: lazarusidestrconsts.lisa2pambiguousancestortype 4432msgid "Ambiguous Ancestor Type" 4433msgstr "" 4434 4435#: lazarusidestrconsts.lisa2pambiguousclassname 4436msgid "Ambiguous Class Name" 4437msgstr "Nom de classe ambigu" 4438 4439#: lazarusidestrconsts.lisa2pambiguousunitname 4440msgid "Ambiguous Unit Name" 4441msgstr "Nom d'unitat ambigu" 4442 4443#: lazarusidestrconsts.lisa2pancestortype 4444#, fuzzy 4445#| msgid "Ancestor Type" 4446msgid "Ancestor type" 4447msgstr "Tipus d'avantpassat" 4448 4449#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas 4450#, fuzzy 4451#| msgid "A pascal unit must have the extension .pp or .pas" 4452msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" 4453msgid "A Pascal unit must have the extension .pp or .pas" 4454msgstr "Una unitat Pascal ha de tenir l'extensió .pp o .pas" 4455 4456#: lazarusidestrconsts.lisa2pbrokendependencies 4457msgid "Broken Dependencies" 4458msgstr "Dependències Interrompudes" 4459 4460#: lazarusidestrconsts.lisa2pclassnamealreadyexists 4461msgid "Class Name already exists" 4462msgstr "Ja existeix el nom de la classe" 4463 4464#: lazarusidestrconsts.lisa2pcreatenewcomp 4465msgid "Create New Component" 4466msgstr "" 4467 4468#: lazarusidestrconsts.lisa2pcreatenewfile 4469#, fuzzy 4470#| msgid "Create new file" 4471msgid "Create New File" 4472msgstr "Crea nou arxiu" 4473 4474#: lazarusidestrconsts.lisa2pcreatenewreq 4475msgid "Create New Requirement" 4476msgstr "" 4477 4478#: lazarusidestrconsts.lisa2pdependency 4479msgid "Dependency" 4480msgstr "Dependència" 4481 4482#: lazarusidestrconsts.lisa2pdirectoryforunitfile 4483msgid "Directory for unit file:" 4484msgstr "" 4485 4486#: lazarusidestrconsts.lisa2pexistingfile2 4487#, object-pascal-format 4488msgid "Existing file: \"%s\"" 4489msgstr "" 4490 4491#: lazarusidestrconsts.lisa2pfilealreadyexists 4492msgid "File already exists" 4493msgstr "Ja existeix el fitxer" 4494 4495#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage 4496#, object-pascal-format 4497msgid "File \"%s\" already exists in the package." 4498msgstr "" 4499 4500#: lazarusidestrconsts.lisa2pfileisused 4501msgid "File is used" 4502msgstr "El fitxer està essent utilitzat" 4503 4504#: lazarusidestrconsts.lisa2pfilename2 4505#, fuzzy 4506#| msgid "Filename" 4507msgid "Filename/URL" 4508msgstr "Nom del fitxer" 4509 4510#: lazarusidestrconsts.lisa2pfilenotunit 4511msgid "File not unit" 4512msgstr "El fitxer no és una unitat" 4513 4514#: lazarusidestrconsts.lisa2picon24x24 4515msgid "Icon 24x24:" 4516msgstr "" 4517 4518#: lazarusidestrconsts.lisa2picon36x36 4519msgid "Icon 36x36:" 4520msgstr "" 4521 4522#: lazarusidestrconsts.lisa2picon48x48 4523msgid "Icon 48x48:" 4524msgstr "" 4525 4526#: lazarusidestrconsts.lisa2pinvalidancestortype 4527msgid "Invalid Ancestor Type" 4528msgstr "El tipus d'avantpassat no és vàlid" 4529 4530#: lazarusidestrconsts.lisa2pinvalidcirculardependency 4531msgid "Invalid Circular Dependency" 4532msgstr "" 4533 4534#: lazarusidestrconsts.lisa2pinvalidclassname 4535msgid "Invalid Class Name" 4536msgstr "El nom de la classe no és vàlid" 4537 4538#: lazarusidestrconsts.lisa2pinvalidfile 4539msgid "Invalid file" 4540msgstr "El fitxer no és vàlid" 4541 4542#: lazarusidestrconsts.lisa2pinvalidfilename 4543msgid "Invalid filename" 4544msgstr "El nom del fitxer no és vàlid" 4545 4546#: lazarusidestrconsts.lisa2pinvalidunitname 4547msgid "Invalid Unit Name" 4548msgstr "El nom de la unitat no és vàlid" 4549 4550#: lazarusidestrconsts.lisa2pisnotavalidunitname 4551#, object-pascal-format, fuzzy, badformat 4552#| msgid "%s%s%s is not a valid unit name." 4553msgid "\"%s\" is not a valid unit name." 4554msgstr "%s%s%s no és un nom d'unitat vàlid" 4555 4556#: lazarusidestrconsts.lisa2pnewclassname 4557msgid "New class name:" 4558msgstr "Nou nom de classe:" 4559 4560#: lazarusidestrconsts.lisa2pnewfile 4561msgid "New File" 4562msgstr "Nou Arxiu" 4563 4564#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting 4565#, object-pascal-format, fuzzy, badformat 4566#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." 4567msgid "No package found for dependency \"%s\".%sPlease choose an existing package." 4568msgstr "No s'ha trobat cap paquet per la dependència %s%s%s.%sSi us plau, escolliu un paquet existent." 4569 4570#: lazarusidestrconsts.lisa2ppackageorproject 4571msgid "Package/Project" 4572msgstr "" 4573 4574#: lazarusidestrconsts.lisa2ppagenametoolong 4575msgid "Page Name too long" 4576msgstr "El nom del paquet és massa llarg" 4577 4578#: lazarusidestrconsts.lisa2ppalettepage 4579#, fuzzy 4580#| msgid "Palette Page:" 4581msgid "Palette page:" 4582msgstr "Pàgina de paleta:" 4583 4584#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas 4585msgid "Pascal units must have the extension .pp or .pas" 4586msgstr "Les unitats pascal han de tenir l'extensió .pp o .pas" 4587 4588#: lazarusidestrconsts.lisa2pshortenorexpandfilename 4589msgid "Shorten or expand filename" 4590msgstr "Acurta o allarga nom d'arxiu" 4591 4592#: lazarusidestrconsts.lisa2pshowall 4593msgctxt "lazarusidestrconsts.lisa2pshowall" 4594msgid "Show all" 4595msgstr "Mostra-ho tot" 4596 4597#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit 4598#, object-pascal-format, fuzzy, badformat 4599#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." 4600msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." 4601msgstr "El tipus avantpassat %s%s%s té el mateix nom que%s la unitat %s%s%s." 4602 4603#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier 4604#, object-pascal-format, fuzzy, badformat 4605#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier." 4606msgid "The ancestor type \"%s\" is not a valid Pascal identifier." 4607msgstr "El tipus avantpassat %s%s%s no és un identificador pascal vàlid." 4608 4609#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame 4610#, object-pascal-format, fuzzy, badformat 4611#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same." 4612msgid "The class name \"%s\" and ancestor type \"%s\" are the same." 4613msgstr "El nom de classe %s%s%s i tipus avantpassat %s%s%s son el mateix." 4614 4615#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile 4616#, object-pascal-format, fuzzy, badformat 4617#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" 4618msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" 4619msgstr "El nom de classe %s%s%s ja existeix en%s el paquet %s%sFitxer: %s%s%s" 4620 4621#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit 4622#, object-pascal-format, fuzzy, badformat 4623#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." 4624msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." 4625msgstr "El nom de classe %s%s%s té el mateix nom que%s la unitat %s%s%s." 4626 4627#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier 4628#, object-pascal-format, fuzzy, badformat 4629#| msgid "The class name %s%s%s is not a valid Pascal identifier." 4630msgid "The class name \"%s\" is not a valid Pascal identifier." 4631msgstr "El nom de classe %s%s%s no és un identificador pascal vàlid." 4632 4633#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea 4634#, object-pascal-format, fuzzy, badformat 4635#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." 4636msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." 4637msgstr "El fitxer %s%s%s és part del projecte actual.%sÉs una mala idea compartir fitxers entre projectes i paquets." 4638 4639#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename 4640#, object-pascal-format 4641msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path." 4642msgstr "" 4643 4644#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor 4645#, object-pascal-format, fuzzy, badformat 4646msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" 4647msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4648msgstr "La versió màxima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" 4649 4650#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion 4651#, fuzzy 4652msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" 4653msgid "The Maximum Version is lower than the Minimim Version." 4654msgstr "La versió màxima és menor que la versió mínima" 4655 4656#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor 4657#, object-pascal-format, fuzzy, badformat 4658msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" 4659msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4660msgstr "La versió mínima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" 4661 4662#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe 4663#, object-pascal-format, fuzzy, badformat 4664#| msgid "The package already has a dependency on the package %s%s%s." 4665msgid "The package already has a dependency on the package \"%s\"." 4666msgstr "El paquet ja té una dependència pel paquet %s%s%s." 4667 4668#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars 4669#, object-pascal-format, fuzzy, badformat 4670#| msgid "The page name %s%s%s is too long (max 100 chars)." 4671msgid "The page name \"%s\" is too long (max 100 chars)." 4672msgstr "El nom de pàgina %s%s%s és massa llarg (max 100 car.)" 4673 4674#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage 4675#, object-pascal-format, fuzzy, badformat 4676#| msgid "The unitname %s%s%s already exists in the package:%s%s" 4677msgid "The unitname \"%s\" already exists in the package:%s%s" 4678msgstr "El nom d'unitat %s%s%s ja existeix en el paquet:%s%s" 4679 4680#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage 4681#, object-pascal-format, fuzzy, badformat 4682#| msgid "The unitname %s%s%s already exists in this package." 4683msgid "The unitname \"%s\" already exists in this package." 4684msgstr "El nom d'unitat %s%s%s ja existeix en aquest paquet." 4685 4686#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer 4687#, object-pascal-format 4688msgid "The unit name \"%s\"%sand filename \"%s\" differ." 4689msgstr "" 4690 4691#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent 4692#, object-pascal-format, fuzzy, badformat 4693#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages." 4694msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." 4695msgstr "El nom d'unitat %s%s%s és el mateix que el d'un component registrat.%sUtilitzar-lo pot causar missatges d'error estranys." 4696 4697#: lazarusidestrconsts.lisa2punitname 4698#, fuzzy 4699#| msgid "Unit Name:" 4700msgid "Unit name:" 4701msgstr "Nom de la unitat:" 4702 4703#: lazarusidestrconsts.lisa2punitnamealreadyexists 4704msgid "Unitname already exists" 4705msgstr "Ja existeix el nom de la unitat" 4706 4707#: lazarusidestrconsts.lisabandonchanges 4708msgid "Abandon changes?" 4709msgstr "" 4710 4711#: lazarusidestrconsts.lisabort 4712#, fuzzy 4713msgctxt "lazarusidestrconsts.lisabort" 4714msgid "Abort" 4715msgstr "Avortar" 4716 4717#: lazarusidestrconsts.lisabortall 4718msgid "Abort all" 4719msgstr "Avortar tot" 4720 4721#: lazarusidestrconsts.lisabortallloading 4722msgid "Abort all loading" 4723msgstr "Avorta totes les càrregues" 4724 4725#: lazarusidestrconsts.lisaborted 4726msgid "Aborted" 4727msgstr "" 4728 4729#: lazarusidestrconsts.lisabortloadingproject 4730msgid "Abort loading project" 4731msgstr "Avorta carrega del projecte" 4732 4733#: lazarusidestrconsts.lisabortwholeloading 4734msgid "Abort whole loading" 4735msgstr "" 4736 4737#: lazarusidestrconsts.lisabout 4738#, fuzzy 4739msgctxt "lazarusidestrconsts.lisabout" 4740msgid "About" 4741msgstr "Quant a" 4742 4743#: lazarusidestrconsts.lisabout2 4744#, object-pascal-format 4745msgid "About %s" 4746msgstr "" 4747 4748#: lazarusidestrconsts.lisaboutdocumentation 4749msgid "Documentation:" 4750msgstr "" 4751 4752#: lazarusidestrconsts.lisaboutide 4753msgid "About IDE" 4754msgstr "" 4755 4756#: lazarusidestrconsts.lisaboutlazarus 4757msgid "About Lazarus" 4758msgstr "Quant al Lazarus" 4759 4760#: lazarusidestrconsts.lisaboutlazarusmsg 4761#, object-pascal-format 4762msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers." 4763msgstr "" 4764 4765#: lazarusidestrconsts.lisaboutnocontributors 4766msgid "Cannot find contributors list." 4767msgstr "" 4768 4769#: lazarusidestrconsts.lisaboutofficial 4770msgid "Official:" 4771msgstr "" 4772 4773#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen 4774#, object-pascal-format, fuzzy 4775#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it." 4776msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it." 4777msgstr "Un %s no pot manegar TControls. %sNomés hi podeu posar components no visuals." 4778 4779#: lazarusidestrconsts.lisacknowledgements 4780msgid "Acknowledgements" 4781msgstr "" 4782 4783#: lazarusidestrconsts.lisaction 4784msgid "Action:" 4785msgstr "" 4786 4787#: lazarusidestrconsts.lisactions 4788msgid "Actions:" 4789msgstr "" 4790 4791#: lazarusidestrconsts.lisactivate 4792msgid "Activate" 4793msgstr "" 4794 4795#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme 4796msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" 4797msgstr "Activa sintaxi d'expressións regulars pel texte i reemplaçament (més similar a perl)" 4798 4799#: lazarusidestrconsts.lisactivateselected 4800msgid "Activate Selected" 4801msgstr "" 4802 4803#: lazarusidestrconsts.lisactive 4804msgid "Active" 4805msgstr "" 4806 4807#: lazarusidestrconsts.lisactivefilter 4808msgid "Active Filter" 4809msgstr "" 4810 4811#: lazarusidestrconsts.lisadd 4812msgctxt "lazarusidestrconsts.lisadd" 4813msgid "Add" 4814msgstr "Afegeix" 4815 4816#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem 4817msgid "Add a new separator above selected item" 4818msgstr "" 4819 4820#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem 4821msgid "Add a new separator below selected item" 4822msgstr "" 4823 4824#: lazarusidestrconsts.lisadddelphidefine 4825msgid "Add defines simulating Delphi7" 4826msgstr "" 4827 4828#: lazarusidestrconsts.lisadddelphidefinehint 4829msgid "Useful when the code has checks for supported compiler versions" 4830msgstr "" 4831 4832#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource 4833#, object-pascal-format 4834msgid "Added missing object \"%s\" to pascal source." 4835msgstr "" 4836 4837#: lazarusidestrconsts.lisaddedpropertysfors 4838#, object-pascal-format 4839msgid "Added property \"%s\" for %s." 4840msgstr "" 4841 4842#: lazarusidestrconsts.lisaddfcutf8 4843msgid "Add -FcUTF8" 4844msgstr "" 4845 4846#: lazarusidestrconsts.lisaddfcutf8hint 4847msgid "May be needed if source files have non-ansistring literals." 4848msgstr "" 4849 4850#: lazarusidestrconsts.lisaddfilter 4851msgid "Add Filter ..." 4852msgstr "" 4853 4854#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage 4855msgid "Addition does not fit the current message" 4856msgstr "" 4857 4858#: lazarusidestrconsts.lisadditionfitsthecurrentmessage 4859msgid "Addition fits the current message" 4860msgstr "" 4861 4862#: lazarusidestrconsts.lisadditions 4863msgid "Additions" 4864msgstr "" 4865 4866#: lazarusidestrconsts.lisaddkeyworddo 4867msgid "Add keyword \"do\"" 4868msgstr "" 4869 4870#: lazarusidestrconsts.lisaddmodifieroverload 4871msgid "Add modifier \"overload\"" 4872msgstr "" 4873 4874#: lazarusidestrconsts.lisaddmodifieroverride 4875msgid "Add modifier \"override\"" 4876msgstr "" 4877 4878#: lazarusidestrconsts.lisaddmodifierreintroduce 4879msgid "Add modifier \"reintroduce\"" 4880msgstr "" 4881 4882#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom 4883#, object-pascal-format 4884msgid "Add new build mode, copying settings from \"%s\"" 4885msgstr "" 4886 4887#: lazarusidestrconsts.lisaddnewmacro 4888msgid "Add new macro" 4889msgstr "" 4890 4891#: lazarusidestrconsts.lisaddnewset 4892msgid "Add new set" 4893msgstr "" 4894 4895#: lazarusidestrconsts.lisaddpackagerequirement 4896msgid "Add package requirement?" 4897msgstr "" 4898 4899#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui 4900msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)." 4901msgstr "" 4902 4903#: lazarusidestrconsts.lisaddpackagetoproject2 4904msgid "Add package to project" 4905msgstr "" 4906 4907#: lazarusidestrconsts.lisaddparameterbrackets 4908msgid "Add parameter brackets" 4909msgstr "" 4910 4911#: lazarusidestrconsts.lisaddress 4912msgid "Address:" 4913msgstr "" 4914 4915#: lazarusidestrconsts.lisaddressbreakpoint 4916msgctxt "lazarusidestrconsts.lisaddressbreakpoint" 4917msgid "&Address Breakpoint ..." 4918msgstr "" 4919 4920#: lazarusidestrconsts.lisaddtoincludesearchpath 4921msgid "Add to include search path?" 4922msgstr "" 4923 4924#: lazarusidestrconsts.lisaddtoproject 4925#, object-pascal-format 4926msgid "Add %s to project?" 4927msgstr "Voleu afegir %s al projecte?" 4928 4929#: lazarusidestrconsts.lisaddtostartupcomponents 4930msgid "Add to startup components?" 4931msgstr "" 4932 4933#: lazarusidestrconsts.lisaddtounitsearchpath 4934msgid "Add to unit search path?" 4935msgstr "" 4936 4937#: lazarusidestrconsts.lisaddunitinterfaces 4938msgid "Add unit interfaces" 4939msgstr "" 4940 4941#: lazarusidestrconsts.lisaddunitnotrecommended 4942msgid "Add unit (not recommended)" 4943msgstr "" 4944 4945#: lazarusidestrconsts.lisaddvaluetomacro 4946#, object-pascal-format 4947msgid "Add value to macro %s" 4948msgstr "" 4949 4950#: lazarusidestrconsts.lisaf2paddfiletoapackage 4951#, fuzzy 4952#| msgid "Add file to a package" 4953msgid "Add File to Package" 4954msgstr "Afegeix el fitxer a un paquet" 4955 4956#: lazarusidestrconsts.lisaf2pdestinationpackage 4957#, fuzzy 4958#| msgid "Destination Package" 4959msgid "Destination package" 4960msgstr "Paquet de destinació" 4961 4962#: lazarusidestrconsts.lisaf2pfiletype 4963#, fuzzy 4964#| msgid "File Type" 4965msgid "File type" 4966msgstr "Tipus de fitxer" 4967 4968#: lazarusidestrconsts.lisaf2pinvalidpackage 4969msgid "Invalid Package" 4970msgstr "El paquet no és vàlid" 4971 4972#: lazarusidestrconsts.lisaf2pinvalidpackageid 4973#, object-pascal-format, fuzzy, badformat 4974#| msgid "Invalid package ID: %s%s%s" 4975msgid "Invalid package ID: \"%s\"" 4976msgstr "L'ID del paquet no és vàlida: %s%s%s" 4977 4978#: lazarusidestrconsts.lisaf2ppackageisreadonly 4979msgid "Package is read only" 4980msgstr "El paquet només és de lectura" 4981 4982#: lazarusidestrconsts.lisaf2ppackagenotfound 4983#, object-pascal-format, fuzzy, badformat 4984#| msgid "Package %s%s%s not found." 4985msgid "Package \"%s\" not found." 4986msgstr "No s'ha trobat el paquet %s%s%s." 4987 4988#: lazarusidestrconsts.lisaf2pshowall 4989#, fuzzy 4990#| msgid "Show All" 4991msgctxt "lazarusidestrconsts.lisaf2pshowall" 4992msgid "Show all" 4993msgstr "Mostra-ho tot" 4994 4995#: lazarusidestrconsts.lisaf2pthepackageisreadonly 4996#, object-pascal-format 4997msgid "The package %s is read only." 4998msgstr "El paquet %s és de només lectura." 4999 5000#: lazarusidestrconsts.lisafilealreadyexistsreplaceit 5001#, object-pascal-format, fuzzy, badformat 5002#| msgid "A file %s%s%s already exists.%sReplace it?" 5003msgid "A file \"%s\" already exists.%sReplace it?" 5004msgstr "Ja existeix un fitxer %s%s%s. %sVoleu que el substitueixi?" 5005 5006#: lazarusidestrconsts.lisafilterwiththenamealreadyexists 5007#, object-pascal-format 5008msgid "A filter with the name \"%s\" already exists." 5009msgstr "" 5010 5011#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean 5012msgid "After cleaning up (clean all or clean common files), switch to clean automatically" 5013msgstr "" 5014 5015#: lazarusidestrconsts.lisalignment 5016msgid "Alignment" 5017msgstr "Alineació" 5018 5019#: lazarusidestrconsts.lisallblockslooksok 5020#, fuzzy 5021#| msgid "All blocks looks ok." 5022msgid "All blocks look ok." 5023msgstr "Tots els blocs semblen correctes." 5024 5025#: lazarusidestrconsts.lisallbuildmodes 5026msgid "<All build modes>" 5027msgstr "" 5028 5029#: lazarusidestrconsts.lisallinheritedoptions 5030msgid "All inherited options" 5031msgstr "" 5032 5033#: lazarusidestrconsts.lisalloptions 5034msgid "All Options" 5035msgstr "" 5036 5037#: lazarusidestrconsts.lisallowfunctio 5038msgid "Allow Function Calls" 5039msgstr "" 5040 5041#: lazarusidestrconsts.lisallowsearchingformultiplelines 5042msgid "Allow searching for multiple lines" 5043msgstr "Permet la recerca per múltiples línies" 5044 5045#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall 5046msgid "All parameters of this function are already set at this call. Nothing to add." 5047msgstr "" 5048 5049#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened 5050#, object-pascal-format 5051msgid "All your modifications to \"%s\"%swill be lost and the file reopened." 5052msgstr "" 5053 5054#: lazarusidestrconsts.lisalpha 5055msgid "Alpha" 5056msgstr "" 5057 5058#: lazarusidestrconsts.lisalternativekey 5059msgid "Alternative key" 5060msgstr "" 5061 5062#: lazarusidestrconsts.lisalternativekeyor2keysequence 5063msgid "Alternative key (or 2 key sequence)" 5064msgstr "" 5065 5066#: lazarusidestrconsts.lisalways 5067msgid "Always" 5068msgstr "" 5069 5070#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase 5071msgid "Always convert suggested default file name to lowercase" 5072msgstr "" 5073 5074#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused 5075msgid "Always draw selected items focused" 5076msgstr "" 5077 5078#: lazarusidestrconsts.lisalwaysignore 5079msgid "Always ignore" 5080msgstr "" 5081 5082#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists 5083msgid "A macro with this name already exists." 5084msgstr "" 5085 5086#: lazarusidestrconsts.lisambiguousfilefound 5087msgid "Ambiguous file found" 5088msgstr "" 5089 5090#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete 5091#, object-pascal-format 5092msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" 5093msgstr "" 5094 5095#: lazarusidestrconsts.lisambiguousfilesfound 5096msgid "Ambiguous files found" 5097msgstr "" 5098 5099#: lazarusidestrconsts.lisambiguousunitfound 5100msgid "Ambiguous unit found" 5101msgstr "" 5102 5103#: lazarusidestrconsts.lisanchorbottomtobottomside 5104msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5105msgstr "" 5106 5107#: lazarusidestrconsts.lisanchorbottomtotopside 5108msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5109msgstr "" 5110 5111#: lazarusidestrconsts.lisanchoreditornocontrolselected 5112msgid "Anchor Editor - no control selected" 5113msgstr "" 5114 5115#: lazarusidestrconsts.lisanchorenabledhint 5116#, object-pascal-format 5117msgid "Enabled = Include %s in Anchors" 5118msgstr "" 5119 5120#: lazarusidestrconsts.lisanchorlefttoleftside 5121msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5122msgstr "" 5123 5124#: lazarusidestrconsts.lisanchorlefttorightside 5125msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5126msgstr "" 5127 5128#: lazarusidestrconsts.lisanchorrighttoleftside 5129msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5130msgstr "" 5131 5132#: lazarusidestrconsts.lisanchorrighttorightside 5133msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5134msgstr "" 5135 5136#: lazarusidestrconsts.lisanchorsof 5137#, object-pascal-format 5138msgid "Anchors of %s" 5139msgstr "" 5140 5141#: lazarusidestrconsts.lisanchorsofselectedcontrols 5142msgid "Anchors of selected controls" 5143msgstr "" 5144 5145#: lazarusidestrconsts.lisanchortoptobottomside 5146msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5147msgstr "" 5148 5149#: lazarusidestrconsts.lisanchortoptotopside 5150msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5151msgstr "" 5152 5153#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro 5154#, object-pascal-format, fuzzy, badformat 5155#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" 5156msgid "An error occurred at last startup while loading %s!%sLoad this project again?" 5157msgstr "Va ocorrer un error durant l'ultima execució mentre s'hi carregava %s!%s%sCarregar aquest projecte de nou?" 5158 5159#: lazarusidestrconsts.lisappearance 5160msgid "Appearance" 5161msgstr "" 5162 5163#: lazarusidestrconsts.lisapplicationclassname 5164msgid "&Application class name" 5165msgstr "" 5166 5167#: lazarusidestrconsts.lisapplicationprogramdescriptor 5168msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI." 5169msgstr "" 5170 5171#: lazarusidestrconsts.lisapply 5172msgctxt "lazarusidestrconsts.lisapply" 5173msgid "Apply" 5174msgstr "Aplica" 5175 5176#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo 5177msgid "apply build flags (-B) to dependencies too" 5178msgstr "" 5179 5180#: lazarusidestrconsts.lisapplyconventions 5181msgid "Apply conventions" 5182msgstr "" 5183 5184#: lazarusidestrconsts.lisapplyconventionshint 5185msgid "Adjust name extension and character case for platform and file type." 5186msgstr "" 5187 5188#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects 5189msgid "A project unit can not be used by other packages/projects" 5190msgstr "" 5191 5192#: lazarusidestrconsts.lisaroundborderspacehint 5193msgid "Borderspace around the control. The other four borderspaces are added to this value." 5194msgstr "" 5195 5196#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext 5197msgid "Ask before replacing each found text" 5198msgstr "Demana abans de reemplaçar cada text trobat" 5199 5200#: lazarusidestrconsts.lisaskbeforesavingprojectssession 5201msgid "Ask before saving project's session" 5202msgstr "" 5203 5204#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform 5205msgid "Ask for component name after putting it on a designer form." 5206msgstr "" 5207 5208#: lazarusidestrconsts.lisaskforfilenameonnewfile 5209msgid "Ask for file name on new file" 5210msgstr "" 5211 5212#: lazarusidestrconsts.lisasknameoncreate 5213msgid "Ask name on create" 5214msgstr "" 5215 5216#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin 5217msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe" 5218msgstr "" 5219 5220#: lazarusidestrconsts.lisautoadjustideheight 5221msgid "Automatically adjust IDE main window height" 5222msgstr "" 5223 5224#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette 5225msgid "Show complete component palette" 5226msgstr "" 5227 5228#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint 5229msgid "If component palette spans over more lines, show them all and not only one." 5230msgstr "" 5231 5232#: lazarusidestrconsts.lisautocompletionoff 5233msgid "Auto completion: off" 5234msgstr "" 5235 5236#: lazarusidestrconsts.lisautocompletionon 5237msgid "Auto completion: on" 5238msgstr "" 5239 5240#: lazarusidestrconsts.lisautocontinueafter 5241msgid "Auto continue after:" 5242msgstr "" 5243 5244#: lazarusidestrconsts.lisautomarkup 5245msgid "Markup and Matches" 5246msgstr "" 5247 5248#: lazarusidestrconsts.lisautomatic 5249msgctxt "lazarusidestrconsts.lisautomatic" 5250msgid "Automatic" 5251msgstr "" 5252 5253#: lazarusidestrconsts.lisautomatically 5254msgid "Automatically" 5255msgstr "" 5256 5257#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs 5258msgid "Automatically convert .lfm files to .lrs resource files" 5259msgstr "" 5260 5261#: lazarusidestrconsts.lisautomaticallyignoreforselection 5262msgid "do not complete selection" 5263msgstr "" 5264 5265#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint 5266msgid "Automatically invoke after point" 5267msgstr "" 5268 5269#: lazarusidestrconsts.lisautomaticallyinvokeontype 5270msgid "Automatically invoke on typing" 5271msgstr "" 5272 5273#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength 5274msgid "Only complete if word is longer or equal" 5275msgstr "" 5276 5277#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend 5278msgid "Only complete when at end of word" 5279msgstr "" 5280 5281#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer 5282msgid "Use completion box delay" 5283msgstr "" 5284 5285#: lazarusidestrconsts.lisautomaticallyonlinebreak 5286msgid "line break" 5287msgstr "" 5288 5289#: lazarusidestrconsts.lisautomaticallyonspace 5290msgid "space" 5291msgstr "" 5292 5293#: lazarusidestrconsts.lisautomaticallyontab 5294msgid "tab" 5295msgstr "" 5296 5297#: lazarusidestrconsts.lisautomaticallyonwordend 5298msgid "word end" 5299msgstr "" 5300 5301#: lazarusidestrconsts.lisautomaticallyremovecharacter 5302msgid "do not add character" 5303msgstr "" 5304 5305#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident 5306msgid "Automatically use single possible identifier" 5307msgstr "" 5308 5309#: lazarusidestrconsts.lisautomaticfeatures 5310msgid "Completion and Hints" 5311msgstr "" 5312 5313#: lazarusidestrconsts.lisautoshowobjectinspector 5314msgid "Auto show" 5315msgstr "" 5316 5317#: lazarusidestrconsts.lisavailableforinstallation 5318msgid "Available for installation" 5319msgstr "" 5320 5321#: lazarusidestrconsts.lisavailableprojectbuildmodes 5322msgid "Available project build modes:" 5323msgstr "" 5324 5325#: lazarusidestrconsts.lisbackupchangedfiles 5326msgid "Make backup of changed files" 5327msgstr "" 5328 5329#: lazarusidestrconsts.lisbackupfilefailed 5330msgid "Backup file failed" 5331msgstr "Ha fallat la còpia de seguretat" 5332 5333#: lazarusidestrconsts.lisbackuphint 5334msgid "Creates a Backup directory under project directory" 5335msgstr "" 5336 5337#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies 5338#, object-pascal-format 5339msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." 5340msgstr "Canviar el nom del paquet o versió, trenca les dependències. Voleu canviar aquestes dependències també?%sSeleccioneu Si per canviar totes les dependències llistades.%sSeleccioneu - Ignora - per trencar les dependències i continuar." 5341 5342#: lazarusidestrconsts.lisbegins 5343msgid "begins" 5344msgstr "" 5345 5346#: lazarusidestrconsts.lisbehindrelated 5347msgid "Behind related" 5348msgstr "" 5349 5350#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes 5351msgid "be less verbose, can be given multiple times" 5352msgstr "" 5353 5354#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes 5355msgid "be more verbose, can be given multiple times" 5356msgstr "" 5357 5358#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip 5359msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" 5360msgstr "" 5361 5362#: lazarusidestrconsts.lisbfalwaysbuildbeforerun 5363msgid "Always build before run" 5364msgstr "" 5365 5366#: lazarusidestrconsts.lisbfbuildcommand 5367msgid "Build Command" 5368msgstr "" 5369 5370#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead 5371msgid "On build project execute the Build File command instead" 5372msgstr "" 5373 5374#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead 5375msgid "On run project execute the Run File command instead" 5376msgstr "" 5377 5378#: lazarusidestrconsts.lisbfruncommand 5379msgid "Run Command" 5380msgstr "" 5381 5382#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor 5383msgid "When this file is active in source editor" 5384msgstr "" 5385 5386#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath 5387msgid "Working directory (leave empty for file path)" 5388msgstr "" 5389 5390#: lazarusidestrconsts.lisbinary 5391#, fuzzy 5392msgctxt "lazarusidestrconsts.lisbinary" 5393msgid "Binary" 5394msgstr "Binari" 5395 5396#: lazarusidestrconsts.lisboldnondefaultobjectinspector 5397msgid "Bold non default values" 5398msgstr "" 5399 5400#: lazarusidestrconsts.lisborderspace 5401msgid "Border space" 5402msgstr "" 5403 5404#: lazarusidestrconsts.lisbottom 5405msgctxt "lazarusidestrconsts.lisbottom" 5406msgid "Bottom" 5407msgstr "" 5408 5409#: lazarusidestrconsts.lisbottomborderspacespinedithint 5410msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." 5411msgstr "" 5412 5413#: lazarusidestrconsts.lisbottomgroupboxcaption 5414msgid "Bottom anchoring" 5415msgstr "" 5416 5417#: lazarusidestrconsts.lisbottoms 5418msgid "Bottoms" 5419msgstr "Inferiors" 5420 5421#: lazarusidestrconsts.lisbottomsiblingcomboboxhint 5422msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 5423msgstr "" 5424 5425#: lazarusidestrconsts.lisbottomspaceequally 5426msgid "Bottom space equally" 5427msgstr "Iguala els espais inferiors" 5428 5429#: lazarusidestrconsts.lisbpsdisabled 5430msgctxt "lazarusidestrconsts.lisbpsdisabled" 5431msgid "Disabled" 5432msgstr "" 5433 5434#: lazarusidestrconsts.lisbpsenabled 5435msgctxt "lazarusidestrconsts.lisbpsenabled" 5436msgid "Enabled" 5437msgstr "" 5438 5439#: lazarusidestrconsts.lisbreak 5440msgctxt "lazarusidestrconsts.lisbreak" 5441msgid "Break" 5442msgstr "" 5443 5444#: lazarusidestrconsts.lisbreakpointproperties 5445msgid "Breakpoint Properties" 5446msgstr "" 5447 5448#: lazarusidestrconsts.lisbrowseandselectacompiler 5449msgid "Browse and select a compiler (e.g. ppcx64" 5450msgstr "" 5451 5452#: lazarusidestrconsts.lisbtnadd 5453msgctxt "lazarusidestrconsts.lisbtnadd" 5454msgid "&Add" 5455msgstr "&Afegeix" 5456 5457#: lazarusidestrconsts.lisbtnclose 5458msgctxt "lazarusidestrconsts.lisbtnclose" 5459msgid "&Close" 5460msgstr "Tan&ca" 5461 5462#: lazarusidestrconsts.lisbtndelete 5463msgctxt "lazarusidestrconsts.lisbtndelete" 5464msgid "&Delete" 5465msgstr "" 5466 5467#: lazarusidestrconsts.lisbtndlgadd 5468msgid "&Add ..." 5469msgstr "" 5470 5471#: lazarusidestrconsts.lisbtndlgreplace 5472msgctxt "lazarusidestrconsts.lisbtndlgreplace" 5473msgid "&Replace ..." 5474msgstr "" 5475 5476#: lazarusidestrconsts.lisbtnenabled 5477msgctxt "lazarusidestrconsts.lisbtnenabled" 5478msgid "&Enabled" 5479msgstr "" 5480 5481#: lazarusidestrconsts.lisbtnfind 5482msgid "&Find" 5483msgstr "" 5484 5485#: lazarusidestrconsts.lisbtnquit 5486#, fuzzy 5487#| msgid "Quit" 5488msgctxt "lazarusidestrconsts.lisbtnquit" 5489msgid "&Quit" 5490msgstr "Surt" 5491 5492#: lazarusidestrconsts.lisbtnremove 5493msgctxt "lazarusidestrconsts.lisbtnremove" 5494msgid "&Remove" 5495msgstr "" 5496 5497#: lazarusidestrconsts.lisbtnrename 5498msgid "&Rename" 5499msgstr "" 5500 5501#: lazarusidestrconsts.lisbtnreplace 5502msgid "&Replace" 5503msgstr "" 5504 5505#: lazarusidestrconsts.lisbuild 5506msgctxt "lazarusidestrconsts.lisbuild" 5507msgid "Build" 5508msgstr "Munta" 5509 5510#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide 5511msgid "build all files of project/package/IDE" 5512msgstr "" 5513 5514#: lazarusidestrconsts.lisbuildcaption 5515msgctxt "lazarusidestrconsts.lisbuildcaption" 5516msgid "Build" 5517msgstr "Munta" 5518 5519#: lazarusidestrconsts.lisbuildide 5520msgid "Build IDE" 5521msgstr "" 5522 5523#: lazarusidestrconsts.lisbuildidewithpackages 5524msgid "build IDE with packages" 5525msgstr "" 5526 5527#: lazarusidestrconsts.lisbuilding 5528msgid "Building" 5529msgstr "" 5530 5531#: lazarusidestrconsts.lisbuildinglazarusfailed 5532msgid "Building Lazarus failed" 5533msgstr "" 5534 5535#: lazarusidestrconsts.lisbuildmode 5536#, object-pascal-format 5537msgid "Build Mode: %s" 5538msgstr "" 5539 5540#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes 5541msgid "Differences between build modes" 5542msgstr "" 5543 5544#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes 5545msgid "Differences from other build modes" 5546msgstr "" 5547 5548#: lazarusidestrconsts.lisbuildmodediffmode 5549msgid "Mode:" 5550msgstr "" 5551 5552#: lazarusidestrconsts.lisbuildmodeintitleinexample 5553msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus" 5554msgstr "" 5555 5556#: lazarusidestrconsts.lisbuildmodes 5557msgid "Build modes" 5558msgstr "" 5559 5560#: lazarusidestrconsts.lisbuildnewproject 5561msgid "Build new project" 5562msgstr "Munta un projecte nou" 5563 5564#: lazarusidestrconsts.lisbuildnumber 5565#, fuzzy 5566#| msgid "Build Number" 5567msgid "Build number" 5568msgstr "Munta el número" 5569 5570#: lazarusidestrconsts.lisbuildstage 5571msgctxt "lazarusidestrconsts.lisbuildstage" 5572msgid "Build" 5573msgstr "Munta" 5574 5575#: lazarusidestrconsts.lisbusy 5576msgid "Busy" 5577msgstr "" 5578 5579#: lazarusidestrconsts.lisbyte 5580#, object-pascal-format 5581msgid "%s byte" 5582msgstr "" 5583 5584#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed 5585#, object-pascal-format 5586msgid "Calling %s to create Makefile from %s failed." 5587msgstr "" 5588 5589#: lazarusidestrconsts.liscallstacknotevaluated 5590msgid "Stack not evaluated" 5591msgstr "" 5592 5593#: lazarusidestrconsts.liscancel 5594msgctxt "lazarusidestrconsts.liscancel" 5595msgid "Cancel" 5596msgstr "Cancel·la" 5597 5598#: lazarusidestrconsts.liscancelloadingthiscomponent 5599msgid "Cancel loading this component" 5600msgstr "" 5601 5602#: lazarusidestrconsts.liscancelloadingunit 5603msgid "Cancel loading unit" 5604msgstr "Cancel·lar carrega de l'unitat" 5605 5606#: lazarusidestrconsts.liscancelrenaming 5607msgid "Cancel renaming" 5608msgstr "Cancel·la canvi de nom" 5609 5610#: lazarusidestrconsts.liscannotcompileproject 5611msgid "Cannot compile project" 5612msgstr "" 5613 5614#: lazarusidestrconsts.liscannotcopytoplevelcomponent 5615#, fuzzy 5616#| msgid "Can not copy top level component." 5617msgid "Cannot copy top level component." 5618msgstr "No es pot copiar el component de nivell superior." 5619 5620#: lazarusidestrconsts.liscannotcreatefile 5621#, object-pascal-format, fuzzy, badformat 5622#| msgid "Cannot create file %s%s%s" 5623msgid "Cannot create file \"%s\"" 5624msgstr "No es pot crear el fitxer %s%s%s" 5625 5626#: lazarusidestrconsts.liscannotdeletelastmode 5627msgid "Cannot delete last mode." 5628msgstr "" 5629 5630#: lazarusidestrconsts.liscannotexecute 5631#, object-pascal-format 5632msgid "cannot execute \"%s\"" 5633msgstr "" 5634 5635#: lazarusidestrconsts.liscannotfind 5636#, object-pascal-format 5637msgid "Cannot find %s" 5638msgstr "" 5639 5640#: lazarusidestrconsts.liscannotfindexecutable 5641#, object-pascal-format 5642msgid "cannot find executable \"%s\"" 5643msgstr "" 5644 5645#: lazarusidestrconsts.liscannotfindlazarusstarter 5646#, object-pascal-format, fuzzy 5647#| msgid "Cannot find lazarus starter:%s%s" 5648msgid "Cannot find Lazarus starter:%s%s" 5649msgstr "No es pot trobar l'iniciador del Lazarus:%s%s" 5650 5651#: lazarusidestrconsts.liscannotfindunit 5652#, object-pascal-format 5653msgid "Cannot find unit %s" 5654msgstr "" 5655 5656#: lazarusidestrconsts.liscannotopenform 5657#, object-pascal-format 5658msgid "Cannot open form \"%s\"." 5659msgstr "" 5660 5661#: lazarusidestrconsts.liscannotsaveform 5662#, object-pascal-format 5663msgid "Cannot save form \"%s\"." 5664msgstr "" 5665 5666#: lazarusidestrconsts.liscannotsubstitutemacros 5667#, object-pascal-format 5668msgid "Cannot substitute macro \"%s\"." 5669msgstr "" 5670 5671#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling 5672msgid "Cannot test the compiler while debugging or compiling." 5673msgstr "" 5674 5675#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents 5676msgid "Can only change the class of TComponents." 5677msgstr "" 5678 5679#: lazarusidestrconsts.liscantfindavalidppu 5680#, object-pascal-format 5681msgid "Can't find a valid %s.ppu" 5682msgstr "" 5683 5684#: lazarusidestrconsts.liscaptioncomparefiles 5685msgid "Compare files (not for creating patches)" 5686msgstr "" 5687 5688#: lazarusidestrconsts.liscbpfiles 5689#, object-pascal-format 5690msgid "%s (%s files)" 5691msgstr "" 5692 5693#: lazarusidestrconsts.liscbpreallydeletesourcefiles 5694#, object-pascal-format 5695msgid "Really delete %s source files%s%s" 5696msgstr "" 5697 5698#: lazarusidestrconsts.lisccdchangeclassof 5699#, object-pascal-format 5700msgid "Change Class of %s" 5701msgstr "" 5702 5703#: lazarusidestrconsts.lisccdnoclass 5704msgid "no class" 5705msgstr "" 5706 5707#: lazarusidestrconsts.lisccoambiguouscompiler 5708msgid "Ambiguous compiler" 5709msgstr "" 5710 5711#: lazarusidestrconsts.lisccochecktestdir 5712#, object-pascal-format 5713msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" 5714msgstr "" 5715 5716#: lazarusidestrconsts.lisccocompilernotanexe 5717#, object-pascal-format 5718msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" 5719msgstr "" 5720 5721#: lazarusidestrconsts.lisccocontains 5722msgid "contains " 5723msgstr "" 5724 5725#: lazarusidestrconsts.lisccocopyoutputtocliboard 5726msgid "Copy output to clipboard" 5727msgstr "" 5728 5729#: lazarusidestrconsts.lisccodatesdiffer 5730#, object-pascal-format 5731msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" 5732msgstr "" 5733 5734#: lazarusidestrconsts.lisccoerrorcaption 5735msgctxt "lazarusidestrconsts.lisccoerrorcaption" 5736msgid "Error" 5737msgstr "S'ha produït un error" 5738 5739#: lazarusidestrconsts.lisccoerrormsg 5740msgid "ERROR: " 5741msgstr "" 5742 5743#: lazarusidestrconsts.lisccofpcunitpathhassource 5744msgid "FPC unit path contains a source: " 5745msgstr "" 5746 5747#: lazarusidestrconsts.lisccohasnewline 5748msgid "new line symbols" 5749msgstr "" 5750 5751#: lazarusidestrconsts.lisccohintmsg 5752msgid "HINT: " 5753msgstr "" 5754 5755#: lazarusidestrconsts.lisccoinvalidcompiler 5756msgid "Invalid compiler" 5757msgstr "" 5758 5759#: lazarusidestrconsts.lisccoinvalidsearchpath 5760msgid "Invalid search path" 5761msgstr "" 5762 5763#: lazarusidestrconsts.lisccoinvalidtestdir 5764msgid "Invalid Test Directory" 5765msgstr "" 5766 5767#: lazarusidestrconsts.lisccomissingunit 5768msgid "Missing unit" 5769msgstr "" 5770 5771#: lazarusidestrconsts.lisccomsgrtlunitnotfound 5772#, object-pascal-format 5773msgid "RTL unit not found: %s" 5774msgstr "" 5775 5776#: lazarusidestrconsts.lisccomultiplecfgfound 5777msgid "multiple compiler configs found: " 5778msgstr "" 5779 5780#: lazarusidestrconsts.liscconocfgfound 5781msgid "no fpc.cfg found" 5782msgstr "" 5783 5784#: lazarusidestrconsts.lisccononascii 5785msgid "non ASCII" 5786msgstr "" 5787 5788#: lazarusidestrconsts.lisccoppuexiststwice 5789#, object-pascal-format 5790msgid "ppu exists twice: %s, %s" 5791msgstr "" 5792 5793#: lazarusidestrconsts.lisccoppuolderthancompiler 5794#, object-pascal-format 5795msgid "There is a .ppu file older than the compiler itself:%s%s" 5796msgstr "" 5797 5798#: lazarusidestrconsts.lisccortlunitnotfounddetailed 5799#, object-pascal-format 5800msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken." 5801msgstr "" 5802 5803#: lazarusidestrconsts.lisccoseveralcompilers 5804#, object-pascal-format 5805msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" 5806msgstr "" 5807 5808#: lazarusidestrconsts.lisccoskip 5809msgid "Skip" 5810msgstr "" 5811 5812#: lazarusidestrconsts.lisccospecialcharacters 5813msgid "special characters" 5814msgstr "" 5815 5816#: lazarusidestrconsts.lisccotestssuccess 5817msgid "All tests succeeded." 5818msgstr "" 5819 5820#: lazarusidestrconsts.lisccounabletocreatetestfile 5821msgid "Unable to create Test File" 5822msgstr "" 5823 5824#: lazarusidestrconsts.lisccounabletocreatetestpascalfile 5825#, object-pascal-format 5826msgid "Unable to create Test Pascal file \"%s\"." 5827msgstr "" 5828 5829#: lazarusidestrconsts.lisccounusualchars 5830msgid "unusual characters" 5831msgstr "" 5832 5833#: lazarusidestrconsts.lisccowarningcaption 5834msgctxt "lazarusidestrconsts.lisccowarningcaption" 5835msgid "Warning" 5836msgstr "" 5837 5838#: lazarusidestrconsts.lisccowarningmsg 5839msgid "WARNING: " 5840msgstr "" 5841 5842#: lazarusidestrconsts.lisccowrongpathdelimiter 5843msgid "wrong path delimiter" 5844msgstr "" 5845 5846#: lazarusidestrconsts.liscecategories 5847msgid "Categories" 5848msgstr "" 5849 5850#: lazarusidestrconsts.liscecomplexitygroup 5851msgid "Complexity" 5852msgstr "" 5853 5854#: lazarusidestrconsts.lisceconstants 5855msgid "Constants" 5856msgstr "" 5857 5858#: lazarusidestrconsts.lisceemptyblocks 5859msgid "Empty blocks" 5860msgstr "" 5861 5862#: lazarusidestrconsts.lisceemptyclasssections 5863msgid "Empty class sections" 5864msgstr "" 5865 5866#: lazarusidestrconsts.lisceemptygroup 5867msgid "Empty constructs" 5868msgstr "" 5869 5870#: lazarusidestrconsts.lisceemptyprocedures 5871msgid "Empty procedures" 5872msgstr "" 5873 5874#: lazarusidestrconsts.liscefilter 5875#, fuzzy 5876#| msgid "(Filter)" 5877msgid "(filter)" 5878msgstr "(Filtre)" 5879 5880#: lazarusidestrconsts.liscefollowcursor 5881msgid "Follow cursor" 5882msgstr "" 5883 5884#: lazarusidestrconsts.liscein 5885#, object-pascal-format 5886msgctxt "lazarusidestrconsts.liscein" 5887msgid "%s in %s" 5888msgstr "" 5889 5890#: lazarusidestrconsts.lisceisarootcontrol 5891msgid "Is a root control" 5892msgstr "" 5893 5894#: lazarusidestrconsts.liscelongparamlistcount 5895msgid "Parameters count treated as \"many\"" 5896msgstr "" 5897 5898#: lazarusidestrconsts.liscelongprocedures 5899msgid "Long procedures" 5900msgstr "" 5901 5902#: lazarusidestrconsts.liscelongproclinecount 5903msgid "Line count of procedure treated as \"long\"" 5904msgstr "" 5905 5906#: lazarusidestrconsts.liscemanynestedprocedures 5907msgid "Many nested procedures" 5908msgstr "" 5909 5910#: lazarusidestrconsts.liscemanyparameters 5911msgid "Many parameters" 5912msgstr "" 5913 5914#: lazarusidestrconsts.liscemodeshowcategories 5915msgid "Show Categories" 5916msgstr "" 5917 5918#: lazarusidestrconsts.liscemodeshowsourcenodes 5919msgid "Show Source Nodes" 5920msgstr "" 5921 5922#: lazarusidestrconsts.liscenestedproccount 5923msgid "Nested procedures count treated as \"many\"" 5924msgstr "" 5925 5926#: lazarusidestrconsts.liscenteralostwindow 5927msgid "Center a lost window" 5928msgstr "" 5929 5930#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling 5931msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored." 5932msgstr "" 5933 5934#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling 5935msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored." 5936msgstr "" 5937 5938#: lazarusidestrconsts.liscenterform 5939msgid "Center Form" 5940msgstr "" 5941 5942#: lazarusidestrconsts.liscenterinwindow 5943msgid "Center in window" 5944msgstr "Centra a la finestra" 5945 5946#: lazarusidestrconsts.liscenters 5947msgid "Centers" 5948msgstr "Centres" 5949 5950#: lazarusidestrconsts.lisceomode 5951msgid "Preferred exhibition mode" 5952msgstr "" 5953 5954#: lazarusidestrconsts.lisceomodecategory 5955msgctxt "lazarusidestrconsts.lisceomodecategory" 5956msgid "Category" 5957msgstr "" 5958 5959#: lazarusidestrconsts.lisceomodesource 5960msgctxt "lazarusidestrconsts.lisceomodesource" 5961msgid "Source" 5962msgstr "" 5963 5964#: lazarusidestrconsts.lisceoneveronlymanually 5965msgid "Never, only manually" 5966msgstr "Mai, sols manualment" 5967 5968#: lazarusidestrconsts.lisceonlyusedincategorymode 5969msgid "Only used in category mode" 5970msgstr "" 5971 5972#: lazarusidestrconsts.lisceoonidle 5973msgid "On idle" 5974msgstr "" 5975 5976#: lazarusidestrconsts.lisceorefreshautomatically 5977msgid "Refresh automatically" 5978msgstr "Actualitza automàticament" 5979 5980#: lazarusidestrconsts.lisceothergroup 5981msgctxt "lazarusidestrconsts.lisceothergroup" 5982msgid "Other" 5983msgstr "Altres" 5984 5985#: lazarusidestrconsts.lisceoupdate 5986msgid "Update" 5987msgstr "" 5988 5989#: lazarusidestrconsts.lisceowhenswitchingfile 5990msgid "When switching file in source editor" 5991msgstr "" 5992 5993#: lazarusidestrconsts.lisceprocedures 5994msgid "Procedures" 5995msgstr "" 5996 5997#: lazarusidestrconsts.lisceproperties 5998msgctxt "lazarusidestrconsts.lisceproperties" 5999msgid "Properties" 6000msgstr "" 6001 6002#: lazarusidestrconsts.liscepublishedpropertywithoutdefault 6003msgid "Published properties without default" 6004msgstr "" 6005 6006#: lazarusidestrconsts.lisceshowcodeobserver 6007msgid "Show observations about" 6008msgstr "" 6009 6010#: lazarusidestrconsts.liscestylegroup 6011msgctxt "lazarusidestrconsts.liscestylegroup" 6012msgid "Style" 6013msgstr "" 6014 6015#: lazarusidestrconsts.liscesurrounding 6016msgid "Surrounding" 6017msgstr "" 6018 6019#: lazarusidestrconsts.liscetodos 6020msgid "ToDos" 6021msgstr "" 6022 6023#: lazarusidestrconsts.liscetypes 6024msgid "Types" 6025msgstr "" 6026 6027#: lazarusidestrconsts.lisceunnamedconstants 6028msgid "Unnamed constants" 6029msgstr "" 6030 6031#: lazarusidestrconsts.lisceunsortedmembers 6032msgid "Unsorted members" 6033msgstr "" 6034 6035#: lazarusidestrconsts.lisceunsortedvisibility 6036msgid "Unsorted visibility" 6037msgstr "" 6038 6039#: lazarusidestrconsts.lisceuses 6040msgctxt "lazarusidestrconsts.lisceuses" 6041msgid "Uses" 6042msgstr "" 6043 6044#: lazarusidestrconsts.liscevariables 6045msgid "Variables" 6046msgstr "" 6047 6048#: lazarusidestrconsts.liscewrongindentation 6049msgid "Wrong indentation" 6050msgstr "" 6051 6052#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof 6053#, object-pascal-format 6054msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s" 6055msgstr "" 6056 6057#: lazarusidestrconsts.liscfecancelloadingthisresource 6058msgid "Cancel loading this resource" 6059msgstr "" 6060 6061#: lazarusidestrconsts.liscfeclassnotfound 6062#, object-pascal-format 6063msgid "%s%sClass \"%s\" not found." 6064msgstr "" 6065 6066#: lazarusidestrconsts.liscfecomponent 6067#, object-pascal-format 6068msgid "%s%sComponent: %s:%s" 6069msgstr "" 6070 6071#: lazarusidestrconsts.liscfecomponentclass 6072#, object-pascal-format 6073msgid "%s%sComponent Class: %s" 6074msgstr "" 6075 6076#: lazarusidestrconsts.liscfecontinueloading 6077msgid "Continue loading" 6078msgstr "" 6079 6080#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection 6081msgid "Do not know how to copy this form editing selection" 6082msgstr "" 6083 6084#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection 6085msgid "Do not know how to cut this form editing selection" 6086msgstr "" 6087 6088#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection 6089msgid "Do not know how to delete this form editing selection" 6090msgstr "" 6091 6092#: lazarusidestrconsts.liscfeerrorcreatingcomponent 6093msgid "Error creating component" 6094msgstr "" 6095 6096#: lazarusidestrconsts.liscfeerrorcreatingcomponent2 6097#, object-pascal-format 6098msgid "Error creating component: %s%s%s" 6099msgstr "" 6100 6101#: lazarusidestrconsts.liscfeerrordestroyingcomponent 6102msgid "Error destroying component" 6103msgstr "" 6104 6105#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit 6106#, object-pascal-format 6107msgid "Error destroying component of type %s of unit %s:%s%s" 6108msgstr "" 6109 6110#: lazarusidestrconsts.liscfeerrordestroyingmediator 6111msgid "Error destroying mediator" 6112msgstr "" 6113 6114#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit 6115#, object-pascal-format 6116msgid "Error destroying mediator %s of unit %s:%s%s" 6117msgstr "" 6118 6119#: lazarusidestrconsts.liscfeerrorreading 6120#, object-pascal-format 6121msgid "Error reading %s" 6122msgstr "" 6123 6124#: lazarusidestrconsts.liscfeinfile 6125#, object-pascal-format 6126msgid "In file %s" 6127msgstr "" 6128 6129#: lazarusidestrconsts.liscfeinvalidcomponentowner 6130msgid "Invalid component owner" 6131msgstr "" 6132 6133#: lazarusidestrconsts.liscferoot 6134#, object-pascal-format 6135msgid "%sRoot=%s:%s" 6136msgstr "" 6137 6138#: lazarusidestrconsts.liscfestopallloading 6139msgid "Stop all loading" 6140msgstr "" 6141 6142#: lazarusidestrconsts.liscfestream 6143#, object-pascal-format 6144msgid "%sStream=%s" 6145msgstr "" 6146 6147#: lazarusidestrconsts.liscfestreamposition 6148#, object-pascal-format 6149msgid "%s%sStream position: %s" 6150msgstr "" 6151 6152#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists 6153msgid "TCustomFormEditor.CreateNonFormForm already exists" 6154msgstr "" 6155 6156#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype 6157#, object-pascal-format 6158msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" 6159msgstr "" 6160 6161#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn 6162#, object-pascal-format 6163msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" 6164msgstr "" 6165 6166#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre 6167#, object-pascal-format 6168msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" 6169msgstr "" 6170 6171#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror 6172#, object-pascal-format 6173msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" 6174msgstr "" 6175 6176#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto 6177#, object-pascal-format 6178msgid "The component of type %s failed to set its owner to %s:%s" 6179msgstr "" 6180 6181#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection 6182#, object-pascal-format 6183msgid "Unable to clear the form editing selection%s%s" 6184msgstr "" 6185 6186#: lazarusidestrconsts.lischange 6187msgctxt "lazarusidestrconsts.lischange" 6188msgid "Change" 6189msgstr "Canvia" 6190 6191#: lazarusidestrconsts.lischangebuildmode 6192msgid "Change build mode" 6193msgstr "" 6194 6195#: lazarusidestrconsts.lischangeclass 6196msgid "Change Class" 6197msgstr "Canvia la Classe" 6198 6199#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides 6200#, object-pascal-format 6201msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." 6202msgstr "" 6203 6204#: lazarusidestrconsts.lischangeencoding 6205msgid "Change Encoding" 6206msgstr "" 6207 6208#: lazarusidestrconsts.lischangefile 6209msgid "Change file" 6210msgstr "" 6211 6212#: lazarusidestrconsts.lischangeparent 6213msgid "Change Parent" 6214msgstr "" 6215 6216#: lazarusidestrconsts.lischangeswerenotsaved 6217msgid "Changes were not saved" 6218msgstr "" 6219 6220#: lazarusidestrconsts.lischangetounix 6221msgid "Change to Unix /" 6222msgstr "" 6223 6224#: lazarusidestrconsts.lischangetowindows 6225msgid "Change to Windows \\" 6226msgstr "" 6227 6228#: lazarusidestrconsts.lischaracter 6229msgid "Character" 6230msgstr "" 6231 6232#: lazarusidestrconsts.lischaractermap 6233msgid "Character Map" 6234msgstr "Mapa de Caràcters" 6235 6236#: lazarusidestrconsts.lischeckall 6237msgid "Check All" 6238msgstr "" 6239 6240#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent 6241msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent" 6242msgid "Check for disk file changes via content rather than timestamp" 6243msgstr "" 6244 6245#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil 6246#, object-pascal-format 6247msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source." 6248msgstr "" 6249 6250#: lazarusidestrconsts.lischeckifpackageisinthedependencies 6251#, object-pascal-format 6252msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies" 6253msgid ". Check if package %s is in the dependencies" 6254msgstr "" 6255 6256#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl 6257msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"." 6258msgstr "" 6259 6260#: lazarusidestrconsts.lischeckoptions 6261msgid "Check options" 6262msgstr "" 6263 6264#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme 6265#, object-pascal-format 6266msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme" 6267msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections." 6268msgstr "" 6269 6270#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded 6271msgid "Check the next token in source and add a semicolon if needed." 6272msgstr "" 6273 6274#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco 6275#, object-pascal-format 6276msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." 6277msgstr "" 6278 6279#: lazarusidestrconsts.lischeckuncheckall 6280msgid "Check/uncheck all" 6281msgstr "" 6282 6283#: lazarusidestrconsts.lischooseadifferentname 6284msgid "Choose a different name" 6285msgstr "Tria un nom diferent" 6286 6287#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates 6288msgid "Choose a file with CodeTools templates" 6289msgstr "" 6290 6291#: lazarusidestrconsts.lischooseafpdoclink 6292msgid "Choose a FPDoc link" 6293msgstr "" 6294 6295#: lazarusidestrconsts.lischooseakey 6296msgid "Choose a key ..." 6297msgstr "" 6298 6299#: lazarusidestrconsts.lischooseanameforthecomponent 6300msgid "Choose a name for the component" 6301msgstr "" 6302 6303#: lazarusidestrconsts.lischooseanexamplefile 6304msgid "Choose an example file" 6305msgstr "" 6306 6307#: lazarusidestrconsts.lischooseanfpcmessagefile 6308msgid "Choose an FPC message file" 6309msgstr "" 6310 6311#: lazarusidestrconsts.lischooseapascalfileforindentationexamples 6312msgid "Choose a Pascal file for indentation examples" 6313msgstr "" 6314 6315#: lazarusidestrconsts.lischoosecompilerexecutable 6316#, object-pascal-format 6317msgid "Choose compiler executable (%s)" 6318msgstr "" 6319 6320#: lazarusidestrconsts.lischoosecompilermessages 6321msgid "Choose compiler messages file" 6322msgstr "" 6323 6324#: lazarusidestrconsts.lischoosedebuggerexecutable 6325msgid "Choose debugger executable" 6326msgstr "" 6327 6328#: lazarusidestrconsts.lischoosedelphipackage 6329msgid "Choose Delphi package (*.dpk)" 6330msgstr "" 6331 6332#: lazarusidestrconsts.lischoosedelphiproject 6333msgid "Choose Delphi project (*.dpr)" 6334msgstr "" 6335 6336#: lazarusidestrconsts.lischoosedelphiunit 6337msgid "Choose Delphi unit (*.pas)" 6338msgstr "Tria una unitat Delphi (*.pas)" 6339 6340#: lazarusidestrconsts.lischoosedirectory 6341msgid "Choose directory" 6342msgstr "Tria el directori" 6343 6344#: lazarusidestrconsts.lischooseexecutable 6345msgid "Choose an executable" 6346msgstr "" 6347 6348#: lazarusidestrconsts.lischoosefpcsourcedir 6349msgid "Choose FPC source directory" 6350msgstr "Tria un directori del codi font del FPC" 6351 6352#: lazarusidestrconsts.lischooselazarussourcedirectory 6353msgid "Choose Lazarus Directory" 6354msgstr "Tria un directori del Lazarus" 6355 6356#: lazarusidestrconsts.lischoosemakeexecutable 6357msgid "Choose \"make\" executable" 6358msgstr "" 6359 6360#: lazarusidestrconsts.lischoosenameandtext 6361msgid "Choose name and text" 6362msgstr "" 6363 6364#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile 6365msgid "Choose one of these items to create a new File" 6366msgstr "Tria un dels següents elements per crear un nou Arxiu" 6367 6368#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage 6369msgid "Choose one of these items to create a new Package" 6370msgstr "Tria un dels següents elements per crear un nou Paquet" 6371 6372#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject 6373msgid "Choose one of these items to create a new Project" 6374msgstr "Tra un dels següents elements per crear un nou Projecte" 6375 6376#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone 6377msgid "Choose one of these items to inherit from an existing one" 6378msgstr "" 6379 6380#: lazarusidestrconsts.lischooseprogramsourcepppaslpr 6381msgid "Choose program source (*.pp,*.pas,*.lpr)" 6382msgstr "Tria el codi font del programa (*.pp, *.pas, *.lpr)" 6383 6384#: lazarusidestrconsts.lischoosestructuretoencloseselection 6385msgid "Choose structure to enclose selection" 6386msgstr "Tria l'estructura per a contenir la selecció" 6387 6388#: lazarusidestrconsts.lischoosetestbuilddir 6389msgid "Choose the directory for tests" 6390msgstr "" 6391 6392#: lazarusidestrconsts.liscirculardependencydetected 6393msgid "Circular dependency detected" 6394msgstr "" 6395 6396#: lazarusidestrconsts.lisclass 6397msgid "&Class" 6398msgstr "" 6399 6400#: lazarusidestrconsts.lisclasscompletion 6401msgid "Class Completion" 6402msgstr "" 6403 6404#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked 6405msgid "Classes and properties exist. Values were not checked." 6406msgstr "" 6407 6408#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste 6409#, object-pascal-format, fuzzy, badformat 6410#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste." 6411msgid "Class \"%s\" is not a registered component class.%sUnable to paste." 6412msgstr "La classe %s%s%s no està registrada com a component de classe. %sNo es pot enganxar" 6413 6414#: lazarusidestrconsts.lisclassnotfound 6415msgid "Class not found" 6416msgstr "No s'ha trobat la classe" 6417 6418#: lazarusidestrconsts.lisclassnotfoundat 6419#, object-pascal-format 6420msgid "Class %s not found at %s(%s,%s)" 6421msgstr "" 6422 6423#: lazarusidestrconsts.lisclassofmethodnotfound 6424#, object-pascal-format 6425msgid "Class \"%s\" of method \"%s\" not found." 6426msgstr "" 6427 6428#: lazarusidestrconsts.liscldirclean 6429msgid "Clean" 6430msgstr "" 6431 6432#: lazarusidestrconsts.liscldircleandirectory 6433msgid "Clean Directory" 6434msgstr "Neteja el directori" 6435 6436#: lazarusidestrconsts.liscldircleansubdirectories 6437msgid "Clean sub directories" 6438msgstr "Neteja els subdirectoris" 6439 6440#: lazarusidestrconsts.liscldirkeepalltextfiles 6441msgid "Keep all text files" 6442msgstr "Manté tots els fitxers de text" 6443 6444#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter 6445msgid "Keep files matching filter" 6446msgstr "Manté els fitxers que coincideixin amb el filtre" 6447 6448#: lazarusidestrconsts.liscldirremovefilesmatchingfilter 6449msgid "Remove files matching filter" 6450msgstr "Elimina els fitxers que concordin amb el filtre" 6451 6452#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof 6453msgid "Simple Syntax (e.g. * instead of .*)" 6454msgstr "Sintaxi simple (p.ex. * en lloc de .*)" 6455 6456#: lazarusidestrconsts.liscleanall 6457msgid "Clean all" 6458msgstr "" 6459 6460#: lazarusidestrconsts.liscleancommonfiles 6461msgid "Clean common files" 6462msgstr "" 6463 6464#: lazarusidestrconsts.liscleanlazarussource 6465msgid "Clean Lazarus Source" 6466msgstr "Neteja el codi del Lazarus" 6467 6468#: lazarusidestrconsts.liscleanonlyonce 6469msgid "Switch after building to automatically" 6470msgstr "" 6471 6472#: lazarusidestrconsts.liscleanup 6473msgid "Clean up" 6474msgstr "" 6475 6476#: lazarusidestrconsts.liscleanupandbuild 6477msgctxt "lazarusidestrconsts.liscleanupandbuild" 6478msgid "Clean up and build" 6479msgstr "" 6480 6481#: lazarusidestrconsts.liscleanupandbuildproject 6482msgid "Clean up and build project" 6483msgstr "" 6484 6485#: lazarusidestrconsts.liscleanuppackage 6486#, object-pascal-format 6487msgid "Clean up package \"%s\"." 6488msgstr "" 6489 6490#: lazarusidestrconsts.liscleanupunitpath 6491msgid "Clean up unit path?" 6492msgstr "" 6493 6494#: lazarusidestrconsts.lisclear 6495msgctxt "lazarusidestrconsts.lisclear" 6496msgid "Clear" 6497msgstr "Neteja" 6498 6499#: lazarusidestrconsts.liscleardirectory 6500msgid "Clear Directory?" 6501msgstr "" 6502 6503#: lazarusidestrconsts.lisclearthefilterforoptions 6504msgid "Clear the filter for options" 6505msgstr "" 6506 6507#: lazarusidestrconsts.lisclickheretobrowsethefilehint 6508msgid "Click here to browse the file" 6509msgstr "" 6510 6511#: lazarusidestrconsts.lisclicktoseethechoices 6512msgid "Click to see the choices" 6513msgstr "" 6514 6515#: lazarusidestrconsts.lisclicktoselectpalettepage 6516msgid "Click to Select Palette Page" 6517msgstr "" 6518 6519#: lazarusidestrconsts.lisclone 6520msgid "Clone" 6521msgstr "" 6522 6523#: lazarusidestrconsts.lisclose 6524#, fuzzy 6525#| msgid "&Close" 6526msgctxt "lazarusidestrconsts.lisclose" 6527msgid "Close" 6528msgstr "Tan&ca" 6529 6530#: lazarusidestrconsts.liscloseall 6531msgctxt "lazarusidestrconsts.liscloseall" 6532msgid "Close All" 6533msgstr "" 6534 6535#: lazarusidestrconsts.liscloseallchecked 6536msgid "Close All Checked" 6537msgstr "" 6538 6539#: lazarusidestrconsts.lisclosealltabsclose 6540msgid "Close files" 6541msgstr "" 6542 6543#: lazarusidestrconsts.lisclosealltabshide 6544msgctxt "lazarusidestrconsts.lisclosealltabshide" 6545msgid "Hide window" 6546msgstr "" 6547 6548#: lazarusidestrconsts.lisclosealltabsquestion 6549msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" 6550msgstr "" 6551 6552#: lazarusidestrconsts.lisclosealltabstitle 6553msgid "Close Source Editor Window" 6554msgstr "" 6555 6556#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions 6557msgid "LCL Interface specific options:" 6558msgstr "Opcions específiques de l'interfície LCL" 6559 6560#: lazarusidestrconsts.liscmparameter 6561msgid "Parameter" 6562msgstr "Paràmetre" 6563 6564#: lazarusidestrconsts.liscmplstcomponents 6565msgctxt "lazarusidestrconsts.liscmplstcomponents" 6566msgid "Components" 6567msgstr "" 6568 6569#: lazarusidestrconsts.liscmplstinheritance 6570msgid "Inheritance" 6571msgstr "" 6572 6573#: lazarusidestrconsts.liscmplstlist 6574msgid "List" 6575msgstr "" 6576 6577#: lazarusidestrconsts.liscmplstpalette 6578msgid "Palette" 6579msgstr "" 6580 6581#: lazarusidestrconsts.liscmppages 6582msgid "Pages" 6583msgstr "" 6584 6585#: lazarusidestrconsts.liscmppalettevisible 6586msgid "Palette is &visible" 6587msgstr "" 6588 6589#: lazarusidestrconsts.liscmprestoredefaults 6590msgid "&Restore defaults" 6591msgstr "" 6592 6593#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile 6594msgid "Ambiguous additional compiler config file" 6595msgstr "" 6596 6597#: lazarusidestrconsts.liscocallon 6598msgid "Call on:" 6599msgstr "Marqueu:" 6600 6601#: lazarusidestrconsts.liscoclickokifaresuretodothat 6602#, object-pascal-format, fuzzy 6603#| msgid "%s%sClick OK if you are sure to do that." 6604msgid "%s%sClick OK if you definitely want to do that." 6605msgstr "%s%sClica D'Acord si estàs segur de fer-ho." 6606 6607#: lazarusidestrconsts.liscocommand 6608msgctxt "lazarusidestrconsts.liscocommand" 6609msgid "Command:" 6610msgstr "Ordre:" 6611 6612#: lazarusidestrconsts.liscode 6613msgid "Code" 6614msgstr "" 6615 6616#: lazarusidestrconsts.liscodebrowser 6617msgctxt "lazarusidestrconsts.liscodebrowser" 6618msgid "Code Browser" 6619msgstr "" 6620 6621#: lazarusidestrconsts.liscodecreationdialogcaption 6622msgid "Code creation options" 6623msgstr "" 6624 6625#: lazarusidestrconsts.liscodecreationdialogclasssection 6626msgid "Class section" 6627msgstr "" 6628 6629#: lazarusidestrconsts.liscodecreationdialoglocation 6630msgctxt "lazarusidestrconsts.liscodecreationdialoglocation" 6631msgid "Location" 6632msgstr "" 6633 6634#: lazarusidestrconsts.liscodegenerationoptions 6635msgid "Code generation options" 6636msgstr "" 6637 6638#: lazarusidestrconsts.liscodehelpaddpathbutton 6639msgid "Add path" 6640msgstr "Afegeix trajectòria" 6641 6642#: lazarusidestrconsts.liscodehelpbrowseexamplebutton 6643#, fuzzy 6644msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" 6645msgid "Browse" 6646msgstr "Navega" 6647 6648#: lazarusidestrconsts.liscodehelpconfirmreplace 6649msgid "Confirm replace" 6650msgstr "" 6651 6652#: lazarusidestrconsts.liscodehelpcreatebutton 6653msgid "Create help item" 6654msgstr "" 6655 6656#: lazarusidestrconsts.liscodehelpdeletepathbutton 6657msgid "Remove path" 6658msgstr "" 6659 6660#: lazarusidestrconsts.liscodehelpdescrtag 6661msgctxt "lazarusidestrconsts.liscodehelpdescrtag" 6662msgid "Description" 6663msgstr "" 6664 6665#: lazarusidestrconsts.liscodehelperrorstag 6666#, fuzzy 6667msgctxt "lazarusidestrconsts.liscodehelperrorstag" 6668msgid "Errors" 6669msgstr "Errors" 6670 6671#: lazarusidestrconsts.liscodehelpexampletag 6672msgid "Example" 6673msgstr "Ejemple" 6674 6675#: lazarusidestrconsts.liscodehelpgroupbox 6676msgid "FPDoc settings" 6677msgstr "" 6678 6679#: lazarusidestrconsts.liscodehelphintboldformat 6680msgid "Insert bold formatting tag" 6681msgstr "" 6682 6683#: lazarusidestrconsts.liscodehelphintinsertcodetag 6684msgid "Insert code formatting tag" 6685msgstr "" 6686 6687#: lazarusidestrconsts.liscodehelphintitalicformat 6688msgid "Insert italic formatting tag" 6689msgstr "Insereix marca de formateig en cursiva" 6690 6691#: lazarusidestrconsts.liscodehelphintremarktag 6692msgid "Insert remark formatting tag" 6693msgstr "" 6694 6695#: lazarusidestrconsts.liscodehelphintunderlineformat 6696msgid "Insert underline formatting tag" 6697msgstr "" 6698 6699#: lazarusidestrconsts.liscodehelphintvartag 6700msgid "Insert var formatting tag" 6701msgstr "" 6702 6703#: lazarusidestrconsts.liscodehelpinherited 6704msgctxt "lazarusidestrconsts.liscodehelpinherited" 6705msgid "Inherited" 6706msgstr "Heretat" 6707 6708#: lazarusidestrconsts.liscodehelpinsertalink 6709msgid "Insert a link ..." 6710msgstr "" 6711 6712#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag 6713msgid "Insert paragraph formatting tag" 6714msgstr "" 6715 6716#: lazarusidestrconsts.liscodehelpmainformcaption 6717msgctxt "lazarusidestrconsts.liscodehelpmainformcaption" 6718msgid "FPDoc Editor" 6719msgstr "" 6720 6721#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound 6722msgid "(no inherited description found)" 6723msgstr "" 6724 6725#: lazarusidestrconsts.liscodehelpnotagcaption 6726msgid "<NONE>" 6727msgstr "<RES>" 6728 6729#: lazarusidestrconsts.liscodehelpseealsotag 6730msgid "See also" 6731msgstr "Vore tambè" 6732 6733#: lazarusidestrconsts.liscodehelpshortdescriptionof 6734msgid "Short description of" 6735msgstr "" 6736 6737#: lazarusidestrconsts.liscodehelpshorttag 6738msgid "Short" 6739msgstr "" 6740 6741#: lazarusidestrconsts.liscodeobignoreconstinfuncs 6742msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" 6743msgid "Ignore constants in next functions" 6744msgstr "" 6745 6746#: lazarusidestrconsts.liscodeobscharconst 6747msgctxt "lazarusidestrconsts.liscodeobscharconst" 6748msgid "Search for unnamed char constants" 6749msgstr "" 6750 6751#: lazarusidestrconsts.liscodeobserver 6752msgid "Code Observer" 6753msgstr "" 6754 6755#: lazarusidestrconsts.liscodeobsignoreeconstants 6756msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" 6757msgid "Ignore next unnamed constants" 6758msgstr "" 6759 6760#: lazarusidestrconsts.liscodetempladd 6761#, fuzzy 6762#| msgid "Add" 6763msgctxt "lazarusidestrconsts.liscodetempladd" 6764msgid "Add template" 6765msgstr "Afegeix" 6766 6767#: lazarusidestrconsts.liscodetempladdcodetemplate 6768msgid "Add code template" 6769msgstr "Afegeix la plantilla del codi" 6770 6771#: lazarusidestrconsts.liscodetemplatokenalreadyexists 6772#, object-pascal-format, fuzzy, badformat 6773#| msgid " A token %s%s%s already exists! " 6774msgid " A token \"%s\" already exists! " 6775msgstr "Ja existeix un testimoni %s%s%s !" 6776 6777#: lazarusidestrconsts.liscodetemplautocompleteon 6778msgid "Auto complete on" 6779msgstr "" 6780 6781#: lazarusidestrconsts.liscodetemplchange 6782msgctxt "lazarusidestrconsts.liscodetemplchange" 6783msgid "Change" 6784msgstr "Canvia" 6785 6786#: lazarusidestrconsts.liscodetemplcomment 6787msgid "Comment:" 6788msgstr "Comentari:" 6789 6790#: lazarusidestrconsts.liscodetempleditcodetemplate 6791msgid "Edit code template" 6792msgstr "Edita la plantilla del codi" 6793 6794#: lazarusidestrconsts.liscodetemplerror 6795msgctxt "lazarusidestrconsts.liscodetemplerror" 6796msgid "Error" 6797msgstr "S'ha produït un error" 6798 6799#: lazarusidestrconsts.liscodetempltoken 6800msgid "Token:" 6801msgstr "Testimoni" 6802 6803#: lazarusidestrconsts.liscodetoolsdefsaction 6804#, object-pascal-format 6805msgid "Action: %s" 6806msgstr "Acció: %s" 6807 6808#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly 6809#, object-pascal-format, fuzzy 6810#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." 6811msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes." 6812msgstr "Els nodes generats automàticament ni es poden editar, %sni poden tenir nodes fills" 6813 6814#: lazarusidestrconsts.liscodetoolsdefsautogenerated 6815#, object-pascal-format 6816msgid "%s, auto generated" 6817msgstr "%s, generat automàticament" 6818 6819#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited 6820#, fuzzy 6821#| msgid "Auto generated nodes can not be edited." 6822msgid "Auto generated nodes cannot be edited." 6823msgstr "Els nodes generats automàticament no poden ser editats" 6824 6825#: lazarusidestrconsts.liscodetoolsdefsblock 6826msgid "Block" 6827msgstr "Bloc" 6828 6829#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor 6830msgid "CodeTools Defines Editor" 6831msgstr "Editor de les definicions de les eines del codi" 6832 6833#: lazarusidestrconsts.liscodetoolsdefscompilerpath 6834#, fuzzy 6835#| msgid "compiler path" 6836msgid "Compiler path" 6837msgstr "trajectòria del compilador" 6838 6839#: lazarusidestrconsts.liscodetoolsdefsconvertnode 6840msgid "Convert node" 6841msgstr "Converteix el node" 6842 6843#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory 6844#, object-pascal-format 6845msgid "Create Defines for %s Directory" 6846msgstr "Crea les definicions pel directori %s" 6847 6848#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler 6849msgid "Create Defines for Free Pascal Compiler" 6850msgstr "Crea les definicions pel compilador Free Pascal" 6851 6852#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources 6853msgid "Create Defines for Free Pascal Git Sources" 6854msgstr "" 6855 6856#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject 6857#, object-pascal-format 6858msgid "Create Defines for %s Project" 6859msgstr "Crea les definicions pel projecte %s" 6860 6861#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory 6862msgid "Create FPC Macros and paths for a fpc project directory" 6863msgstr "Crea les macroinstruccions FPC i les trajectòries per un directori de projecte FPC" 6864 6865#: lazarusidestrconsts.liscodetoolsdefsdefine 6866msgid "Define" 6867msgstr "Defineix" 6868 6869#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse 6870msgid "Define Recurse" 6871msgstr "Defineix el recurs" 6872 6873#: lazarusidestrconsts.liscodetoolsdefsdeletenode 6874msgid "Delete node" 6875msgstr "Elimina el node" 6876 6877#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc 6878#, object-pascal-format, fuzzy, badformat 6879msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" 6880msgstr "El %s directori principal, %s on Borland a instal·lat totes les fonts %s. Per exemple: C:/Programme/Borland/Delphi%s" 6881 6882#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject 6883#, object-pascal-format, fuzzy, badformat 6884msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" 6885msgstr "El directori principal %s, on Borland ha instal·lat totes les fonts %s i que son utilitzades per aquest projecte.%s Per exemple: C:/Programme/Borland/Delphi%s" 6886 6887#: lazarusidestrconsts.liscodetoolsdefsdescription 6888msgid "Description:" 6889msgstr "Descripció" 6890 6891#: lazarusidestrconsts.liscodetoolsdefsdirectory 6892#, object-pascal-format 6893msgid "%s directory" 6894msgstr "%s directori" 6895 6896#: lazarusidestrconsts.liscodetoolsdefselse 6897msgid "Else" 6898msgstr "Else" 6899 6900#: lazarusidestrconsts.liscodetoolsdefselseif 6901msgid "ElseIf" 6902msgstr "ElseIf" 6903 6904#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave 6905msgid "Exit without Save" 6906msgstr "Surt sense desar" 6907 6908#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory 6909msgid "FPC Git source directory" 6910msgstr "" 6911 6912#: lazarusidestrconsts.liscodetoolsdefsif 6913msgid "If" 6914msgstr "If" 6915 6916#: lazarusidestrconsts.liscodetoolsdefsifdef 6917msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef" 6918msgid "IfDef" 6919msgstr "IfDef" 6920 6921#: lazarusidestrconsts.liscodetoolsdefsifndef 6922msgid "IfNDef" 6923msgstr "IfNDef" 6924 6925#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory 6926msgid "Directory" 6927msgstr "Directori" 6928 6929#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp 6930msgid "Insert Delphi 5 Compiler Template" 6931msgstr "Insereix plantilla del compilador Delphi 5" 6932 6933#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem 6934msgid "Insert Delphi 5 Directory Template" 6935msgstr "Insereix plantilla del directori del Delphi 5" 6936 6937#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl 6938msgid "Insert Delphi 5 Project Template" 6939msgstr "Insereix plantilla de projecte Delphi 5" 6940 6941#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp 6942msgid "Insert Delphi 6 Compiler Template" 6943msgstr "Insereix plantilla del compilador Delphi 6" 6944 6945#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem 6946msgid "Insert Delphi 6 Directory Template" 6947msgstr "Insereix plantilla del directori del Delphi 6" 6948 6949#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl 6950msgid "Insert Delphi 6 Project Template" 6951msgstr "Insereix plantilla del projecte Delphi 6" 6952 6953#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp 6954msgid "Insert Delphi 7 Compiler Template" 6955msgstr "Insereix plantilla del compilador Delphi 7" 6956 6957#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem 6958msgid "Insert Delphi 7 Directory Template" 6959msgstr "Insereix plantilla del compilador Delphi 7" 6960 6961#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl 6962msgid "Insert Delphi 7 Project Template" 6963msgstr "Insereix plantilla de projecte Delphi 7" 6964 6965#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert 6966msgid "Insert Free Pascal Compiler Template" 6967msgstr "Insereix plantilla del compilador Free Pascal" 6968 6969#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte 6970msgid "Insert Free Pascal Project Template" 6971msgstr "Insereix plantilla del projecte Free Pascal" 6972 6973#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource 6974msgid "Insert Free Pascal Git Source Template" 6975msgstr "" 6976 6977#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp 6978msgid "Insert Kylix 3 Compiler Template" 6979msgstr "Insereix plantilla del compilador Kylix 3" 6980 6981#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem 6982msgid "Insert Kylix 3 Directory Template" 6983msgstr "Insereix plantilla del directori Kylix 3" 6984 6985#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl 6986msgid "Insert Kylix 3 Project Template" 6987msgstr "Insereix plantilla de projecte Kylix 3" 6988 6989#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild 6990msgid "Insert node as child" 6991msgstr "Insereix el node com a fill" 6992 6993#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow 6994msgid "Insert node below" 6995msgstr "Insereix el node avall" 6996 6997#: lazarusidestrconsts.liscodetoolsdefsinserttemplate 6998msgid "Insert Template" 6999msgstr "Insereix la plantilla" 7000 7001#: lazarusidestrconsts.liscodetoolsdefsinvalidparent 7002msgid "Invalid parent" 7003msgstr "El pare no és vàlid" 7004 7005#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode 7006msgid "Invalid parent node" 7007msgstr "El node pare no és vàlid" 7008 7009#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode 7010msgid "Invalid previous node" 7011msgstr "El node anterior no és vàlid" 7012 7013#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc 7014#, object-pascal-format 7015msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" 7016msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s.%sPer exemple: /home/user/kylix%s" 7017 7018#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject 7019#, object-pascal-format 7020msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" 7021msgstr "El directori principal %s,%son Borland ha instal·lat totes les fonts %s,%si que son utilitzades per aquest projecte %s.%sPer exemple: /home/user/kylix%s" 7022 7023#: lazarusidestrconsts.liscodetoolsdefsmovenodedown 7024msgid "Move node down" 7025msgstr "Mou el node avall" 7026 7027#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown 7028msgid "Move node one level down" 7029msgstr "Mou el node un nivell avall" 7030 7031#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup 7032msgid "Move node one level up" 7033msgstr "Mou el node un nivell amunt" 7034 7035#: lazarusidestrconsts.liscodetoolsdefsmovenodeup 7036msgid "Move node up" 7037msgstr "Mou el node amunt" 7038 7039#: lazarusidestrconsts.liscodetoolsdefsname 7040msgctxt "lazarusidestrconsts.liscodetoolsdefsname" 7041msgid "Name:" 7042msgstr "Nom:" 7043 7044#: lazarusidestrconsts.liscodetoolsdefsnewnode 7045msgid "NewNode" 7046msgstr "Nou node" 7047 7048#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly 7049msgid "Node is readonly" 7050msgstr "El node és només de lectura" 7051 7052#: lazarusidestrconsts.liscodetoolsdefsnoneselected 7053msgid "none selected" 7054msgstr "cap de seleccionat" 7055 7056#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch 7057#, fuzzy 7058#| msgid "Parent node can not contain child nodes." 7059msgid "Parent node cannot contain child nodes." 7060msgstr "El node pare no pot contenir nodes fills" 7061 7062#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes 7063msgid "Previous node can not contain child nodes." 7064msgstr "El node anterior no pot contenir nodes fill" 7065 7066#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory 7067#, fuzzy 7068msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" 7069msgid "Project directory" 7070msgstr "Directori del projecte" 7071 7072#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 7073#, object-pascal-format 7074msgid "%s project directory" 7075msgstr "directori del projecte %s" 7076 7077#: lazarusidestrconsts.liscodetoolsdefsreaderror 7078msgid "Read error" 7079msgstr "S'ha produït un error de lectura" 7080 7081#: lazarusidestrconsts.liscodetoolsdefssaveandexit 7082msgid "Save and Exit" 7083msgstr "Desa i surt" 7084 7085#: lazarusidestrconsts.liscodetoolsdefsselectednode 7086msgid "Selected Node:" 7087msgstr "Node seleccionat" 7088 7089#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory 7090msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging." 7091msgstr "" 7092 7093#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory 7094msgid "The Free Pascal project directory." 7095msgstr "El directori del projecte Free Pascal" 7096 7097#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir 7098msgid "The Free Pascal Git source directory." 7099msgstr "" 7100 7101#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample 7102#, object-pascal-format, fuzzy 7103#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 7104msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 7105msgstr "La trajectòria al compilador Free Pascal.%s Per exemple %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etcfpc.cfg%s." 7106 7107#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject 7108msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros." 7109msgstr "" 7110 7111#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa 7112#, object-pascal-format 7113msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." 7114msgstr "" 7115 7116#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory 7117#, object-pascal-format 7118msgid "The %s project directory,%swhich contains the .dpr, dpk file." 7119msgstr "El directori del projecte %s, %s el qual conté el fitxer .dpr, dpk" 7120 7121#: lazarusidestrconsts.liscodetoolsdefsundefine 7122msgid "Undefine" 7123msgstr "Indefineix" 7124 7125#: lazarusidestrconsts.liscodetoolsdefsundefineall 7126msgid "Undefine All" 7127msgstr "Indefineix-ho tot" 7128 7129#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse 7130msgid "Undefine Recurse" 7131msgstr "Indefineix el recurs" 7132 7133#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths 7134msgid "Value as File Paths" 7135msgstr "" 7136 7137#: lazarusidestrconsts.liscodetoolsdefsvalueastext 7138msgid "Value as Text" 7139msgstr "Valor com a text" 7140 7141#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid 7142#, object-pascal-format 7143msgid "%s:%svalue \"%s\" is invalid." 7144msgstr "" 7145 7146#: lazarusidestrconsts.liscodetoolsdefsvariable 7147msgid "Variable:" 7148msgstr "variable:" 7149 7150#: lazarusidestrconsts.liscodetoolsdefswriteerror 7151msgid "Write error" 7152msgstr "S'ha produït un error d'escriptura" 7153 7154#: lazarusidestrconsts.liscodetoolsoptsat 7155msgid "At" 7156msgstr "A" 7157 7158#: lazarusidestrconsts.liscodetoolsoptsbracket 7159msgid "Bracket" 7160msgstr "" 7161 7162#: lazarusidestrconsts.liscodetoolsoptscaret 7163msgid "Caret (^)" 7164msgstr "" 7165 7166#: lazarusidestrconsts.liscodetoolsoptscolon 7167msgid "Colon" 7168msgstr "Dos punts" 7169 7170#: lazarusidestrconsts.liscodetoolsoptscomma 7171msgid "Comma" 7172msgstr "Coma" 7173 7174#: lazarusidestrconsts.liscodetoolsoptsidentifier 7175msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" 7176msgid "Identifier" 7177msgstr "Identificador" 7178 7179#: lazarusidestrconsts.liscodetoolsoptskeyword 7180msgid "Keyword" 7181msgstr "Paraula clau" 7182 7183#: lazarusidestrconsts.liscodetoolsoptsnewline 7184msgid "Newline" 7185msgstr "Nova línia" 7186 7187#: lazarusidestrconsts.liscodetoolsoptsnone 7188msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" 7189msgid "None" 7190msgstr "Cap" 7191 7192#: lazarusidestrconsts.liscodetoolsoptsnumber 7193msgid "Number" 7194msgstr "Número" 7195 7196#: lazarusidestrconsts.liscodetoolsoptspoint 7197msgid "Point" 7198msgstr "Punt" 7199 7200#: lazarusidestrconsts.liscodetoolsoptssemicolon 7201msgid "Semicolon" 7202msgstr "Punt i coma" 7203 7204#: lazarusidestrconsts.liscodetoolsoptsspace 7205msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" 7206msgid "Space" 7207msgstr "Espaiat" 7208 7209#: lazarusidestrconsts.liscodetoolsoptsstringconst 7210msgid "String constant" 7211msgstr "Constant alfanumèrica" 7212 7213#: lazarusidestrconsts.liscodetoolsoptssymbol 7214msgid "Symbol" 7215msgstr "Símbol" 7216 7217#: lazarusidestrconsts.liscoexecuteafter 7218msgid "Execute after" 7219msgstr "Executa després de" 7220 7221#: lazarusidestrconsts.liscoexecutebefore 7222msgid "Execute before" 7223msgstr "Executa abans de" 7224 7225#: lazarusidestrconsts.liscoladdress 7226msgid "Address" 7227msgstr "" 7228 7229#: lazarusidestrconsts.liscolclass 7230msgid "Class" 7231msgstr "" 7232 7233#: lazarusidestrconsts.liscollapseall 7234msgid "Collapse All (/)" 7235msgstr "" 7236 7237#: lazarusidestrconsts.liscollapseallclasses 7238msgid "Collapse all classes" 7239msgstr "" 7240 7241#: lazarusidestrconsts.liscollapseallpackages 7242msgid "Collapse all packages" 7243msgstr "" 7244 7245#: lazarusidestrconsts.liscollapseallunits 7246msgid "Collapse all units" 7247msgstr "" 7248 7249#: lazarusidestrconsts.liscolreturns 7250msgid "Returns" 7251msgstr "" 7252 7253#: lazarusidestrconsts.liscolvisibility 7254msgid "Visibility" 7255msgstr "" 7256 7257#: lazarusidestrconsts.liscomboboxes 7258msgid "Combo Boxes" 7259msgstr "" 7260 7261#: lazarusidestrconsts.liscommandlineparameters 7262msgctxt "lazarusidestrconsts.liscommandlineparameters" 7263msgid "Command line parameters" 7264msgstr "" 7265 7266#: lazarusidestrconsts.liscommandlineparamsofprogram 7267msgid "Command line parameters of program" 7268msgstr "Paràmetres de la línia d'ordres del programa" 7269 7270#: lazarusidestrconsts.liscompile 7271msgctxt "lazarusidestrconsts.liscompile" 7272msgid "Compile" 7273msgstr "Compila" 7274 7275#: lazarusidestrconsts.liscompileanddonotaskagain 7276msgid "Compile and do not ask again" 7277msgstr "" 7278 7279#: lazarusidestrconsts.liscompilefollowingmodes 7280msgid "Compile the following modes" 7281msgstr "" 7282 7283#: lazarusidestrconsts.liscompileproject 7284msgid "Compile Project" 7285msgstr "" 7286 7287#: lazarusidestrconsts.liscompiler 7288msgid "Compiler" 7289msgstr "Compilador" 7290 7291#: lazarusidestrconsts.liscompilercfgismissing 7292#, object-pascal-format 7293msgid "%s is missing." 7294msgstr "" 7295 7296#: lazarusidestrconsts.liscompilerdoesnotsupporttarget 7297#, object-pascal-format 7298msgid "Compiler \"%s\" does not support target %s-%s" 7299msgstr "" 7300 7301#: lazarusidestrconsts.liscompilererrorinvalidcompiler 7302#, object-pascal-format 7303msgid "Error: invalid compiler: %s" 7304msgstr "S'ha produït un error: el compilador %s no és vàlid." 7305 7306#: lazarusidestrconsts.liscompilerfilename 7307msgid "Compiler filename" 7308msgstr "Nom del fitxer del compilador" 7309 7310#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath 7311#, fuzzy 7312#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" 7313msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" 7314msgstr "Suggeriment: podeu triar la trajectòria del compilador en Entorn->Opcions d'entorn->Fitxers->Trajectòria del compilador" 7315 7316#: lazarusidestrconsts.liscompilermessagesfilenotfound 7317#, object-pascal-format 7318msgid "Compiler messages file not found:%s%s" 7319msgstr "" 7320 7321#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults 7322msgid "NOTE: codetools config file not found - using defaults" 7323msgstr "Nota: No s'ha trobat el fitxer de configuració de les eines del codi, s'utilitzen els valors predeterminats" 7324 7325#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile 7326msgid "NOTE: loading old codetools options file: " 7327msgstr "Nota: S'està carregant el fitxer de les opcions de les eines del codi antic: " 7328 7329#: lazarusidestrconsts.liscompilestage 7330msgctxt "lazarusidestrconsts.liscompilestage" 7331msgid "Compile" 7332msgstr "Compila" 7333 7334#: lazarusidestrconsts.liscompilewithprojectsettings 7335msgid "Compile with project settings" 7336msgstr "" 7337 7338#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates 7339msgid "Compile with -vd for more details. Check for duplicates." 7340msgstr "" 7341 7342#: lazarusidestrconsts.liscompiling 7343#, object-pascal-format 7344msgid "%s (compiling ...)" 7345msgstr "%s (s'està compilant ...)" 7346 7347#: lazarusidestrconsts.liscompletionlonglinehinttype 7348msgid "Show long line hints" 7349msgstr "" 7350 7351#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft 7352msgid "Extend far left" 7353msgstr "" 7354 7355#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft 7356msgid "Extend some left" 7357msgstr "" 7358 7359#: lazarusidestrconsts.liscompletionlonglinehinttypenone 7360msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" 7361msgid "Never" 7362msgstr "" 7363 7364#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly 7365msgid "Extend right only" 7366msgstr "" 7367 7368#: lazarusidestrconsts.liscomponentnameisapascalkeyword 7369#, object-pascal-format 7370msgid "Component name \"%s\" is a Pascal keyword." 7371msgstr "" 7372 7373#: lazarusidestrconsts.liscomponentnameiskeyword 7374#, object-pascal-format, fuzzy, badformat 7375#| msgid "Component name %s%s%s is keyword" 7376msgid "Component name \"%s\" is keyword" 7377msgstr "El nom de component %s%s%s és paraula clau" 7378 7379#: lazarusidestrconsts.liscomponentnameisnotavalididentifier 7380#, object-pascal-format, fuzzy, badformat 7381#| msgid "Component name %s%s%s is not a valid identifier" 7382msgid "Component name \"%s\" is not a valid identifier" 7383msgstr "El nom de component %s%s%s no és un identificador vàlid" 7384 7385#: lazarusidestrconsts.liscomppalcomponentlist 7386msgid "View All" 7387msgstr "" 7388 7389#: lazarusidestrconsts.liscomppalopenpackage 7390msgid "Open package" 7391msgstr "Obre el paquet" 7392 7393#: lazarusidestrconsts.liscomppalopenunit 7394msgid "Open unit" 7395msgstr "Obre la unitat" 7396 7397#: lazarusidestrconsts.liscompress 7398msgid "Compress" 7399msgstr "" 7400 7401#: lazarusidestrconsts.liscompresshint 7402msgid "The resulting directory will be compressed into a ZIP file." 7403msgstr "" 7404 7405#: lazarusidestrconsts.liscomptest 7406#, fuzzy 7407#| msgid "Test" 7408msgctxt "lazarusidestrconsts.liscomptest" 7409msgid "&Test" 7410msgstr "Prova" 7411 7412#: lazarusidestrconsts.liscondition 7413msgid "Condition" 7414msgstr "" 7415 7416#: lazarusidestrconsts.lisconditionals 7417msgctxt "lazarusidestrconsts.lisconditionals" 7418msgid "Conditionals" 7419msgstr "" 7420 7421#: lazarusidestrconsts.lisconfigdirectory 7422msgid "Lazarus config directory" 7423msgstr "Directori de configuració del Lazarus" 7424 7425#: lazarusidestrconsts.lisconfigfileofadditions 7426msgid "Config file of additions:" 7427msgstr "" 7428 7429#: lazarusidestrconsts.lisconfigurebuild 7430#, object-pascal-format 7431msgid "Configure Build %s" 7432msgstr "" 7433 7434#: lazarusidestrconsts.lisconfigurebuildlazarus 7435msgid "Configure \"Build Lazarus\"" 7436msgstr "" 7437 7438#: lazarusidestrconsts.lisconfigureeditortoolbar 7439msgid "Configure Toolbar" 7440msgstr "" 7441 7442#: lazarusidestrconsts.lisconfigurelazaruside 7443msgid "Configure Lazarus IDE" 7444msgstr "" 7445 7446#: lazarusidestrconsts.lisconfirm 7447msgid "Confirm" 7448msgstr "" 7449 7450#: lazarusidestrconsts.lisconfirmation 7451msgid "Confirmation" 7452msgstr "" 7453 7454#: lazarusidestrconsts.lisconfirmbuildallprofiles 7455#, object-pascal-format 7456msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" 7457msgstr "" 7458 7459#: lazarusidestrconsts.lisconfirmchanges 7460msgid "Confirm changes" 7461msgstr "Confirma els canvis" 7462 7463#: lazarusidestrconsts.lisconfirmdelete 7464msgid "Confirm delete" 7465msgstr "" 7466 7467#: lazarusidestrconsts.lisconfirmlazarusrebuild 7468#, object-pascal-format, fuzzy, badformat 7469#| msgid "Do you want to rebuild Lazarus with profile: %s ?" 7470msgid "Do you want to rebuild Lazarus with profile: %s?" 7471msgstr "Vols reconstruïr Lazarus?" 7472 7473#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide 7474msgid "Confirm new package set for the IDE" 7475msgstr "" 7476 7477#: lazarusidestrconsts.lisconfirmpackageaction 7478msgctxt "lazarusidestrconsts.lisconfirmpackageaction" 7479msgid "Action" 7480msgstr "" 7481 7482#: lazarusidestrconsts.lisconfirmpackagenewpackageset 7483msgid "New package set" 7484msgstr "" 7485 7486#: lazarusidestrconsts.lisconfirmpackageoldpackageset 7487msgid "Old package set" 7488msgstr "" 7489 7490#: lazarusidestrconsts.lisconflict 7491msgid "Conflict" 7492msgstr "" 7493 7494#: lazarusidestrconsts.lisconflictdetected 7495msgid "Conflict detected" 7496msgstr "" 7497 7498#: lazarusidestrconsts.lisconsoleapplication 7499msgid "Console application" 7500msgstr "" 7501 7502#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor 7503msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc." 7504msgstr "" 7505 7506#: lazarusidestrconsts.lisconstructorcode 7507msgid "Constructor code" 7508msgstr "" 7509 7510#: lazarusidestrconsts.liscontains 7511msgid "contains" 7512msgstr "" 7513 7514#: lazarusidestrconsts.liscontents 7515#, fuzzy 7516msgctxt "lazarusidestrconsts.liscontents" 7517msgid "Contents" 7518msgstr "Contingut" 7519 7520#: lazarusidestrconsts.liscontextsensitive 7521msgid "Context sensitive" 7522msgstr "" 7523 7524#: lazarusidestrconsts.liscontinue 7525msgctxt "lazarusidestrconsts.liscontinue" 7526msgid "Continue" 7527msgstr "Continuar" 7528 7529#: lazarusidestrconsts.liscontinueanddonotaskagain 7530msgid "Continue and do not ask again" 7531msgstr "" 7532 7533#: lazarusidestrconsts.liscontinuebuilding 7534msgid "Continue building" 7535msgstr "" 7536 7537#: lazarusidestrconsts.liscontinuewithoutloadingform 7538msgid "Continue without loading form" 7539msgstr "Continua sense carregar la forma" 7540 7541#: lazarusidestrconsts.liscontributors 7542msgid "Contributors" 7543msgstr "" 7544 7545#: lazarusidestrconsts.liscontrolneedsparent 7546msgid "Control needs parent" 7547msgstr "El control necessita pare" 7548 7549#: lazarusidestrconsts.lisconvaddcommentafterreplacement 7550msgid "Add comment after replacement" 7551msgstr "" 7552 7553#: lazarusidestrconsts.lisconvaddedmodedelphimodifier 7554msgid "Added MODE Delphi syntax modifier after unit name." 7555msgstr "" 7556 7557#: lazarusidestrconsts.lisconvaddingflagforregister 7558#, object-pascal-format 7559msgid "Adding flag for \"Register\" procedure in unit %s." 7560msgstr "" 7561 7562#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc 7563#, object-pascal-format 7564msgid "\")\" is missing from replacement function: %s" 7565msgstr "" 7566 7567#: lazarusidestrconsts.lisconvbracketnotfound 7568msgid "Bracket not found" 7569msgstr "" 7570 7571#: lazarusidestrconsts.lisconvconvertedfrom 7572#, object-pascal-format 7573msgid " { *Converted from %s* }" 7574msgstr "" 7575 7576#: lazarusidestrconsts.lisconvcoordhint 7577msgid "An offset is added to Top coordinate of controls inside visual containers" 7578msgstr "" 7579 7580#: lazarusidestrconsts.lisconvcoordoffs 7581msgid "Coordinate offsets" 7582msgstr "" 7583 7584#: lazarusidestrconsts.lisconvdeletedfile 7585#, object-pascal-format 7586msgid "Deleted file %s" 7587msgstr "" 7588 7589#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines 7590#, object-pascal-format 7591msgid "Added defines %s in custom options" 7592msgstr "" 7593 7594#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency 7595#, object-pascal-format 7596msgid "Added Package %s as a dependency." 7597msgstr "" 7598 7599#: lazarusidestrconsts.lisconvdelphiaddedunittousessection 7600#, object-pascal-format 7601msgid "Added unit \"%s\" to uses section." 7602msgstr "" 7603 7604#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned 7605msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" 7606msgid "All sub-directories will be scanned for unit files" 7607msgstr "" 7608 7609#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed 7610msgid "BeginCodeTools failed!" 7611msgstr "" 7612 7613#: lazarusidestrconsts.lisconvdelphicategories 7614msgid "Categories:" 7615msgstr "" 7616 7617#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 7618#, object-pascal-format 7619msgid "Changed encoding from %s to UTF-8" 7620msgstr "" 7621 7622#: lazarusidestrconsts.lisconvdelphiconversionaborted 7623msgid "Conversion Aborted." 7624msgstr "" 7625 7626#: lazarusidestrconsts.lisconvdelphiconversionready 7627msgid "Conversion Ready." 7628msgstr "" 7629 7630#: lazarusidestrconsts.lisconvdelphiconversiontook 7631#, object-pascal-format 7632msgid "Conversion took: %s" 7633msgstr "" 7634 7635#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage 7636msgid "Convert Delphi package" 7637msgstr "" 7638 7639#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject 7640msgid "Convert Delphi project" 7641msgstr "" 7642 7643#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit 7644msgid "Convert Delphi unit" 7645msgstr "" 7646 7647#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits 7648msgid "*** Converting unit files found during conversion ***" 7649msgstr "" 7650 7651#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits 7652msgid "*** Converting unit files belonging to project/package ***" 7653msgstr "" 7654 7655#: lazarusidestrconsts.lisconvdelphierror 7656#, object-pascal-format 7657msgid "Error=\"%s\"" 7658msgstr "" 7659 7660#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion 7661msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." 7662msgstr "" 7663 7664#: lazarusidestrconsts.lisconvdelphifailedconvertingunit 7665msgid "Failed converting unit" 7666msgstr "" 7667 7668#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit 7669#, object-pascal-format 7670msgid "Failed to convert unit \"%s\"" 7671msgstr "" 7672 7673#: lazarusidestrconsts.lisconvdelphifixedunitcase 7674#, object-pascal-format 7675msgid "Fixed character case of unit \"%s\" to \"%s\"." 7676msgstr "" 7677 7678#: lazarusidestrconsts.lisconvdelphifoundallunitfiles 7679msgid "Found all unit files" 7680msgstr "" 7681 7682#: lazarusidestrconsts.lisconvdelphifunc 7683msgid "Delphi Function" 7684msgstr "" 7685 7686#: lazarusidestrconsts.lisconvdelphimissingincludefile 7687#, object-pascal-format 7688msgid "%s(%s,%s) missing include file" 7689msgstr "" 7690 7691#: lazarusidestrconsts.lisconvdelphiname 7692msgid "Delphi Name" 7693msgstr "" 7694 7695#: lazarusidestrconsts.lisconvdelphipackagenameexists 7696msgid "Package name exists" 7697msgstr "" 7698 7699#: lazarusidestrconsts.lisconvdelphipackagerequired 7700#, object-pascal-format 7701msgid "Package %s is required but not installed in Lazarus! Install it later." 7702msgstr "" 7703 7704#: lazarusidestrconsts.lisconvdelphiprojomittedunit 7705#, object-pascal-format 7706msgid "Omitted unit %s from project" 7707msgstr "" 7708 7709#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection 7710#, object-pascal-format 7711msgid "Removed unit \"%s\" from uses section." 7712msgstr "" 7713 7714#: lazarusidestrconsts.lisconvdelphirepairingformfiles 7715msgid "*** Fixing used units and Repairing form files ***" 7716msgstr "" 7717 7718#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection 7719#, object-pascal-format 7720msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" 7721msgid "Replaced unit \"%s\" with \"%s\" in uses section." 7722msgstr "" 7723 7724#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa 7725#, object-pascal-format 7726msgid "There is already a package with the name \"%s\"%sPlease close this package first." 7727msgstr "" 7728 7729#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl 7730msgid "Unitname exists in LCL" 7731msgstr "" 7732 7733#: lazarusidestrconsts.lisconvdelphiunitstoreplacein 7734#, object-pascal-format 7735msgid "Units to replace in %s" 7736msgstr "" 7737 7738#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl 7739#, object-pascal-format 7740msgid "LCL already has a unit with name %s. Delete local file %s?" 7741msgstr "" 7742 7743#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet 7744msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages." 7745msgstr "" 7746 7747#: lazarusidestrconsts.lisconversionerror 7748msgid "Conversion error" 7749msgstr "S'ha produït un error de conversió" 7750 7751#: lazarusidestrconsts.lisconvert 7752msgid "Convert" 7753msgstr "" 7754 7755#: lazarusidestrconsts.lisconvertencoding 7756msgid "Convert Encoding" 7757msgstr "" 7758 7759#: lazarusidestrconsts.lisconvertencodingofprojectspackages 7760msgid "Convert encoding of projects/packages" 7761msgstr "" 7762 7763#: lazarusidestrconsts.lisconvertotherhint 7764msgid "Other options affecting the conversion" 7765msgstr "" 7766 7767#: lazarusidestrconsts.lisconvertprojectorpackage 7768msgid "Convert project or package" 7769msgstr "" 7770 7771#: lazarusidestrconsts.lisconverttarget 7772msgid "Target" 7773msgstr "" 7774 7775#: lazarusidestrconsts.lisconverttargetcrossplatform 7776msgid "Cross-platform" 7777msgstr "" 7778 7779#: lazarusidestrconsts.lisconverttargetcrossplatformhint 7780msgid "Cross-platform versus Windows-only" 7781msgstr "" 7782 7783#: lazarusidestrconsts.lisconverttargethint 7784msgid "Converter adds conditional compilation to support different targets" 7785msgstr "" 7786 7787#: lazarusidestrconsts.lisconverttargetsamedfmfile 7788msgid "Use the same DFM form file" 7789msgstr "" 7790 7791#: lazarusidestrconsts.lisconverttargetsamedfmfilehint 7792msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" 7793msgstr "" 7794 7795#: lazarusidestrconsts.lisconverttargetsupportdelphi 7796msgid "Support Delphi" 7797msgstr "" 7798 7799#: lazarusidestrconsts.lisconverttargetsupportdelphihint 7800msgid "Use conditional compilation to support Delphi" 7801msgstr "" 7802 7803#: lazarusidestrconsts.lisconvfixedunitname 7804#, object-pascal-format 7805msgid "Fixed unit name from %s to %s." 7806msgstr "" 7807 7808#: lazarusidestrconsts.lisconvfuncreplacements 7809msgid "Function Replacements" 7810msgstr "" 7811 7812#: lazarusidestrconsts.lisconvfuncreplhint 7813msgctxt "lazarusidestrconsts.lisconvfuncreplhint" 7814msgid "Some Delphi functions can be replaced with LCL function" 7815msgstr "" 7816 7817#: lazarusidestrconsts.lisconvfuncstoreplace 7818msgid "Functions / procedures to replace" 7819msgstr "" 7820 7821#: lazarusidestrconsts.lisconvleftoff 7822msgid "Left offset" 7823msgstr "" 7824 7825#: lazarusidestrconsts.lisconvnewname 7826msgid "New Name" 7827msgstr "" 7828 7829#: lazarusidestrconsts.lisconvparentcontainer 7830msgid "Parent Container" 7831msgstr "" 7832 7833#: lazarusidestrconsts.lisconvproblemsfindingallunits 7834#, object-pascal-format 7835msgid "Problems when trying to find all units from project file %s" 7836msgstr "" 7837 7838#: lazarusidestrconsts.lisconvproblemsfixingincludefile 7839#, object-pascal-format 7840msgid "Problems when fixing include files in file %s" 7841msgstr "" 7842 7843#: lazarusidestrconsts.lisconvproblemsrepairingformfile 7844#, object-pascal-format 7845msgid "Problems when repairing form file %s" 7846msgstr "" 7847 7848#: lazarusidestrconsts.lisconvrepairingincludefiles 7849msgid "Repairing include files : " 7850msgstr "" 7851 7852#: lazarusidestrconsts.lisconvreplacedcall 7853#, object-pascal-format 7854msgid "Replaced call %s with %s" 7855msgstr "" 7856 7857#: lazarusidestrconsts.lisconvreplfuncparameternum 7858#, object-pascal-format 7859msgid "Replacement function parameter number should be >= 1: %s" 7860msgstr "" 7861 7862#: lazarusidestrconsts.lisconvshouldbefollowedbynumber 7863#, object-pascal-format 7864msgid "\"$\" should be followed by a number: %s" 7865msgstr "" 7866 7867#: lazarusidestrconsts.lisconvstoppedbecausethereispackage 7868msgid "Stopped because there already is a package with the same name" 7869msgstr "" 7870 7871#: lazarusidestrconsts.lisconvthislogwassaved 7872#, object-pascal-format 7873msgid "This log was saved to %s" 7874msgstr "" 7875 7876#: lazarusidestrconsts.lisconvtopoff 7877msgid "Top offset" 7878msgstr "" 7879 7880#: lazarusidestrconsts.lisconvtypereplacements 7881msgid "Type Replacements" 7882msgstr "" 7883 7884#: lazarusidestrconsts.lisconvtypereplhint 7885msgid "Unknown types in form file (DFM/LFM)" 7886msgstr "" 7887 7888#: lazarusidestrconsts.lisconvtypestoreplace 7889msgid "Types to replace" 7890msgstr "" 7891 7892#: lazarusidestrconsts.lisconvunitreplacements 7893msgid "Unit Replacements" 7894msgstr "" 7895 7896#: lazarusidestrconsts.lisconvunitreplhint 7897msgid "Unit names in uses section of a source unit" 7898msgstr "" 7899 7900#: lazarusidestrconsts.lisconvunitstoreplace 7901msgid "Units to replace" 7902msgstr "" 7903 7904#: lazarusidestrconsts.lisconvunknownprops 7905msgid "Unknown properties" 7906msgstr "" 7907 7908#: lazarusidestrconsts.lisconvuserselectedtoendconversion 7909#, object-pascal-format 7910msgid "User selected to end conversion with file %s" 7911msgstr "" 7912 7913#: lazarusidestrconsts.liscoolbaraddconfigdelete 7914msgid "Add/Config/Delete Toolbar(s)" 7915msgstr "" 7916 7917#: lazarusidestrconsts.liscoolbaradddivider 7918msgid "Add Divider" 7919msgstr "" 7920 7921#: lazarusidestrconsts.liscoolbaraddselected 7922msgid "Add selected item to toolbar" 7923msgstr "" 7924 7925#: lazarusidestrconsts.liscoolbaravailablecommands 7926msgid "Available commands" 7927msgstr "" 7928 7929#: lazarusidestrconsts.liscoolbarborderstyle 7930msgid "Toolbars border style" 7931msgstr "" 7932 7933#: lazarusidestrconsts.liscoolbarborderstyleitem0 7934#, fuzzy 7935msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0" 7936msgid "None" 7937msgstr "Cap" 7938 7939#: lazarusidestrconsts.liscoolbarborderstyleitem1 7940msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1" 7941msgid "Single" 7942msgstr "" 7943 7944#: lazarusidestrconsts.liscoolbarcodeexplorer 7945#, fuzzy 7946msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer" 7947msgid "Code Explorer" 7948msgstr "Explorador del codi" 7949 7950#: lazarusidestrconsts.liscoolbarcodetemplates 7951#, fuzzy 7952#| msgid "Code templates" 7953msgctxt "lazarusidestrconsts.liscoolbarcodetemplates" 7954msgid "Code Templates" 7955msgstr "Plantilles del codi" 7956 7957#: lazarusidestrconsts.liscoolbarconfigure 7958msgid "&Configure" 7959msgstr "" 7960 7961#: lazarusidestrconsts.liscoolbardeletetoolbar 7962msgid "Are you sure you want to delete the selected toolbar?" 7963msgstr "" 7964 7965#: lazarusidestrconsts.liscoolbardeletewarning 7966msgid "There must be at least one toolbar!" 7967msgstr "" 7968 7969#: lazarusidestrconsts.liscoolbardesigner 7970msgid "Designer" 7971msgstr "" 7972 7973#: lazarusidestrconsts.liscoolbargeneralsettings 7974msgid "General Coolbar Settings" 7975msgstr "" 7976 7977#: lazarusidestrconsts.liscoolbargrabstyle 7978msgid "Toolbars grab style" 7979msgstr "" 7980 7981#: lazarusidestrconsts.liscoolbargrabstyleitem0 7982msgid "Simple" 7983msgstr "" 7984 7985#: lazarusidestrconsts.liscoolbargrabstyleitem1 7986msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1" 7987msgid "Double" 7988msgstr "" 7989 7990#: lazarusidestrconsts.liscoolbargrabstyleitem2 7991msgid "HorLines" 7992msgstr "" 7993 7994#: lazarusidestrconsts.liscoolbargrabstyleitem3 7995msgid "VerLines" 7996msgstr "" 7997 7998#: lazarusidestrconsts.liscoolbargrabstyleitem4 7999msgid "Gripper" 8000msgstr "" 8001 8002#: lazarusidestrconsts.liscoolbargrabstyleitem5 8003msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5" 8004msgid "Button" 8005msgstr "" 8006 8007#: lazarusidestrconsts.liscoolbargrabwidth 8008msgid "Grab width" 8009msgstr "" 8010 8011#: lazarusidestrconsts.liscoolbaridemainmenu 8012msgid "IDE Main Menu" 8013msgstr "" 8014 8015#: lazarusidestrconsts.liscoolbarmessages 8016#, fuzzy 8017msgctxt "lazarusidestrconsts.liscoolbarmessages" 8018msgid "Messages" 8019msgstr "Missatges" 8020 8021#: lazarusidestrconsts.liscoolbarmoveselecteddown 8022msgid "Move selected toolbar item down" 8023msgstr "" 8024 8025#: lazarusidestrconsts.liscoolbarmoveselectedup 8026msgid "Move selected toolbar item up" 8027msgstr "" 8028 8029#: lazarusidestrconsts.liscoolbaroptions 8030msgid "IDE CoolBar" 8031msgstr "" 8032 8033#: lazarusidestrconsts.liscoolbarpackageeditor 8034msgid "Package Editor" 8035msgstr "" 8036 8037#: lazarusidestrconsts.liscoolbarpackageeditorfiles 8038msgid "Package Editor Files" 8039msgstr "" 8040 8041#: lazarusidestrconsts.liscoolbarremoveselected 8042msgid "Remove selected item from toolbar" 8043msgstr "" 8044 8045#: lazarusidestrconsts.liscoolbarrestoredefaults 8046msgid "Restore defaults" 8047msgstr "" 8048 8049#: lazarusidestrconsts.liscoolbarselecttoolbar 8050msgid "Please select a toolbar first!" 8051msgstr "" 8052 8053#: lazarusidestrconsts.liscoolbarsourceeditor 8054#, fuzzy 8055msgctxt "lazarusidestrconsts.liscoolbarsourceeditor" 8056msgid "Source Editor" 8057msgstr "Editor del codi font" 8058 8059#: lazarusidestrconsts.liscoolbarsourcetab 8060msgid "Source Tab" 8061msgstr "" 8062 8063#: lazarusidestrconsts.liscoolbartoolbarcommands 8064msgid "Toolbar commands" 8065msgstr "" 8066 8067#: lazarusidestrconsts.liscoolbarvisible 8068msgid "Coolbar is &visible" 8069msgstr "" 8070 8071#: lazarusidestrconsts.liscoolbarwidth 8072msgid "Coolbar width" 8073msgstr "" 8074 8075#: lazarusidestrconsts.liscopy 8076msgctxt "lazarusidestrconsts.liscopy" 8077msgid "Copy" 8078msgstr "Copia" 8079 8080#: lazarusidestrconsts.liscopyall 8081msgid "Copy All" 8082msgstr "" 8083 8084#: lazarusidestrconsts.liscopyallitemstoclipboard 8085msgid "Copy All Items to Clipboard" 8086msgstr "" 8087 8088#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard 8089msgid "Copy All/Original Messages to Clipboard" 8090msgstr "" 8091 8092#: lazarusidestrconsts.liscopyalloutputclipboard 8093msgid "Copy all output to clipboard" 8094msgstr "" 8095 8096#: lazarusidestrconsts.liscopyallshownmessagestoclipboard 8097msgid "Copy All Shown Messages to Clipboard" 8098msgstr "" 8099 8100#: lazarusidestrconsts.liscopydescription 8101msgid "Copy description to clipboard" 8102msgstr "" 8103 8104#: lazarusidestrconsts.liscopyerror 8105msgid "Copy Error" 8106msgstr "S'ha produït un error de còpia" 8107 8108#: lazarusidestrconsts.liscopyerror2 8109msgid "Copy error" 8110msgstr "S'ha produït un error de còpia" 8111 8112#: lazarusidestrconsts.liscopyfilename 8113#, object-pascal-format 8114msgid "Copy Filename %s" 8115msgstr "" 8116 8117#: lazarusidestrconsts.liscopyfilenametoclipboard 8118msgid "Copy File Name to Clipboard" 8119msgstr "" 8120 8121#: lazarusidestrconsts.liscopyfilesfailed 8122msgid "Copying files failed." 8123msgstr "" 8124 8125#: lazarusidestrconsts.liscopyidentifier 8126#, object-pascal-format 8127msgid "Copy \"%s\" to clipboard" 8128msgstr "" 8129 8130#: lazarusidestrconsts.liscopyingawholeformisnotimplemented 8131msgid "Copying a whole form is not implemented." 8132msgstr "Copiar una forma sencera no està implementat." 8133 8134#: lazarusidestrconsts.liscopyitemtoclipboard 8135msgid "Copy Item to Clipboard" 8136msgstr "" 8137 8138#: lazarusidestrconsts.liscopymovefiletodirectory 8139msgid "Copy/Move File to Directory" 8140msgstr "" 8141 8142#: lazarusidestrconsts.liscopyselecteditemtoclipboard 8143msgid "Copy Selected Items to Clipboard" 8144msgstr "" 8145 8146#: lazarusidestrconsts.liscopyselectedmessagestoclipboard 8147msgid "Copy Selected Messages to Clipboard" 8148msgstr "" 8149 8150#: lazarusidestrconsts.liscoscanforfpcmessages 8151msgid "Scan for FPC messages" 8152msgstr "Explora els missatges del FPC" 8153 8154#: lazarusidestrconsts.liscoscanformakemessages 8155msgid "Scan for Make messages" 8156msgstr "Explora els missatges de Make" 8157 8158#: lazarusidestrconsts.liscoscanformessages 8159msgid "Scan for messages:" 8160msgstr "" 8161 8162#: lazarusidestrconsts.liscoskipcallingcompiler 8163#, fuzzy 8164#| msgid "Skip calling Compiler" 8165msgid "Skip calling compiler" 8166msgstr "No cridis el compilador" 8167 8168#: lazarusidestrconsts.liscouldnotadditomainsource 8169#, object-pascal-format 8170msgid "Could not add \"{$I %s}\" to main source!" 8171msgstr "" 8172 8173#: lazarusidestrconsts.liscouldnotaddrtomainsource 8174#, object-pascal-format 8175msgid "Could not add \"{$R %s}\" to main source!" 8176msgstr "" 8177 8178#: lazarusidestrconsts.liscouldnotaddtomainsource 8179#, object-pascal-format 8180msgid "Could not add \"%s\" to main source!" 8181msgstr "" 8182 8183#: lazarusidestrconsts.liscouldnotremovefrommainsource 8184#, object-pascal-format 8185msgid "Could not remove \"%s\" from main source!" 8186msgstr "" 8187 8188#: lazarusidestrconsts.liscouldnotremoveifrommainsource 8189#, object-pascal-format 8190msgid "Could not remove \"{$I %s}\" from main source!" 8191msgstr "" 8192 8193#: lazarusidestrconsts.liscouldnotremoverfrommainsource 8194#, object-pascal-format 8195msgid "Could not remove \"{$R %s}\" from main source!" 8196msgstr "" 8197 8198#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena 8199#, fuzzy 8200#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." 8201msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." 8202msgstr "Avís: El fitxer de configuració addicional del compilador té el mateix nom que un dels fitxers normalitzats de configuració que utilitza el FreePascal. Això pot comportar que NOMÉS s'analitzi el fitxer addicional i es salti el normalitzat." 8203 8204#: lazarusidestrconsts.liscpopenpackage 8205#, object-pascal-format 8206msgid "Open Package %s" 8207msgstr "Obre Paquet %s" 8208 8209#: lazarusidestrconsts.liscpopenunit 8210#, object-pascal-format 8211msgid "Open Unit %s" 8212msgstr "Obre Unitat %s" 8213 8214#: lazarusidestrconsts.liscpu 8215#, object-pascal-format 8216msgid ", CPU: %s" 8217msgstr "" 8218 8219#: lazarusidestrconsts.liscreateaprojectfirst 8220msgid "Create a project first!" 8221msgstr "Creeu primer un projecte!" 8222 8223#: lazarusidestrconsts.liscreatedebugandreleasemodes 8224msgid "Create Debug and Release modes" 8225msgstr "" 8226 8227#: lazarusidestrconsts.liscreatedirectory 8228msgid "Create directory?" 8229msgstr "" 8230 8231#: lazarusidestrconsts.liscreatefilter 8232msgid "Create Filter" 8233msgstr "" 8234 8235#: lazarusidestrconsts.liscreatefppkgconfig 8236msgid "Restore Fppkg configuration" 8237msgstr "" 8238 8239#: lazarusidestrconsts.liscreatefunction 8240msgid "Create function" 8241msgstr "" 8242 8243#: lazarusidestrconsts.liscreatehelpnode 8244msgid "Create Help node" 8245msgstr "" 8246 8247#: lazarusidestrconsts.liscreateit 8248msgid "Create it" 8249msgstr "" 8250 8251#: lazarusidestrconsts.liscreatelocalvariable 8252#, object-pascal-format 8253msgid "Create local variable \"%s\"" 8254msgstr "" 8255 8256#: lazarusidestrconsts.liscreatenewaddition 8257msgid "Create new addition" 8258msgstr "" 8259 8260#: lazarusidestrconsts.liscreatenewpackage 8261msgid "(Create new package)" 8262msgstr "" 8263 8264#: lazarusidestrconsts.liscreatenewpackagecomponent 8265msgid "Create new package component" 8266msgstr "" 8267 8268#: lazarusidestrconsts.liscreateproject 8269msgid "Create project" 8270msgstr "" 8271 8272#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile 8273msgid "Create/update .po file when saving a lfm file" 8274msgstr "" 8275 8276#: lazarusidestrconsts.liscreatingfileindexoffpcsources 8277#, object-pascal-format 8278msgid "Creating file index of FPC sources %s ..." 8279msgstr "" 8280 8281#: lazarusidestrconsts.liscsbottom 8282msgctxt "lazarusidestrconsts.liscsbottom" 8283msgid "Bottom" 8284msgstr "" 8285 8286#: lazarusidestrconsts.liscstop 8287msgctxt "lazarusidestrconsts.liscstop" 8288msgid "Top" 8289msgstr "" 8290 8291#: lazarusidestrconsts.lisctdefchoosedirectory 8292msgid "Choose Directory" 8293msgstr "Tria un directori" 8294 8295#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues 8296msgid "CodeTools Directory Values" 8297msgstr "Valors del directori de les eines del codi" 8298 8299#: lazarusidestrconsts.lisctdefdefinetemplates 8300msgid "Define templates" 8301msgstr "Defineix plantilles" 8302 8303#: lazarusidestrconsts.lisctdefnovariableselected 8304msgid "<no variable selected>" 8305msgstr "<no hi ha cap variable seleccionada>" 8306 8307#: lazarusidestrconsts.lisctdefsopenpreview 8308msgid "Open Preview" 8309msgstr "Obre la vista prèvia" 8310 8311#: lazarusidestrconsts.lisctdefstools 8312msgid "Tools" 8313msgstr "Eines" 8314 8315#: lazarusidestrconsts.lisctdefvariable 8316#, object-pascal-format 8317msgid "Variable: %s" 8318msgstr "Variable: %s" 8319 8320#: lazarusidestrconsts.lisctdefvariablename 8321msgid "Variable Name" 8322msgstr "Nom de la variable" 8323 8324#: lazarusidestrconsts.lisctdtemplates 8325msgid "Templates" 8326msgstr "Plantilles" 8327 8328#: lazarusidestrconsts.lisctoupdateallmethodsignatures 8329msgid "Update all method signatures" 8330msgstr "" 8331 8332#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures 8333msgid "Update multiple procedure signatures" 8334msgstr "" 8335 8336#: lazarusidestrconsts.lisctpleaseselectamacro 8337msgid "please select a macro" 8338msgstr "Per favor sel·lecciona una macroinstrucció" 8339 8340#: lazarusidestrconsts.lisctselectcodemacro 8341msgid "Select Code Macro" 8342msgstr "Sel·lecciona Macroinstrucció de Codi" 8343 8344#: lazarusidestrconsts.liscurrent 8345msgctxt "lazarusidestrconsts.liscurrent" 8346msgid "Current" 8347msgstr "" 8348 8349#: lazarusidestrconsts.liscurrentlclwidgetset 8350#, object-pascal-format 8351msgid "Current LCL widgetset: \"%s\"" 8352msgstr "" 8353 8354#: lazarusidestrconsts.liscurrentstate 8355msgid "Current state: " 8356msgstr "" 8357 8358#: lazarusidestrconsts.liscursorcolumnincurrenteditor 8359msgid "Cursor column in current editor" 8360msgstr "Columna del cursor en l'editor actual" 8361 8362#: lazarusidestrconsts.liscursorrowincurrenteditor 8363msgid "Cursor row in current editor" 8364msgstr "La línia del cursor en l'editor actual" 8365 8366#: lazarusidestrconsts.liscustomopthint 8367msgid "These options are passed to the compiler after macros are replaced." 8368msgstr "" 8369 8370#: lazarusidestrconsts.liscustomoptions 8371msgid "custom options" 8372msgstr "opcions personalitzades" 8373 8374#: lazarusidestrconsts.liscustomoptions2 8375msgid "Custom options" 8376msgstr "Opcions personalitzades" 8377 8378#: lazarusidestrconsts.liscustomoptions3 8379msgid "Custom Options" 8380msgstr "" 8381 8382#: lazarusidestrconsts.liscustomprogram 8383msgid "Custom Program" 8384msgstr "Programa personalitzat" 8385 8386#: lazarusidestrconsts.liscustomprogramprogramdescriptor 8387msgid "A Custom Free Pascal program." 8388msgstr "" 8389 8390#: lazarusidestrconsts.liscut 8391msgctxt "lazarusidestrconsts.liscut" 8392msgid "Cut" 8393msgstr "Talla" 8394 8395#: lazarusidestrconsts.lisdadattach 8396msgid "Attach" 8397msgstr "" 8398 8399#: lazarusidestrconsts.lisdadimagename 8400msgid "Image Name" 8401msgstr "" 8402 8403#: lazarusidestrconsts.lisdadpid 8404msgid "PID" 8405msgstr "" 8406 8407#: lazarusidestrconsts.lisdadrunningprocesses 8408msgid "Running Processes" 8409msgstr "" 8410 8411#: lazarusidestrconsts.lisdatamodule 8412msgid "Data Module" 8413msgstr "" 8414 8415#: lazarusidestrconsts.lisdate 8416msgid "Date" 8417msgstr "Data" 8418 8419#: lazarusidestrconsts.lisdbgallitemdelete 8420msgctxt "lazarusidestrconsts.lisdbgallitemdelete" 8421msgid "Delete all" 8422msgstr "" 8423 8424#: lazarusidestrconsts.lisdbgallitemdeletehint 8425msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint" 8426msgid "Delete all" 8427msgstr "" 8428 8429#: lazarusidestrconsts.lisdbgallitemdisable 8430msgctxt "lazarusidestrconsts.lisdbgallitemdisable" 8431msgid "Disable all" 8432msgstr "" 8433 8434#: lazarusidestrconsts.lisdbgallitemdisablehint 8435msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" 8436msgid "Disable all" 8437msgstr "" 8438 8439#: lazarusidestrconsts.lisdbgallitemenable 8440msgctxt "lazarusidestrconsts.lisdbgallitemenable" 8441msgid "Enable all" 8442msgstr "" 8443 8444#: lazarusidestrconsts.lisdbgallitemenablehint 8445msgctxt "lazarusidestrconsts.lisdbgallitemenablehint" 8446msgid "Enable all" 8447msgstr "" 8448 8449#: lazarusidestrconsts.lisdbgasmcopytoclipboard 8450msgid "Copy to Clipboard" 8451msgstr "" 8452 8453#: lazarusidestrconsts.lisdbgbreakpointpropertieshint 8454msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint" 8455msgid "Breakpoint Properties ..." 8456msgstr "" 8457 8458#: lazarusidestrconsts.lisdbgemexpression 8459msgid "&Expression:" 8460msgstr "" 8461 8462#: lazarusidestrconsts.lisdbgemnewvalue 8463msgid "&New value:" 8464msgstr "" 8465 8466#: lazarusidestrconsts.lisdbgemresult 8467msgid "&Result:" 8468msgstr "" 8469 8470#: lazarusidestrconsts.lisdbgenbreakpointevaluation 8471msgid "Breakpoint Evaluation" 8472msgstr "" 8473 8474#: lazarusidestrconsts.lisdbgenbreakpointhit 8475msgid "Breakpoint Hit" 8476msgstr "" 8477 8478#: lazarusidestrconsts.lisdbgenbreakpointmessage 8479msgid "Breakpoint Message" 8480msgstr "" 8481 8482#: lazarusidestrconsts.lisdbgenbreakpointstackdump 8483msgid "Breakpoint Stack Dump" 8484msgstr "" 8485 8486#: lazarusidestrconsts.lisdbgendefaultcolor 8487msgid "Default Color" 8488msgstr "" 8489 8490#: lazarusidestrconsts.lisdbgenexceptionraised 8491msgid "Exception Raised" 8492msgstr "" 8493 8494#: lazarusidestrconsts.lisdbgenmoduleload 8495msgid "Module Load" 8496msgstr "" 8497 8498#: lazarusidestrconsts.lisdbgenmoduleunload 8499msgid "Module Unload" 8500msgstr "" 8501 8502#: lazarusidestrconsts.lisdbgenoutputdebugstring 8503msgid "Output Debug String" 8504msgstr "" 8505 8506#: lazarusidestrconsts.lisdbgenprocessexit 8507msgid "Process Exit" 8508msgstr "" 8509 8510#: lazarusidestrconsts.lisdbgenprocessstart 8511msgid "Process Start" 8512msgstr "" 8513 8514#: lazarusidestrconsts.lisdbgenthreadexit 8515msgid "Thread Exit" 8516msgstr "" 8517 8518#: lazarusidestrconsts.lisdbgenthreadstart 8519msgid "Thread Start" 8520msgstr "" 8521 8522#: lazarusidestrconsts.lisdbgenwindowsmessageposted 8523msgid "Windows Message Posted" 8524msgstr "" 8525 8526#: lazarusidestrconsts.lisdbgenwindowsmessagesent 8527msgid "Windows Message Sent" 8528msgstr "" 8529 8530#: lazarusidestrconsts.lisdbgitemdeletehint 8531msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" 8532msgid "Delete" 8533msgstr "Elimina" 8534 8535#: lazarusidestrconsts.lisdbgitemdisable 8536msgctxt "lazarusidestrconsts.lisdbgitemdisable" 8537msgid "Disable" 8538msgstr "" 8539 8540#: lazarusidestrconsts.lisdbgitemdisablehint 8541msgctxt "lazarusidestrconsts.lisdbgitemdisablehint" 8542msgid "Disable" 8543msgstr "" 8544 8545#: lazarusidestrconsts.lisdbgitemenable 8546msgctxt "lazarusidestrconsts.lisdbgitemenable" 8547msgid "Enable" 8548msgstr "" 8549 8550#: lazarusidestrconsts.lisdbgitemenablehint 8551msgctxt "lazarusidestrconsts.lisdbgitemenablehint" 8552msgid "Enable" 8553msgstr "" 8554 8555#: lazarusidestrconsts.lisdbgmangnodebuggerspecified 8556msgid "No debugger specified" 8557msgstr "No s'ha especificat cap depurador" 8558 8559#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway 8560msgid "Set the breakpoint anyway" 8561msgstr "" 8562 8563#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno 8564#, object-pascal-format, fuzzy 8565#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." 8566msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu." 8567msgstr "No s'hi ha especificat cap depurador.%sEstablir punts de parada no tindrà cap efecte fins que configures un depurador al dialeg d'opcións del depurador en el menú." 8568 8569#: lazarusidestrconsts.lisdbgterminal 8570msgctxt "lazarusidestrconsts.lisdbgterminal" 8571msgid "Console In/Output" 8572msgstr "" 8573 8574#: lazarusidestrconsts.lisdbgwinpower 8575msgid "On/Off" 8576msgstr "" 8577 8578#: lazarusidestrconsts.lisdbgwinpowerhint 8579msgid "Disable/Enable updates for the entire window" 8580msgstr "" 8581 8582#: lazarusidestrconsts.lisdebug 8583#, fuzzy 8584msgctxt "lazarusidestrconsts.lisdebug" 8585msgid "Debug" 8586msgstr "Depuració" 8587 8588#: lazarusidestrconsts.lisdebugger 8589msgctxt "lazarusidestrconsts.lisdebugger" 8590msgid "Debugger" 8591msgstr "" 8592 8593#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate 8594#, object-pascal-format 8595msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." 8596msgstr "S'ha produït un error del depurador%sAtenció!! el depurador a entrat en estat d'error%sDeseu el vostre treball ara mateix!!%sPremeu Atura i espereu el millor ..." 8597 8598#: lazarusidestrconsts.lisdebuggerfeedbackerror 8599msgid "Debugger Error" 8600msgstr "" 8601 8602#: lazarusidestrconsts.lisdebuggerfeedbackinformation 8603msgid "Debugger Information" 8604msgstr "" 8605 8606#: lazarusidestrconsts.lisdebuggerfeedbackwarning 8607msgid "Debugger Warning" 8608msgstr "" 8609 8610#: lazarusidestrconsts.lisdebuggerinvalid 8611msgid "Debugger invalid" 8612msgstr "Depurador invàlid" 8613 8614#: lazarusidestrconsts.lisdebugging 8615#, object-pascal-format 8616msgid "%s (debugging ...)" 8617msgstr "%s (s'està depurant ...)" 8618 8619#: lazarusidestrconsts.lisdebughintautotypecastclass 8620msgid "Automatic typecast for objects" 8621msgstr "" 8622 8623#: lazarusidestrconsts.lisdebugoptionsfrmaddexception 8624msgid "Add Exception" 8625msgstr "" 8626 8627#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath 8628msgid "Additional search path" 8629msgstr "Trajectòria de cerca addicional" 8630 8631#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls 8632msgid "BETA: Allow function calls in watches (if supported by backend)" 8633msgstr "" 8634 8635#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm 8636msgid "Automatically close the assembler window, after source not found" 8637msgstr "" 8638 8639#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass 8640msgid "Automatically set \"use instance class type\" for new watches" 8641msgstr "" 8642 8643#: lazarusidestrconsts.lisdebugoptionsfrmbackend 8644msgid "Debugger backend" 8645msgstr "" 8646 8647#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint 8648msgid "Breakpoint" 8649msgstr "Punt de parada" 8650 8651#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun 8652msgid "Clear log on run" 8653msgstr "Neteja la bitacora al ejecutar" 8654 8655#: lazarusidestrconsts.lisdebugoptionsfrmdebugger 8656msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" 8657msgid "Debugger" 8658msgstr "" 8659 8660#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend 8661msgid "Debugger Backend:" 8662msgstr "" 8663 8664#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions 8665msgid "Debugger general options" 8666msgstr "Opcions generals de depuració" 8667 8668#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific 8669msgid "Debugger specific options (depends on type of debugger)" 8670msgstr "Opcions específiques del depurador (Depen del tipus de depurador)" 8671 8672#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname 8673msgid "Duplicate Exception name" 8674msgstr "" 8675 8676#: lazarusidestrconsts.lisdebugoptionsfrmeditclass 8677msgid "Change type" 8678msgstr "" 8679 8680#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn 8681msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type." 8682msgstr "" 8683 8684#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname 8685msgid "Enter the name of the exception" 8686msgstr "" 8687 8688#: lazarusidestrconsts.lisdebugoptionsfrmeventlog 8689msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" 8690msgid "Event Log" 8691msgstr "Bitàcora d'events" 8692 8693#: lazarusidestrconsts.lisdebugoptionsfrmhandledby 8694msgid "Handled by" 8695msgstr "Gestionat per" 8696 8697#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger 8698msgid "Handled by Debugger" 8699msgstr "Gestionat pel Depurador" 8700 8701#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram 8702msgid "Handled by Program" 8703msgstr "Gestionat pel Programa" 8704 8705#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions 8706msgid "Ignore these exceptions" 8707msgstr "Ignora aquestes excepcions" 8708 8709#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions 8710msgid "Language Exceptions" 8711msgstr "" 8712 8713#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto 8714msgid "Limit line count to" 8715msgstr "" 8716 8717#: lazarusidestrconsts.lisdebugoptionsfrmmodule 8718msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" 8719msgid "Module" 8720msgstr "" 8721 8722#: lazarusidestrconsts.lisdebugoptionsfrmname 8723#, fuzzy 8724msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" 8725msgid "Name:" 8726msgstr "Nom:" 8727 8728#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions 8729msgid "Notify on Exceptions" 8730msgstr "" 8731 8732#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions 8733msgid "OS Exceptions" 8734msgstr "" 8735 8736#: lazarusidestrconsts.lisdebugoptionsfrmoutput 8737msgid "Output" 8738msgstr "Eixida" 8739 8740#: lazarusidestrconsts.lisdebugoptionsfrmprocess 8741msgid "Process" 8742msgstr "Procés" 8743 8744#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun 8745msgid "Reset Debugger after each run" 8746msgstr "" 8747 8748#: lazarusidestrconsts.lisdebugoptionsfrmresume 8749msgid "Resume" 8750msgstr "Continua" 8751 8752#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled 8753msgid "Resume Handled" 8754msgstr "" 8755 8756#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled 8757msgid "Resume Unhandled" 8758msgstr "" 8759 8760#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop 8761msgid "Show message on stop with Error (Exit-code <> 0)" 8762msgstr "" 8763 8764#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop 8765msgid "Show message on stop" 8766msgstr "" 8767 8768#: lazarusidestrconsts.lisdebugoptionsfrmsignals 8769msgid "Signals" 8770msgstr "" 8771 8772#: lazarusidestrconsts.lisdebugoptionsfrmthread 8773msgid "Thread" 8774msgstr "" 8775 8776#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke 8777#, object-pascal-format 8778msgid "Unknown Debugger backend \"%s\"" 8779msgstr "" 8780 8781#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors 8782msgid "Use event log colors" 8783msgstr "" 8784 8785#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger 8786msgid "-- Use IDE default Debugger --" 8787msgstr "" 8788 8789#: lazarusidestrconsts.lisdebugoptionsfrmwindows 8790msgid "Windows" 8791msgstr "" 8792 8793#: lazarusidestrconsts.lisdebugunabletoloadfile 8794msgid "Unable to load file" 8795msgstr "No es pot carregar el fitxer" 8796 8797#: lazarusidestrconsts.lisdebugunabletoloadfile2 8798#, object-pascal-format, fuzzy, badformat 8799#| msgid "Unable to load file %s%s%s." 8800msgid "Unable to load file \"%s\"." 8801msgstr "No es pot carregar el fitxer %s%s%s." 8802 8803#: lazarusidestrconsts.lisdecimal 8804msgctxt "lazarusidestrconsts.lisdecimal" 8805msgid "Decimal" 8806msgstr "" 8807 8808#: lazarusidestrconsts.lisdefault 8809msgctxt "lazarusidestrconsts.lisdefault" 8810msgid "Default" 8811msgstr "Predeterminat" 8812 8813#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl 8814msgid "Default class visibility section of new methods. For example code completion on OnShow:=" 8815msgstr "" 8816 8817#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse 8818msgid "The default is ComboBox with \"True\" and \"False\" selections" 8819msgstr "" 8820 8821#: lazarusidestrconsts.lisdefaultplaceholder 8822msgid "(default)" 8823msgstr "" 8824 8825#: lazarusidestrconsts.lisdefaultsectionofmethods 8826msgid "Default section of methods" 8827msgstr "" 8828 8829#: lazarusidestrconsts.lisdelayforcompletionbox 8830msgid "Delay for completion box" 8831msgstr "" 8832 8833#: lazarusidestrconsts.lisdelayforcompletionlonglinehint 8834msgid "Delay for long line hints in completion box" 8835msgstr "" 8836 8837#: lazarusidestrconsts.lisdelayforhints 8838msgid "Delay for hints" 8839msgstr "" 8840 8841#: lazarusidestrconsts.lisdelete 8842msgctxt "lazarusidestrconsts.lisdelete" 8843msgid "Delete" 8844msgstr "Elimina" 8845 8846#: lazarusidestrconsts.lisdelete2 8847msgid "Delete?" 8848msgstr "" 8849 8850#: lazarusidestrconsts.lisdeleteaddition 8851#, object-pascal-format 8852msgid "Delete addition \"%s\"?" 8853msgstr "" 8854 8855#: lazarusidestrconsts.lisdeleteall 8856msgid "&Delete All" 8857msgstr "" 8858 8859#: lazarusidestrconsts.lisdeleteallbreakpoints 8860msgid "Delete all breakpoints?" 8861msgstr "" 8862 8863#: lazarusidestrconsts.lisdeleteallbreakpoints2 8864#, object-pascal-format 8865msgid "Delete all breakpoints in file \"%s\"?" 8866msgstr "" 8867 8868#: lazarusidestrconsts.lisdeleteallinsamesource 8869msgid "Delete All in same source" 8870msgstr "" 8871 8872#: lazarusidestrconsts.lisdeleteallselectedbreakpoints 8873msgid "Delete all selected breakpoints?" 8874msgstr "" 8875 8876#: lazarusidestrconsts.lisdeleteallthesefiles 8877msgid "Delete all these files?" 8878msgstr "Esborrar tots aquestos arxius?" 8879 8880#: lazarusidestrconsts.lisdeleteambiguousfile 8881msgid "Delete ambiguous file?" 8882msgstr "" 8883 8884#: lazarusidestrconsts.lisdeletebreakpoint 8885msgid "Delete Breakpoint" 8886msgstr "" 8887 8888#: lazarusidestrconsts.lisdeletebreakpointatline 8889#, object-pascal-format 8890msgid "Delete breakpoint at%s\"%s\" line %d?" 8891msgstr "" 8892 8893#: lazarusidestrconsts.lisdeletebreakpointforaddress 8894#, object-pascal-format 8895msgid "Delete breakpoint for address %s?" 8896msgstr "" 8897 8898#: lazarusidestrconsts.lisdeletebreakpointforwatch 8899#, object-pascal-format 8900msgid "Delete watchpoint for \"%s\"?" 8901msgstr "" 8902 8903#: lazarusidestrconsts.lisdeletefilefailed 8904msgid "Delete file failed" 8905msgstr "Ha fallat l'eliminació del fitxer" 8906 8907#: lazarusidestrconsts.lisdeletemacro 8908#, object-pascal-format 8909msgid "Delete macro \"%s\"?" 8910msgstr "" 8911 8912#: lazarusidestrconsts.lisdeletemode 8913#, object-pascal-format 8914msgid "Delete mode \"%s\"" 8915msgstr "" 8916 8917#: lazarusidestrconsts.lisdeleteoldfile 8918#, object-pascal-format, fuzzy, badformat 8919#| msgid "Delete old file %s%s%s?" 8920msgid "Delete old file \"%s\"?" 8921msgstr "Voleu eliminar el fitxer antic %s%s%s?" 8922 8923#: lazarusidestrconsts.lisdeleteoldfile2 8924msgid "Delete old file?" 8925msgstr "" 8926 8927#: lazarusidestrconsts.lisdeleteselectedmacro 8928msgid "Delete selected macro?" 8929msgstr "" 8930 8931#: lazarusidestrconsts.lisdeletethisaddition 8932msgid "Delete this addition" 8933msgstr "" 8934 8935#: lazarusidestrconsts.lisdeletevalue 8936#, object-pascal-format 8937msgid "Delete value \"%s\"?" 8938msgstr "" 8939 8940#: lazarusidestrconsts.lisdeletevalue2 8941#, object-pascal-format 8942msgid "Delete value %s" 8943msgstr "" 8944 8945#: lazarusidestrconsts.lisdeletingoffilefailed 8946#, object-pascal-format, fuzzy, badformat 8947#| msgid "Deleting of file %s%s%s failed." 8948msgid "Deleting of file \"%s\" failed." 8949msgstr "Ha fallat l'eliminació del fitxer %s%s%s." 8950 8951#: lazarusidestrconsts.lisdelimiterissemicolon 8952msgid "Delimiter is semicolon." 8953msgstr "" 8954 8955#: lazarusidestrconsts.lisdelphicompatibleresources 8956msgid "Delphi compatible resources. Recommended." 8957msgstr "" 8958 8959#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid 8960msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project." 8961msgstr "" 8962 8963#: lazarusidestrconsts.lisdesktops 8964msgid "Desktops ..." 8965msgstr "" 8966 8967#: lazarusidestrconsts.lisdestinationdirectory 8968msgid "Destination directory" 8969msgstr "Directori de destinació" 8970 8971#: lazarusidestrconsts.lisdestructorcode 8972msgid "Destructor code" 8973msgstr "" 8974 8975#: lazarusidestrconsts.lisdiffdlgcaseinsensitive 8976msgid "Case Insensitive" 8977msgstr "No distingeixis entre majúscules i minúscules" 8978 8979#: lazarusidestrconsts.lisdiffdlgfile1 8980msgid "File1" 8981msgstr "" 8982 8983#: lazarusidestrconsts.lisdiffdlgfile2 8984msgid "File2" 8985msgstr "" 8986 8987#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd 8988msgid "Ignore if empty lines were added or removed" 8989msgstr "Ignora si s'han afegit o eliminat línies buides" 8990 8991#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe 8992msgid "Ignore difference in line ends (e.g. #10 = #13#10)" 8993msgstr "Ignora les diferències al final de la línia (p.ex. #10 = #13#10)" 8994 8995#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd 8996msgid "Ignore amount of space chars" 8997msgstr "Ignora la quantitat d'espais" 8998 8999#: lazarusidestrconsts.lisdiffdlgignorespaces 9000msgid "Ignore spaces (newline chars not included)" 9001msgstr "Ignora els espais (excepte #10, #13#10)" 9002 9003#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline 9004msgid "Ignore spaces at end of line" 9005msgstr "Ignora els espais al final de la línia" 9006 9007#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline 9008msgid "Ignore spaces at start of line" 9009msgstr "Ignora els espais al començament de la línia" 9010 9011#: lazarusidestrconsts.lisdiffdlgonlyselection 9012msgid "Only selection" 9013msgstr "Selecció única" 9014 9015#: lazarusidestrconsts.lisdiffdlgopendiffineditor 9016#, fuzzy 9017#| msgid "Open Diff in editor" 9018msgid "Open difference in editor" 9019msgstr "Obre les diferències a l'editor" 9020 9021#: lazarusidestrconsts.lisdifferentunitfoundatnewposition 9022#, object-pascal-format 9023msgid "different unit %s found at new position \"%s\"" 9024msgstr "" 9025 9026#: lazarusidestrconsts.lisdigits 9027msgid "Digits:" 9028msgstr "" 9029 9030#: lazarusidestrconsts.lisdirectives 9031msgid "Directives" 9032msgstr "" 9033 9034#: lazarusidestrconsts.lisdirectivesfornewunit 9035msgid "Directives for new unit" 9036msgstr "" 9037 9038#: lazarusidestrconsts.lisdirectories 9039msgid "Directories" 9040msgstr "" 9041 9042#: lazarusidestrconsts.lisdirectory 9043msgid "Directory: " 9044msgstr "" 9045 9046#: lazarusidestrconsts.lisdirectorynotfound 9047#, object-pascal-format 9048msgid "Directory \"%s\" not found." 9049msgstr "" 9050 9051#: lazarusidestrconsts.lisdirectorynotfound2 9052#, object-pascal-format 9053msgid "directory %s not found" 9054msgstr "" 9055 9056#: lazarusidestrconsts.lisdirectorynotwritable 9057msgid "Directory not writable" 9058msgstr "" 9059 9060#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles 9061msgid "Directory where the IDE puts the .po files" 9062msgstr "" 9063 9064#: lazarusidestrconsts.lisdisableallinsamesource 9065msgid "Disable All in same source" 9066msgstr "" 9067 9068#: lazarusidestrconsts.lisdisablebreakpoint 9069msgid "Disable Breakpoint" 9070msgstr "" 9071 9072#: lazarusidestrconsts.lisdisabled 9073msgctxt "lazarusidestrconsts.lisdisabled" 9074msgid "Disabled" 9075msgstr "" 9076 9077#: lazarusidestrconsts.lisdisablegroups 9078msgid "Disable Groups" 9079msgstr "" 9080 9081#: lazarusidestrconsts.lisdisablei18nforlfm 9082msgid "Disable I18N for LFM" 9083msgstr "" 9084 9085#: lazarusidestrconsts.lisdisableoptionxg 9086msgid "Disable Option -Xg?" 9087msgstr "" 9088 9089#: lazarusidestrconsts.lisdisableoptionxg2 9090msgid "Disable option -Xg" 9091msgstr "" 9092 9093#: lazarusidestrconsts.lisdisassassembler 9094msgctxt "lazarusidestrconsts.lisdisassassembler" 9095msgid "Assembler" 9096msgstr "" 9097 9098#: lazarusidestrconsts.lisdisassgotoaddredittexthint 9099msgid "($address)" 9100msgstr "" 9101 9102#: lazarusidestrconsts.lisdisassgotoaddress 9103msgctxt "lazarusidestrconsts.lisdisassgotoaddress" 9104msgid "Goto Address" 9105msgstr "" 9106 9107#: lazarusidestrconsts.lisdisassgotoaddresshint 9108msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint" 9109msgid "Goto Address" 9110msgstr "" 9111 9112#: lazarusidestrconsts.lisdisassgotocurrentaddress 9113msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress" 9114msgid "Goto Current Address" 9115msgstr "" 9116 9117#: lazarusidestrconsts.lisdisassgotocurrentaddresshint 9118msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint" 9119msgid "Goto Current Address" 9120msgstr "" 9121 9122#: lazarusidestrconsts.lisdiscardchanges 9123msgid "Discard changes" 9124msgstr "Descarta els canvis" 9125 9126#: lazarusidestrconsts.lisdiscardchangesall 9127msgid "Discard all changes" 9128msgstr "" 9129 9130#: lazarusidestrconsts.lisdiscardchangesandopenproject 9131msgid "Discard changes and open project" 9132msgstr "" 9133 9134#: lazarusidestrconsts.lisdiscardchangesandquit 9135msgid "Discard changes and quit" 9136msgstr "" 9137 9138#: lazarusidestrconsts.lisdiscardchangescreatenewproject 9139msgid "Discard changes, create new project" 9140msgstr "" 9141 9142#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff 9143msgid "Click on one of the above items to see the diff" 9144msgstr "Feu un clic en els elements d'amunt per veure'n les diferencies" 9145 9146#: lazarusidestrconsts.lisdiskdifferrorreadingfile 9147#, object-pascal-format 9148msgid "Error reading file: %s" 9149msgstr "S'ha produït un error mentre es llegia el fitxer: %s" 9150 9151#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges 9152msgid "Ignore all disk changes" 9153msgstr "" 9154 9155#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk 9156msgid "Reload checked files from disk" 9157msgstr "" 9158 9159#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk 9160msgid "Some files have changed on disk:" 9161msgstr "Alguns fitxers han canviat al disc:" 9162 9163#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges 9164msgid "Some files have local changes. Either local or external changes will be overwritten." 9165msgstr "" 9166 9167#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda 9168msgid "Distinguish big and small letters e.g. A and a" 9169msgstr "Distingeix entre lletres grans i petites p.ex. A i a" 9170 9171#: lazarusidestrconsts.lisdlgadd 9172#, fuzzy 9173#| msgid "Add..." 9174msgctxt "lazarusidestrconsts.lisdlgadd" 9175msgid "Add ..." 9176msgstr "Afegeix" 9177 9178#: lazarusidestrconsts.lisdlgalloptions 9179msgid "All options ..." 9180msgstr "" 9181 9182#: lazarusidestrconsts.lisdlgchangeclass 9183msgid "Change Class ..." 9184msgstr "" 9185 9186#: lazarusidestrconsts.lisdlgdefines 9187msgid "Defines ..." 9188msgstr "" 9189 9190#: lazarusidestrconsts.lisdlgedit 9191#, fuzzy 9192#| msgid "Edit..." 9193msgctxt "lazarusidestrconsts.lisdlgedit" 9194msgid "Edit ..." 9195msgstr "Edita" 9196 9197#: lazarusidestrconsts.lisdlgexport 9198msgctxt "lazarusidestrconsts.lisdlgexport" 9199msgid "Export ..." 9200msgstr "" 9201 9202#: lazarusidestrconsts.lisdlgimport 9203msgctxt "lazarusidestrconsts.lisdlgimport" 9204msgid "Import ..." 9205msgstr "" 9206 9207#: lazarusidestrconsts.lisdlgmore 9208msgctxt "lazarusidestrconsts.lisdlgmore" 9209msgid "More ..." 9210msgstr "" 9211 9212#: lazarusidestrconsts.lisdlgopen 9213msgctxt "lazarusidestrconsts.lisdlgopen" 9214msgid "Open ..." 9215msgstr "" 9216 9217#: lazarusidestrconsts.lisdlgsave 9218msgctxt "lazarusidestrconsts.lisdlgsave" 9219msgid "Save ..." 9220msgstr "" 9221 9222#: lazarusidestrconsts.lisdoesnotexists 9223#, object-pascal-format 9224msgid "%s does not exist: %s" 9225msgstr "" 9226 9227#: lazarusidestrconsts.lisdonotchange 9228msgid "Do not change" 9229msgstr "" 9230 9231#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning 9232#, object-pascal-format 9233msgid "%sDo not check if another IDE instance is already running" 9234msgstr "" 9235 9236#: lazarusidestrconsts.lisdonotclosetheproject 9237msgid "Do not close the project" 9238msgstr "" 9239 9240#: lazarusidestrconsts.lisdonotcompiledependencies 9241msgid "do not compile dependencies" 9242msgstr "" 9243 9244#: lazarusidestrconsts.lisdonotshowsplashscreen 9245msgid "Do not show splash screen" 9246msgstr "No mostris la finestra de venvinguda" 9247 9248#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject 9249msgid "Do not show this dialog for this project" 9250msgstr "" 9251 9252#: lazarusidestrconsts.lisdonotshowthismessageagain 9253msgid "Do not show this message again" 9254msgstr "" 9255 9256#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild 9257msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured." 9258msgstr "" 9259 9260#: lazarusidestrconsts.lisdonwloadonlinepackages 9261#, object-pascal-format 9262msgid "" 9263"The following package(s) are not available locally: %s.\n" 9264"In order to install it, you must download them first. Download now?" 9265msgstr "" 9266 9267#: lazarusidestrconsts.lisdown 9268msgctxt "lazarusidestrconsts.lisdown" 9269msgid "Down" 9270msgstr "Avall" 9271 9272#: lazarusidestrconsts.lisdowngrade 9273msgid "Downgrade" 9274msgstr "" 9275 9276#: lazarusidestrconsts.lisdowngradeconfiguration 9277msgid "Downgrade configuration" 9278msgstr "" 9279 9280#: lazarusidestrconsts.lisdownload 9281msgid "Download" 9282msgstr "" 9283 9284#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject 9285msgid "Do you still want to create the new project?" 9286msgstr "" 9287 9288#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject 9289msgid "Do you still want to open another project?" 9290msgstr "" 9291 9292#: lazarusidestrconsts.lisdoyoustillwanttoquit 9293msgid "Do you still want to quit?" 9294msgstr "" 9295 9296#: lazarusidestrconsts.lisdrawgridlinesobjectinspector 9297msgid "Draw grid lines" 9298msgstr "" 9299 9300#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn 9301msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing." 9302msgstr "" 9303 9304#: lazarusidestrconsts.lisdropdowncount 9305msgid "Drop Down Count" 9306msgstr "" 9307 9308#: lazarusidestrconsts.lisdsgcopycomponents 9309msgid "Copy selected components to clipboard" 9310msgstr "Copia els components seleccionats al porta-retalls" 9311 9312#: lazarusidestrconsts.lisdsgcutcomponents 9313msgid "Cut selected components to clipboard" 9314msgstr "Retalla els components seleccionats al porta-retalls" 9315 9316#: lazarusidestrconsts.lisdsgorderbackone 9317msgid "Move component one back" 9318msgstr "Mou component u cap enrere" 9319 9320#: lazarusidestrconsts.lisdsgorderforwardone 9321msgid "Move component one forward" 9322msgstr "Mou component u cap endavant" 9323 9324#: lazarusidestrconsts.lisdsgordermovetoback 9325msgid "Move component to back" 9326msgstr "Mou component al fons" 9327 9328#: lazarusidestrconsts.lisdsgordermovetofront 9329msgid "Move component to front" 9330msgstr "Mou component al front" 9331 9332#: lazarusidestrconsts.lisdsgpastecomponents 9333msgid "Paste selected components from clipboard" 9334msgstr "Enganxa els components seleccionats des del porta-retalls" 9335 9336#: lazarusidestrconsts.lisdsgselectparentcomponent 9337msgid "Select parent component" 9338msgstr "Selecciona el component pare" 9339 9340#: lazarusidestrconsts.lisdsgshownonvisualcomponents 9341msgid "Show nonvisual components" 9342msgstr "" 9343 9344#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents 9345msgid "Toggle showing nonvisual components" 9346msgstr "" 9347 9348#: lazarusidestrconsts.lisduplicate 9349msgid "Duplicate" 9350msgstr "" 9351 9352#: lazarusidestrconsts.lisduplicateentry 9353msgid "Duplicate entry" 9354msgstr "" 9355 9356#: lazarusidestrconsts.lisduplicatefilename 9357msgid "Duplicate File Name" 9358msgstr "" 9359 9360#: lazarusidestrconsts.lisduplicatefoundofvalue 9361#, object-pascal-format 9362msgid "Duplicate found of value \"%s\"." 9363msgstr "" 9364 9365#: lazarusidestrconsts.lisduplicatemodename 9366#, object-pascal-format 9367msgid "Mode \"%s\" is already present in the list." 9368msgstr "" 9369 9370#: lazarusidestrconsts.lisduplicatename 9371msgid "Duplicate Name" 9372msgstr "" 9373 9374#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe 9375#, object-pascal-format 9376msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" 9377msgstr "" 9378 9379#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths 9380msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9381msgstr "" 9382 9383#: lazarusidestrconsts.lisduplicatesearchpath 9384msgid "Duplicate search path" 9385msgstr "" 9386 9387#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh 9388msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9389msgstr "" 9390 9391#: lazarusidestrconsts.lisduplicateunit 9392msgid "Duplicate Unit" 9393msgstr "" 9394 9395#: lazarusidestrconsts.lisduplicateunitin 9396#, object-pascal-format 9397msgid "Duplicate unit \"%s\" in \"%s\"" 9398msgstr "" 9399 9400#: lazarusidestrconsts.lisdynpkgamounttoscrollin 9401msgid "Amount to scroll in" 9402msgstr "" 9403 9404#: lazarusidestrconsts.lisdynpkgamounttoscrollin2 9405msgid "Amount to scroll in (%)" 9406msgstr "" 9407 9408#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax 9409msgid "Amount to scroll in (Max)" 9410msgstr "" 9411 9412#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa 9413msgid "Auto Scroll on delete past left border" 9414msgstr "" 9415 9416#: lazarusidestrconsts.lisdynpkgautoscrollontypepast 9417msgid "Auto Scroll on type past right border" 9418msgstr "" 9419 9420#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw 9421msgid "Trigger on min chars (% of width)" 9422msgstr "" 9423 9424#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis 9425msgid "Trigger on min chars visible" 9426msgstr "" 9427 9428#: lazarusidestrconsts.lisedit 9429msgctxt "lazarusidestrconsts.lisedit" 9430msgid "Edit" 9431msgstr "Edita" 9432 9433#: lazarusidestrconsts.liseditadditionalhelpformessages 9434msgid "Edit additional help for messages" 9435msgstr "" 9436 9437#: lazarusidestrconsts.liseditcontexthelp 9438msgid "Edit context help" 9439msgstr "" 9440 9441#: lazarusidestrconsts.lisedithelp 9442msgid "Edit help" 9443msgstr "" 9444 9445#: lazarusidestrconsts.liseditkey 9446msgid "Edit Key" 9447msgstr "" 9448 9449#: lazarusidestrconsts.liseditorcolors 9450msgid "Editor Colors" 9451msgstr "" 9452 9453#: lazarusidestrconsts.liseditormacros 9454msgid "Editor Macros" 9455msgstr "" 9456 9457#: lazarusidestrconsts.liseditortoolbar 9458msgid "Editor ToolBar" 9459msgstr "" 9460 9461#: lazarusidestrconsts.liseditortoolbarsettings 9462msgid "Editor Toolbar Settings" 9463msgstr "" 9464 9465#: lazarusidestrconsts.liseditortoolbarvisible 9466msgid "Editor Toolbar is &visible" 9467msgstr "" 9468 9469#: lazarusidestrconsts.lisedoptsloadascheme 9470msgid "Load a scheme" 9471msgstr "" 9472 9473#: lazarusidestrconsts.lisedtdefallpackages 9474msgid "All packages" 9475msgstr "Tots els paquets" 9476 9477#: lazarusidestrconsts.lisedtdefcurrentproject 9478msgid "Current Project" 9479msgstr "Projecte actual" 9480 9481#: lazarusidestrconsts.lisedtdefsallprojects 9482msgid "All projects" 9483msgstr "Tots els projectes" 9484 9485#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi 9486msgid "set FPC mode to DELPHI" 9487msgstr "fica mode FPC a DELPHI" 9488 9489#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc 9490msgid "set FPC mode to FPC" 9491msgstr "" 9492 9493#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc 9494msgid "set FPC mode to GPC" 9495msgstr "fica mode FPC a GPC" 9496 9497#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas 9498msgid "set FPC mode to MacPas" 9499msgstr "" 9500 9501#: lazarusidestrconsts.lisedtdefsetfpcmodetotp 9502msgid "set FPC mode to TP" 9503msgstr "fica mode FPC aTP" 9504 9505#: lazarusidestrconsts.lisedtdefsetiocheckson 9506msgid "set IOCHECKS on" 9507msgstr "activa IOCHECKS" 9508 9509#: lazarusidestrconsts.lisedtdefsetoverflowcheckson 9510msgid "set OVERFLOWCHECKS on" 9511msgstr "activa OVERFLOWCHECKS" 9512 9513#: lazarusidestrconsts.lisedtdefsetrangecheckson 9514msgid "set RANGECHECKS on" 9515msgstr "activa RANGECHECKS" 9516 9517#: lazarusidestrconsts.lisedtdefuseheaptrcunit 9518msgid "use HeapTrc unit" 9519msgstr "utilitza la unitat HeapTrc" 9520 9521#: lazarusidestrconsts.lisedtdefuselineinfounit 9522msgid "use LineInfo unit" 9523msgstr "utilitza la unitat LineInfo" 9524 9525#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename 9526msgid "A valid tool needs at least a title and a filename." 9527msgstr "Una eina vàlida necessita al menys, títol i nom de fitxer" 9528 9529#: lazarusidestrconsts.lisedtexttooledittool 9530msgid "Edit Tool" 9531msgstr "Edita l'eina" 9532 9533#: lazarusidestrconsts.lisedtexttoolkey 9534msgctxt "lazarusidestrconsts.lisedtexttoolkey" 9535msgid "Key" 9536msgstr "Tecla" 9537 9538#: lazarusidestrconsts.lisedtexttoolmacros 9539msgctxt "lazarusidestrconsts.lisedtexttoolmacros" 9540msgid "Macros" 9541msgstr "Macroinstruccions" 9542 9543#: lazarusidestrconsts.lisedtexttoolparameters 9544msgid "Parameters:" 9545msgstr "Paràmetres:" 9546 9547#: lazarusidestrconsts.lisedtexttoolprogramfilename 9548msgid "Program Filename:" 9549msgstr "Nom de programa:" 9550 9551#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages 9552#, fuzzy 9553#| msgid "Scan output for Free Pascal Compiler messages" 9554msgid "Scan output for FPC messages" 9555msgstr "Explora a la sortida els missatges del compilador Free Pascal" 9556 9557#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages 9558#, fuzzy 9559#| msgid "Scan output for make messages" 9560msgid "Scan output for \"make\" messages" 9561msgstr "Explora a la sortida els missatges de Make" 9562 9563#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired 9564msgid "Title and Filename required" 9565msgstr "Es requereix títol i nom de fitxer" 9566 9567#: lazarusidestrconsts.lisedtexttoolworkingdirectory 9568msgid "Working Directory:" 9569msgstr "Directori de treball:" 9570 9571#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit 9572msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")" 9573msgstr "" 9574 9575#: lazarusidestrconsts.lisemdall 9576msgctxt "lazarusidestrconsts.lisemdall" 9577msgid "All" 9578msgstr "" 9579 9580#: lazarusidestrconsts.lisemdemptymethods 9581msgctxt "lazarusidestrconsts.lisemdemptymethods" 9582msgid "Empty Methods" 9583msgstr "" 9584 9585#: lazarusidestrconsts.lisemdfoundemptymethods 9586msgid "Found empty methods:" 9587msgstr "" 9588 9589#: lazarusidestrconsts.lisemdnoclass 9590msgid "No class" 9591msgstr "" 9592 9593#: lazarusidestrconsts.lisemdnoclassat 9594#, object-pascal-format 9595msgid "No class at %s(%s,%s)" 9596msgstr "" 9597 9598#: lazarusidestrconsts.lisemdonlypublished 9599msgid "Only published" 9600msgstr "" 9601 9602#: lazarusidestrconsts.lisemdpublic 9603msgid "Public" 9604msgstr "" 9605 9606#: lazarusidestrconsts.lisemdpublished 9607msgid "Published" 9608msgstr "" 9609 9610#: lazarusidestrconsts.lisemdremovemethods 9611msgid "Remove methods" 9612msgstr "" 9613 9614#: lazarusidestrconsts.lisemdsearchintheseclasssections 9615msgid "Search in these class sections:" 9616msgstr "" 9617 9618#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause 9619#, object-pascal-format 9620msgid "Unable to show empty methods of the current class, because%s%s" 9621msgstr "" 9622 9623#: lazarusidestrconsts.lisempty 9624msgid "Empty" 9625msgstr "" 9626 9627#: lazarusidestrconsts.lisemptydestinationforpublishing 9628msgid "Destination directory for publishing is either a relative path or empty." 9629msgstr "" 9630 9631#: lazarusidestrconsts.lisenableall 9632msgid "&Enable All" 9633msgstr "" 9634 9635#: lazarusidestrconsts.lisenableallinsamesource 9636msgid "Enable All in same source" 9637msgstr "" 9638 9639#: lazarusidestrconsts.lisenablebreakpoint 9640msgid "Enable Breakpoint" 9641msgstr "" 9642 9643#: lazarusidestrconsts.lisenabled 9644msgctxt "lazarusidestrconsts.lisenabled" 9645msgid "Enabled" 9646msgstr "" 9647 9648#: lazarusidestrconsts.lisenabledonlyforpackages 9649msgid "Enabled only for packages." 9650msgstr "" 9651 9652#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage 9653#, object-pascal-format 9654msgid ". Enable flag \"Use Unit\" of unit %s in package %s" 9655msgstr "" 9656 9657#: lazarusidestrconsts.lisenablegroups 9658msgid "Enable Groups" 9659msgstr "" 9660 9661#: lazarusidestrconsts.lisenablei18nforlfm 9662msgid "Enable I18N for LFM" 9663msgstr "" 9664 9665#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport 9666msgid "Enable internationalization and translation support" 9667msgstr "" 9668 9669#: lazarusidestrconsts.lisenablemacros 9670msgid "Enable Macros" 9671msgstr "Permet Macroinstruccions" 9672 9673#: lazarusidestrconsts.lisenableoptiondwarf 9674msgid "Enable Dwarf 2 (-gw)?" 9675msgstr "" 9676 9677#: lazarusidestrconsts.lisenableoptiondwarf2 9678msgid "Enable Dwarf 2 (-gw)" 9679msgstr "" 9680 9681#: lazarusidestrconsts.lisenableoptiondwarf2sets 9682msgid "Enable Dwarf 2 with sets" 9683msgstr "" 9684 9685#: lazarusidestrconsts.lisenableoptiondwarf3 9686msgid "Enable Dwarf 3 (-gw3)" 9687msgstr "" 9688 9689#: lazarusidestrconsts.lisenableoptionxg 9690msgid "Enable Option -Xg?" 9691msgstr "" 9692 9693#: lazarusidestrconsts.lisenableoptionxg2 9694msgid "Enable option -Xg" 9695msgstr "" 9696 9697#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix 9698msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier" 9699msgstr "" 9700 9701#: lazarusidestrconsts.lisenclose 9702msgid "Enclose" 9703msgstr "Tanca" 9704 9705#: lazarusidestrconsts.lisencloseinifdef 9706msgid "Enclose in $IFDEF" 9707msgstr "" 9708 9709#: lazarusidestrconsts.lisencodingnumberoffilesfailed 9710#, object-pascal-format 9711msgid "Number of files failed to convert: %d" 9712msgstr "" 9713 9714#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis 9715#, object-pascal-format 9716msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" 9717msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." 9718msgstr "" 9719 9720#: lazarusidestrconsts.lisendlessloopinmacros 9721msgid "Endless loop in macros" 9722msgstr "" 9723 9724#: lazarusidestrconsts.lisenternewnameformacros 9725#, object-pascal-format 9726msgid "Enter new name for Macro \"%s\"" 9727msgstr "" 9728 9729#: lazarusidestrconsts.lisenvironmentvariablenameasparameter 9730msgid "Environment variable, name as parameter" 9731msgstr "" 9732 9733#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound 9734msgid "Directory not found" 9735msgstr "No s'ha trobat el directori" 9736 9737#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename 9738msgid "Invalid debugger filename" 9739msgstr "El nom del depurador no és vàlid" 9740 9741#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg 9742#, object-pascal-format 9743msgid "The debugger file \"%s\" is not an executable." 9744msgstr "El fitxer del depurador \"%s\" no és executable" 9745 9746#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg 9747#, object-pascal-format 9748msgid "Test directory \"%s\" not found." 9749msgstr "No s'ha trobat el directori de les proves \"%s\"." 9750 9751#: lazarusidestrconsts.liserrinvalidoption 9752#, object-pascal-format 9753msgid "Invalid option at position %d: \"%s\"" 9754msgstr "" 9755 9756#: lazarusidestrconsts.liserrnooptionallowed 9757#, object-pascal-format 9758msgid "Option at position %d does not allow an argument: %s" 9759msgstr "L'opció en la posició %d no permet un argument: %s" 9760 9761#: lazarusidestrconsts.liserroptionneeded 9762#, object-pascal-format 9763msgid "Option at position %d needs an argument : %s" 9764msgstr "" 9765 9766#: lazarusidestrconsts.liserror 9767msgid "Error: " 9768msgstr "S'ha produït un error: " 9769 9770#: lazarusidestrconsts.liserrorcreatingfile 9771msgid "Error creating file" 9772msgstr "S'ha produït un error mentre es creava el fitxer" 9773 9774#: lazarusidestrconsts.liserrordeletingfile 9775msgid "Error deleting file" 9776msgstr "S'ha produït un error mentre s'eliminava el fitxer" 9777 9778#: lazarusidestrconsts.liserrorin 9779#, object-pascal-format 9780msgid "Error in %s" 9781msgstr "Hi ha un error a %s" 9782 9783#: lazarusidestrconsts.liserrorinthecompilerfilename 9784msgid "Error in the compiler file name:" 9785msgstr "" 9786 9787#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother 9788msgid "Error in the custom compiler options (Other):" 9789msgstr "" 9790 9791#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol 9792msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):" 9793msgstr "" 9794 9795#: lazarusidestrconsts.liserrorinthedebuggerpathaddition 9796msgid "Error in the \"Debugger path addition\":" 9797msgstr "" 9798 9799#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles 9800msgid "Error in the search path for \"Include files\":" 9801msgstr "" 9802 9803#: lazarusidestrconsts.liserrorinthesearchpathforlibraries 9804msgid "Error in the search path for \"Libraries\":" 9805msgstr "" 9806 9807#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles 9808msgid "Error in the search path for \"Object files\":" 9809msgstr "" 9810 9811#: lazarusidestrconsts.liserrorinthesearchpathforothersources 9812msgid "Error in the search path for \"Other sources\":" 9813msgstr "" 9814 9815#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles 9816msgid "Error in the search path for \"Other unit files\":" 9817msgstr "" 9818 9819#: lazarusidestrconsts.liserrorintheunitoutputdirectory 9820msgid "Error in the \"unit output directory\":" 9821msgstr "" 9822 9823#: lazarusidestrconsts.liserrorinvalidbuildmode 9824#, object-pascal-format 9825msgid "Error: (lazarus) invalid build mode \"%s\"" 9826msgstr "" 9827 9828#: lazarusidestrconsts.liserrorloadingfile 9829msgid "Error loading file" 9830msgstr "" 9831 9832#: lazarusidestrconsts.liserrorloadingfile2 9833#, object-pascal-format 9834msgid "Error loading file \"%s\":" 9835msgstr "" 9836 9837#: lazarusidestrconsts.liserrorloadingfrom 9838#, object-pascal-format 9839msgid "Error loading %s from%s%s%s%s" 9840msgstr "" 9841 9842#: lazarusidestrconsts.liserrormovingcomponent 9843msgid "Error moving component" 9844msgstr "S'ha produït un error mentre es movia el component" 9845 9846#: lazarusidestrconsts.liserrormovingcomponent2 9847#, object-pascal-format 9848msgid "Error moving component %s:%s" 9849msgstr "S'ha produït un error mentre es movia el component %s:%s" 9850 9851#: lazarusidestrconsts.liserrornamingcomponent 9852msgid "Error naming component" 9853msgstr "" 9854 9855#: lazarusidestrconsts.liserroropeningcomponent 9856msgid "Error opening component" 9857msgstr "" 9858 9859#: lazarusidestrconsts.liserroropeningform 9860msgid "Error opening form" 9861msgstr "" 9862 9863#: lazarusidestrconsts.liserrorparsinglfmcomponentstream 9864msgid "Error parsing lfm component stream." 9865msgstr "" 9866 9867#: lazarusidestrconsts.liserrorreadingpackagelistfromfile 9868#, object-pascal-format 9869msgid "Error reading package list from file%s%s%s%s" 9870msgstr "S'ha produït un error mentre es llegia la llista de paquets des del fitxer%s%s%s%s" 9871 9872#: lazarusidestrconsts.liserrorreadingxml 9873msgid "Error reading XML" 9874msgstr "" 9875 9876#: lazarusidestrconsts.liserrorreadingxmlfile 9877#, object-pascal-format 9878msgid "Error reading xml file \"%s\"%s%s" 9879msgstr "" 9880 9881#: lazarusidestrconsts.liserrorrenamingfile 9882msgid "Error renaming file" 9883msgstr "S'ha produït un error mentre es canviava el nom del fitxer" 9884 9885#: lazarusidestrconsts.liserrors 9886msgctxt "lazarusidestrconsts.liserrors" 9887msgid "Errors" 9888msgstr "Errors" 9889 9890#: lazarusidestrconsts.liserrors2 9891#, object-pascal-format 9892msgid ", Errors: %s" 9893msgstr "" 9894 9895#: lazarusidestrconsts.liserrorsavingform 9896msgid "Error saving form" 9897msgstr "" 9898 9899#: lazarusidestrconsts.liserrorsavingto 9900#, object-pascal-format 9901msgid "Error saving %s to%s%s%s%s" 9902msgstr "" 9903 9904#: lazarusidestrconsts.liserrorsettingthenameofacomponentto 9905#, object-pascal-format 9906msgid "Error setting the name of a component %s to %s" 9907msgstr "" 9908 9909#: lazarusidestrconsts.liserrorwritingfile 9910#, object-pascal-format 9911msgid "Error writing file \"%s\"" 9912msgstr "" 9913 9914#: lazarusidestrconsts.liserrorwritingpackagelisttofile 9915#, object-pascal-format 9916msgid "Error writing package list to file%s%s%s%s" 9917msgstr "S'ha produït un error mentre s'escrivia la llista de paquets al fitxer%s%s%s%s" 9918 9919#: lazarusidestrconsts.lisevalexpression 9920msgctxt "lazarusidestrconsts.lisevalexpression" 9921msgid "Eval expression" 9922msgstr "" 9923 9924#: lazarusidestrconsts.lisevaluate 9925msgid "E&valuate" 9926msgstr "" 9927 9928#: lazarusidestrconsts.lisevaluateall 9929msgid "Evaluate all" 9930msgstr "" 9931 9932#: lazarusidestrconsts.lisevaluatemodify 9933msgid "&Evaluate/Modify" 9934msgstr "" 9935 9936#: lazarusidestrconsts.liseventlogclear 9937msgid "Clear Events" 9938msgstr "" 9939 9940#: lazarusidestrconsts.liseventlogoptions 9941msgid "Event Log Options ..." 9942msgstr "" 9943 9944#: lazarusidestrconsts.liseventlogsavetofile 9945msgid "Save Events to File" 9946msgstr "" 9947 9948#: lazarusidestrconsts.liseventslogaddcomment 9949msgid "Add Comment ..." 9950msgstr "" 9951 9952#: lazarusidestrconsts.liseventslogaddcomment2 9953msgid "Add Comment" 9954msgstr "" 9955 9956#: lazarusidestrconsts.liseverynthlinenumber 9957msgid "Every n-th line number" 9958msgstr "" 9959 9960#: lazarusidestrconsts.lisexamplefile 9961msgid "Example file:" 9962msgstr "" 9963 9964#: lazarusidestrconsts.lisexamplesbuildallselected 9965msgid "Build all selected" 9966msgstr "" 9967 9968#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac 9969#, object-pascal-format 9970msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" 9971msgstr "" 9972 9973#: lazarusidestrconsts.lisexamplesopenfirstselected 9974msgid "Open first selected" 9975msgstr "" 9976 9977#: lazarusidestrconsts.lisexceptiondialog 9978msgid "Debugger Exception Notification" 9979msgstr "" 9980 9981#: lazarusidestrconsts.lisexcludedatruntime 9982#, object-pascal-format 9983msgid "%s excluded at run time" 9984msgstr "" 9985 9986#: lazarusidestrconsts.lisexecutableisadirectory 9987#, object-pascal-format 9988msgid "executable \"%s\" is a directory" 9989msgstr "" 9990 9991#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun 9992#, object-pascal-format 9993msgid "executable \"%s\" lacks the permission to run" 9994msgstr "" 9995 9996#: lazarusidestrconsts.lisexecutingcommandafter 9997msgid "Executing command after" 9998msgstr "Executa l'ordre després" 9999 10000#: lazarusidestrconsts.lisexecutingcommandbefore 10001msgid "Executing command before" 10002msgstr "Executa l'ordre abans" 10003 10004#: lazarusidestrconsts.lisexecutionstopped 10005msgid "Execution stopped" 10006msgstr "S'ha aturat l'execució" 10007 10008#: lazarusidestrconsts.lisexecutionstoppedexitcode 10009#, object-pascal-format 10010msgid "Execution stopped with exit-code %1:d ($%2:s)" 10011msgstr "" 10012 10013#: lazarusidestrconsts.lisexit 10014msgctxt "lazarusidestrconsts.lisexit" 10015msgid "Exit" 10016msgstr "Surt" 10017 10018#: lazarusidestrconsts.lisexitcode 10019#, object-pascal-format 10020msgid "Exit code %s" 10021msgstr "" 10022 10023#: lazarusidestrconsts.lisexpandall 10024msgid "Expand All (*)" 10025msgstr "" 10026 10027#: lazarusidestrconsts.lisexpandallclasses 10028msgid "Expand all classes" 10029msgstr "" 10030 10031#: lazarusidestrconsts.lisexpandallpackages 10032msgid "Expand all packages" 10033msgstr "" 10034 10035#: lazarusidestrconsts.lisexpandallunits 10036msgid "Expand all units" 10037msgstr "" 10038 10039#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor 10040msgid "Expanded filename of current editor file" 10041msgstr "Nom del fitxer estès de l'actual fitxer editor" 10042 10043#: lazarusidestrconsts.lisexport 10044msgctxt "lazarusidestrconsts.lisexport" 10045msgid "Export" 10046msgstr "" 10047 10048#: lazarusidestrconsts.lisexportall 10049msgid "Export all" 10050msgstr "" 10051 10052#: lazarusidestrconsts.lisexportallitemstofile 10053msgid "Export All Items to File" 10054msgstr "" 10055 10056#: lazarusidestrconsts.lisexportenvironmentoptions 10057msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" 10058msgid "Export environment options" 10059msgstr "" 10060 10061#: lazarusidestrconsts.lisexporthtml 10062msgid "Export as HTML" 10063msgstr "" 10064 10065#: lazarusidestrconsts.lisexportimport 10066msgid "Export / Import" 10067msgstr "" 10068 10069#: lazarusidestrconsts.lisexportlist 10070msgid "Export list" 10071msgstr "Exporta la llista" 10072 10073#: lazarusidestrconsts.lisexportpackagelistxml 10074msgid "Export package list (*.xml)" 10075msgstr "" 10076 10077#: lazarusidestrconsts.lisexportselected 10078msgid "Export selected" 10079msgstr "" 10080 10081#: lazarusidestrconsts.lisexportsub 10082msgid "Export >>" 10083msgstr "" 10084 10085#: lazarusidestrconsts.lisexpression 10086msgid "Expression:" 10087msgstr "" 10088 10089#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith 10090#, object-pascal-format 10091msgid "Extend include file search path of package \"%s\" with%s\"%s\"?" 10092msgstr "" 10093 10094#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith 10095#, object-pascal-format 10096msgid "Extend include files search path of project with%s\"%s\"?" 10097msgstr "" 10098 10099#: lazarusidestrconsts.lisextendincludepath 10100msgid "Extend include path?" 10101msgstr "" 10102 10103#: lazarusidestrconsts.lisextendunitpath 10104msgid "Extend unit path?" 10105msgstr "" 10106 10107#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith 10108#, object-pascal-format 10109msgid "Extend unit search path of package \"%s\" with%s\"%s\"?" 10110msgstr "" 10111 10112#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith 10113#, object-pascal-format 10114msgid "Extend unit search path of project with%s\"%s\"?" 10115msgstr "" 10116 10117#: lazarusidestrconsts.lisextract 10118msgid "Extract" 10119msgstr "Extrau" 10120 10121#: lazarusidestrconsts.lisextractprocedure 10122#, fuzzy 10123#| msgid "Extract procedure" 10124msgctxt "lazarusidestrconsts.lisextractprocedure" 10125msgid "Extract Procedure" 10126msgstr "Extrau el procediment" 10127 10128#: lazarusidestrconsts.lisextremelyverbose 10129msgid "Extremely Verbose" 10130msgstr "" 10131 10132#: lazarusidestrconsts.lisexttoolexternaltools 10133#, fuzzy 10134#| msgid "External tools" 10135msgid "External Tools" 10136msgstr "Ferramentes Externes" 10137 10138#: lazarusidestrconsts.lisexttoolmaximumtoolsreached 10139msgid "Maximum Tools reached" 10140msgstr "Número màxim d'eines accedides" 10141 10142#: lazarusidestrconsts.lisexttoolthereisamaximumoftools 10143#, object-pascal-format 10144msgid "There is a maximum of %s tools." 10145msgstr "Hi ha un màxim de %s eines." 10146 10147#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources 10148#, object-pascal-format 10149msgid "Failed to add %d not unique resource(s)" 10150msgstr "" 10151 10152#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor 10153#, object-pascal-format 10154msgid "Failed to create Application Bundle for \"%s\"" 10155msgstr "" 10156 10157#: lazarusidestrconsts.lisfailedtoloadfoldstat 10158msgid "Failed to load fold state" 10159msgstr "" 10160 10161#: lazarusidestrconsts.lisfailedtoresolvemacros 10162msgid "failed to resolve macros" 10163msgstr "" 10164 10165#: lazarusidestrconsts.lisfailedtosavefile 10166msgid "Failed to save file." 10167msgstr "" 10168 10169#: lazarusidestrconsts.lisfatal 10170msgctxt "lazarusidestrconsts.lisfatal" 10171msgid "Fatal" 10172msgstr "" 10173 10174#: lazarusidestrconsts.lisfile 10175msgctxt "lazarusidestrconsts.lisfile" 10176msgid "File" 10177msgstr "Fitxer" 10178 10179#: lazarusidestrconsts.lisfile2 10180msgid "File: " 10181msgstr "" 10182 10183#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway 10184#, object-pascal-format, fuzzy, badformat 10185#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" 10186msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" 10187msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?" 10188msgstr "El fitxer %s%s%s%sno sembla un fitxer de text.%sEl voleu obrir igualment?" 10189 10190#: lazarusidestrconsts.lisfileextensionofprograms 10191msgid "File extension of programs" 10192msgstr "" 10193 10194#: lazarusidestrconsts.lisfilefilter 10195msgid "File filter" 10196msgstr "" 10197 10198#: lazarusidestrconsts.lisfilefilters 10199msgid "File Filters" 10200msgstr "" 10201 10202#: lazarusidestrconsts.lisfilefiltersaddrow 10203msgid "Add Row" 10204msgstr "" 10205 10206#: lazarusidestrconsts.lisfilefiltersdeleterow 10207msgid "Delete Row" 10208msgstr "" 10209 10210#: lazarusidestrconsts.lisfilefiltersinsertrow 10211msgid "Insert Row" 10212msgstr "" 10213 10214#: lazarusidestrconsts.lisfilefiltersmask 10215msgid "File mask" 10216msgstr "" 10217 10218#: lazarusidestrconsts.lisfilefilterssetdefaults 10219msgid "Set defaults" 10220msgstr "" 10221 10222#: lazarusidestrconsts.lisfilefilterstitle 10223msgid "These are file filters that will appear in all File Open dialogs" 10224msgstr "" 10225 10226#: lazarusidestrconsts.lisfilefound 10227msgid "File found" 10228msgstr "" 10229 10230#: lazarusidestrconsts.lisfilehaschangedsave 10231#, object-pascal-format 10232msgid "File \"%s\" has changed. Save?" 10233msgstr "" 10234 10235#: lazarusidestrconsts.lisfilehasnoproject 10236msgid "File has no project" 10237msgstr "" 10238 10239#: lazarusidestrconsts.lisfileisdirectory 10240msgid "File is directory" 10241msgstr "" 10242 10243#: lazarusidestrconsts.lisfileisnotanexecutable 10244msgid "File is not an executable" 10245msgstr "" 10246 10247#: lazarusidestrconsts.lisfileisnotwritable 10248msgid "File is not writable" 10249msgstr "No es pot escriure en el fitxer" 10250 10251#: lazarusidestrconsts.lisfileissymlink 10252msgid "File is symlink" 10253msgstr "" 10254 10255#: lazarusidestrconsts.lisfileisvirtual 10256#, object-pascal-format, fuzzy, badformat 10257#| msgid "File %s%s%s is virtual." 10258msgid "File \"%s\" is virtual." 10259msgstr "El fitxer %s%s%s és virtual." 10260 10261#: lazarusidestrconsts.lisfilelinkerror 10262msgid "File link error" 10263msgstr "" 10264 10265#: lazarusidestrconsts.lisfilenameaddress 10266msgid "Filename/Address" 10267msgstr "" 10268 10269#: lazarusidestrconsts.lisfilenamestyle 10270msgid "Filename Style" 10271msgstr "" 10272 10273#: lazarusidestrconsts.lisfilenotfound 10274msgid "File not found" 10275msgstr "No s'ha trobat el fitxer" 10276 10277#: lazarusidestrconsts.lisfilenotfound2 10278#, object-pascal-format, fuzzy, badformat 10279#| msgid "File %s%s%s not found.%s" 10280msgctxt "lazarusidestrconsts.lisfilenotfound2" 10281msgid "File \"%s\" not found." 10282msgstr "No s'ha trobat el fitxer %s%s%s.%s" 10283 10284#: lazarusidestrconsts.lisfilenotfound3 10285#, object-pascal-format 10286msgid "file %s not found" 10287msgstr "" 10288 10289#: lazarusidestrconsts.lisfilenotfound4 10290msgid "file not found" 10291msgstr "" 10292 10293#: lazarusidestrconsts.lisfilenotfound5 10294#, object-pascal-format 10295msgid "File not found:%s%s" 10296msgstr "" 10297 10298#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit 10299#, object-pascal-format, fuzzy, badformat 10300#| msgid "File %s%s%s not found.%sDo you want to create it?%s" 10301msgid "File \"%s\" not found.%sDo you want to create it?" 10302msgstr "No s'ha trobat el fitxer %s%s%s.%sEl voleu crear?%s" 10303 10304#: lazarusidestrconsts.lisfilenotlowercase 10305msgid "File not lowercase" 10306msgstr "El fitxer no és en minúscules" 10307 10308#: lazarusidestrconsts.lisfilenottext 10309msgid "File not text" 10310msgstr "No és un fitxer de text" 10311 10312#: lazarusidestrconsts.lisfilescountconvertedtotextformat 10313#, object-pascal-format 10314msgid "%d files were converted to text format." 10315msgstr "" 10316 10317#: lazarusidestrconsts.lisfilesettings 10318msgid "File Settings" 10319msgstr "" 10320 10321#: lazarusidestrconsts.lisfileshasincorrectsyntax 10322#, object-pascal-format 10323msgid "File %s has incorrect syntax." 10324msgstr "" 10325 10326#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection 10327#, object-pascal-format 10328msgid "Files: %s, has Register procedure: %s, in package uses section: %s" 10329msgstr "" 10330 10331#: lazarusidestrconsts.lisfileshaverightencoding 10332msgid "*** All found files already have the right encoding ***" 10333msgstr "" 10334 10335#: lazarusidestrconsts.lisfilesinasciiorutf8encoding 10336msgid "Files in ASCII or UTF-8 encoding" 10337msgstr "" 10338 10339#: lazarusidestrconsts.lisfilesisconvertedtotextformat 10340#, object-pascal-format 10341msgid "File %s was converted to text format." 10342msgstr "" 10343 10344#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding 10345msgid "Files not in ASCII nor UTF-8 encoding" 10346msgstr "" 10347 10348#: lazarusidestrconsts.lisfilewheredebugoutputiswritten 10349msgid "file where debug output is written to. If it is not specified, debug output is written to the console." 10350msgstr "" 10351 10352#: lazarusidestrconsts.lisfilter 10353msgid "Filter" 10354msgstr "" 10355 10356#: lazarusidestrconsts.lisfilter3 10357#, object-pascal-format 10358msgid "Filter: %s" 10359msgstr "" 10360 10361#: lazarusidestrconsts.lisfilterallmessagesofcertaintype 10362msgid "Filter all messages of certain type" 10363msgstr "" 10364 10365#: lazarusidestrconsts.lisfilterallmessagesoftype 10366#, object-pascal-format 10367msgid "Filter all messages of type %s" 10368msgstr "" 10369 10370#: lazarusidestrconsts.lisfilteralreadyexists 10371msgid "Filter already exists" 10372msgstr "" 10373 10374#: lazarusidestrconsts.lisfilterdebugmessagesandbelow 10375msgid "Filter Debug Messages and below" 10376msgstr "" 10377 10378#: lazarusidestrconsts.lisfilterhintsandbelow 10379msgid "Filter Hints and below" 10380msgstr "" 10381 10382#: lazarusidestrconsts.lisfilterhintswithoutsourceposition 10383msgid "Filter Hints without Source Position" 10384msgstr "" 10385 10386#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency 10387msgid "Filter None, do not filter by urgency" 10388msgstr "" 10389 10390#: lazarusidestrconsts.lisfilternonurgentmessages 10391msgid "Filter non urgent Messages" 10392msgstr "" 10393 10394#: lazarusidestrconsts.lisfilternotesandbelow 10395msgid "Filter Notes and below" 10396msgstr "" 10397 10398#: lazarusidestrconsts.lisfiltersets 10399msgid "Filter Sets" 10400msgstr "" 10401 10402#: lazarusidestrconsts.lisfiltertheavailableoptionslist 10403msgid "Filter the available options list" 10404msgstr "" 10405 10406#: lazarusidestrconsts.lisfilterverbosemessagesandbelow 10407msgid "Filter Verbose Messages and below" 10408msgstr "" 10409 10410#: lazarusidestrconsts.lisfilterwarningsandbelow 10411msgid "Filter Warnings and below" 10412msgstr "" 10413 10414#: lazarusidestrconsts.lisfind 10415msgid "Find ..." 10416msgstr "" 10417 10418#: lazarusidestrconsts.lisfinddeclarationof 10419#, object-pascal-format 10420msgid "Find Declaration of %s" 10421msgstr "" 10422 10423#: lazarusidestrconsts.lisfindfiledirectories 10424msgid "D&irectories" 10425msgstr "" 10426 10427#: lazarusidestrconsts.lisfindfilefilemask 10428msgid "Fi&le mask" 10429msgstr "" 10430 10431#: lazarusidestrconsts.lisfindfileincludesubdirectories 10432#, fuzzy 10433#| msgid "Include sub directories" 10434msgid "Include &sub directories" 10435msgstr "Inclou els subdirectoris" 10436 10437#: lazarusidestrconsts.lisfindfilemultilinepattern 10438msgid "&Multiline pattern" 10439msgstr "" 10440 10441#: lazarusidestrconsts.lisfindfilesearchallfilesinproject 10442msgid "search all files in &project" 10443msgstr "" 10444 10445#: lazarusidestrconsts.lisfindfilesearchallopenfiles 10446msgid "search all &open files" 10447msgstr "" 10448 10449#: lazarusidestrconsts.lisfindfilesearchinactivefile 10450msgid "search in &active file" 10451msgstr "" 10452 10453#: lazarusidestrconsts.lisfindfilesearchindirectories 10454msgid "search in &directories" 10455msgstr "" 10456 10457#: lazarusidestrconsts.lisfindfilessearchinprojectgroup 10458msgid "search in project &group" 10459msgstr "" 10460 10461#: lazarusidestrconsts.lisfindfilewhere 10462msgid "Where" 10463msgstr "On" 10464 10465#: lazarusidestrconsts.lisfindkeycombination 10466msgid "Find key combination" 10467msgstr "" 10468 10469#: lazarusidestrconsts.lisfindmissingunit 10470msgid "Find missing unit" 10471msgstr "" 10472 10473#: lazarusidestrconsts.lisfirst 10474msgid "First" 10475msgstr "" 10476 10477#: lazarusidestrconsts.lisfirsttest 10478msgid "&First test" 10479msgstr "" 10480 10481#: lazarusidestrconsts.lisfixlfmfile 10482msgid "Fix LFM file" 10483msgstr "Fixa el fitxer LFM" 10484 10485#: lazarusidestrconsts.lisfloatingpoin 10486msgid "Floating Point" 10487msgstr "" 10488 10489#: lazarusidestrconsts.lisfocushint 10490msgid "Focus hint" 10491msgstr "" 10492 10493#: lazarusidestrconsts.lisforcerenaming 10494msgid "Force renaming" 10495msgstr "" 10496 10497#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers 10498msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units" 10499msgstr "" 10500 10501#: lazarusidestrconsts.lisform 10502msgid "Form" 10503msgstr "" 10504 10505#: lazarusidestrconsts.lisformacosdarwin 10506msgid "For macOS (Darwin)" 10507msgstr "" 10508 10509#: lazarusidestrconsts.lisformaterror 10510msgid "Format error" 10511msgstr "S'ha produït un error de format" 10512 10513#: lazarusidestrconsts.lisforwindows 10514msgid "For Windows" 10515msgstr "" 10516 10517#: lazarusidestrconsts.lisfoundversionexpected 10518#, object-pascal-format 10519msgid "Found version %s, expected %s" 10520msgstr "" 10521 10522#: lazarusidestrconsts.lisfpcfullversioneg20701 10523msgid "FPC version as one number (e.g. 20701)" 10524msgstr "" 10525 10526#: lazarusidestrconsts.lisfpcmakefailed 10527msgid "fpcmake failed" 10528msgstr "" 10529 10530#: lazarusidestrconsts.lisfpcmessagefile2 10531msgid "FPC message file:" 10532msgstr "" 10533 10534#: lazarusidestrconsts.lisfpcmessagesappendix 10535msgid "FPC messages: Appendix" 10536msgstr "" 10537 10538#: lazarusidestrconsts.lisfpcresources 10539msgid "FPC resources (.res)" 10540msgstr "" 10541 10542#: lazarusidestrconsts.lisfpcsources 10543msgid "FPC sources" 10544msgstr "" 10545 10546#: lazarusidestrconsts.lisfpctooold 10547msgid "FPC too old" 10548msgstr "" 10549 10550#: lazarusidestrconsts.lisfpcversion 10551msgid "FPC Version: " 10552msgstr "" 10553 10554#: lazarusidestrconsts.lisfpcversioneg222 10555msgid "FPC Version (e.g. 2.2.2)" 10556msgstr "" 10557 10558#: lazarusidestrconsts.lisfpdoceditor 10559msgctxt "lazarusidestrconsts.lisfpdoceditor" 10560msgid "FPDoc Editor" 10561msgstr "" 10562 10563#: lazarusidestrconsts.lisfpdocerrorwriting 10564#, object-pascal-format 10565msgid "Error writing \"%s\"%s%s" 10566msgstr "" 10567 10568#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror 10569msgid "FPDoc syntax error" 10570msgstr "" 10571 10572#: lazarusidestrconsts.lisfpdocpackagename 10573msgid "FPDoc package name:" 10574msgstr "" 10575 10576#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename 10577msgid "FPDoc package name. Default is project file name." 10578msgstr "" 10579 10580#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement 10581#, object-pascal-format 10582msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" 10583msgstr "" 10584 10585#: lazarusidestrconsts.lisfppkgcompilernotexecutable 10586#, object-pascal-format 10587msgid "The compiler [%s] configured for Fppkg is not an executable." 10588msgstr "" 10589 10590#: lazarusidestrconsts.lisfppkgcompilernotexists 10591#, object-pascal-format 10592msgid "The compiler [%s] configured for Fppkg does not exist." 10593msgstr "" 10594 10595#: lazarusidestrconsts.lisfppkgcompilernotfound 10596#, object-pascal-format 10597msgid "Could not find the compiler [%s] configured for Fppkg." 10598msgstr "" 10599 10600#: lazarusidestrconsts.lisfppkgcompilerproblem 10601msgid "there is a problem with the Free Pascal compiler executable, " 10602msgstr "" 10603 10604#: lazarusidestrconsts.lisfppkgconfgenproblems 10605msgid "Warnings have to be resolved first" 10606msgstr "" 10607 10608#: lazarusidestrconsts.lisfppkgconfiguration 10609msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default." 10610msgstr "" 10611 10612#: lazarusidestrconsts.lisfppkgcreatefilefailed 10613#, object-pascal-format 10614msgid "Failed to generate the configuration file \"%s\": %s" 10615msgstr "" 10616 10617#: lazarusidestrconsts.lisfppkgfilestobewritten 10618msgid "Files to be written:" 10619msgstr "" 10620 10621#: lazarusidestrconsts.lisfppkgfixconfiguration 10622msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually." 10623msgstr "" 10624 10625#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed 10626msgid "Failed to retrieve the version of the fpcmkcfg configuration tool." 10627msgstr "" 10628 10629#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing 10630msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files." 10631msgstr "" 10632 10633#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded 10634msgid "An up-to-date version is needed to create the configuration files." 10635msgstr "" 10636 10637#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold 10638msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold" 10639msgid "It is probably too old to create the configuration files." 10640msgstr "" 10641 10642#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold 10643#, object-pascal-format 10644msgid "The fpcmkcfg configuration tool it too old [%s]." 10645msgstr "" 10646 10647#: lazarusidestrconsts.lisfppkginstallationpath 10648#, object-pascal-format 10649msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\"" 10650msgstr "" 10651 10652#: lazarusidestrconsts.lisfppkglibprefix 10653#, object-pascal-format 10654msgid "Fpc library prefix: %s" 10655msgstr "" 10656 10657#: lazarusidestrconsts.lisfppkgprefix 10658#, object-pascal-format 10659msgid "Fpc prefix: %s" 10660msgstr "" 10661 10662#: lazarusidestrconsts.lisfppkgproblem 10663msgid "Problem with Fppkg configuration" 10664msgstr "" 10665 10666#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded 10667msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable." 10668msgstr "" 10669 10670#: lazarusidestrconsts.lisfppkgrtlnotfound 10671msgid "Fppkg reports that the RTL is not installed." 10672msgstr "" 10673 10674#: lazarusidestrconsts.lisfppkgwriteconfexception 10675#, object-pascal-format 10676msgid "A problem occurred while trying to create a new Fppkg configuration: %s" 10677msgstr "" 10678 10679#: lazarusidestrconsts.lisfppkgwriteconffailed 10680#, object-pascal-format 10681msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal." 10682msgstr "" 10683 10684#: lazarusidestrconsts.lisfppkgwriteconfigfile 10685msgid "Write new configuration files" 10686msgstr "" 10687 10688#: lazarusidestrconsts.lisframe 10689msgid "Frame" 10690msgstr "" 10691 10692#: lazarusidestrconsts.lisfrbackwardsearch 10693msgid "&Backward search" 10694msgstr "" 10695 10696#: lazarusidestrconsts.lisfreeingbufferlines 10697#, object-pascal-format 10698msgid "freeing buffer lines: %s" 10699msgstr "" 10700 10701#: lazarusidestrconsts.lisfreepascalcompilermessages 10702msgid "Free Pascal Compiler messages" 10703msgstr "" 10704 10705#: lazarusidestrconsts.lisfreepascalprefix 10706msgid "Free Pascal compiler prefix" 10707msgstr "" 10708 10709#: lazarusidestrconsts.lisfreepascalsourcedirectory 10710#, fuzzy 10711#| msgid "Freepascal source directory" 10712msgid "Free Pascal source directory" 10713msgstr "Directori del codi font del FreePascal" 10714 10715#: lazarusidestrconsts.lisfrforwardsearch 10716msgid "Forwar&d search" 10717msgstr "" 10718 10719#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp 10720msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" 10721msgstr "Fitxers addicionals a cercar (p.e. /trajectòria/*.pas;/trajec2/*.pp)" 10722 10723#: lazarusidestrconsts.lisfrifindorrenameidentifier 10724msgid "Find or Rename Identifier" 10725msgstr "Cerca o reanomena l'identificador" 10726 10727#: lazarusidestrconsts.lisfrifindreferences 10728msgid "Find References" 10729msgstr "Cerca les referències" 10730 10731#: lazarusidestrconsts.lisfriidentifier 10732#, object-pascal-format 10733msgid "Identifier: %s" 10734msgstr "Identificador: %s" 10735 10736#: lazarusidestrconsts.lisfriinallopenpackagesandprojects 10737msgid "in all open packages and projects" 10738msgstr "en tots els projectes i paquets oberts" 10739 10740#: lazarusidestrconsts.lisfriincurrentunit 10741msgid "in current unit" 10742msgstr "en la unitat actual" 10743 10744#: lazarusidestrconsts.lisfriinmainproject 10745msgid "in main project" 10746msgstr "en el projecte principal" 10747 10748#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit 10749msgid "in project/package owning current unit" 10750msgstr "en el projecte/paquet que es propietari de la unitat actual" 10751 10752#: lazarusidestrconsts.lisfriinvalididentifier 10753msgid "Invalid Identifier" 10754msgstr "L'identificador no és vàlid" 10755 10756#: lazarusidestrconsts.lisfrirenameallreferences 10757msgid "Rename all References" 10758msgstr "Canvia el nom de totes les referències" 10759 10760#: lazarusidestrconsts.lisfrirenaming 10761msgid "Renaming" 10762msgstr "" 10763 10764#: lazarusidestrconsts.lisfrisearch 10765msgid "Search" 10766msgstr "" 10767 10768#: lazarusidestrconsts.lisfrisearchincommentstoo 10769msgid "Search in comments too" 10770msgstr "Cerca també en els comentaris" 10771 10772#: lazarusidestrconsts.lisfull 10773msgid "Full" 10774msgstr "" 10775 10776#: lazarusidestrconsts.lisfunction 10777msgctxt "lazarusidestrconsts.lisfunction" 10778msgid "Function" 10779msgstr "" 10780 10781#: lazarusidestrconsts.lisgeneral 10782msgctxt "lazarusidestrconsts.lisgeneral" 10783msgid "General" 10784msgstr "General" 10785 10786#: lazarusidestrconsts.lisgeneratefppkgcfg 10787#, object-pascal-format 10788msgid "Fppkg configuration: %s" 10789msgstr "" 10790 10791#: lazarusidestrconsts.lisgeneratefppkgcompcfg 10792#, object-pascal-format 10793msgid "Fppkg compiler configuration: %s" 10794msgstr "" 10795 10796#: lazarusidestrconsts.lisgeneratefppkgconfiguration 10797msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool." 10798msgstr "" 10799 10800#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption 10801msgid "Generate new Fppkg configuration files" 10802msgstr "" 10803 10804#: lazarusidestrconsts.lisgetwordatcurrentcursorposition 10805msgid "get word at current cursor position" 10806msgstr "" 10807 10808#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2 10809msgid "Get word at current cursor position." 10810msgstr "" 10811 10812#: lazarusidestrconsts.lisglobalsettings 10813msgid "Global settings" 10814msgstr "" 10815 10816#: lazarusidestrconsts.lisgotoline 10817msgid "Goto Line" 10818msgstr "" 10819 10820#: lazarusidestrconsts.lisgotoselected 10821msgid "Goto selected" 10822msgstr "" 10823 10824#: lazarusidestrconsts.lisgplnotice 10825msgid "" 10826"<description>\n" 10827"\n" 10828"Copyright (C) <year> <name of author> <contact>\n" 10829"\n" 10830"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 10831"\n" 10832"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" 10833"\n" 10834"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 10835msgstr "" 10836 10837#: lazarusidestrconsts.lisgroup 10838msgid "Group" 10839msgstr "" 10840 10841#: lazarusidestrconsts.lisgroupassignexisting 10842#, object-pascal-format 10843msgid "Assign to existing \"%s\" group?" 10844msgstr "" 10845 10846#: lazarusidestrconsts.lisgroupemptydelete 10847#, object-pascal-format 10848msgid "No more breakpoints are assigned to group \"%s\", delete it?" 10849msgstr "" 10850 10851#: lazarusidestrconsts.lisgroupemptydeletemore 10852#, object-pascal-format 10853msgid "%sThere are %d more empty groups, delete all?" 10854msgstr "" 10855 10856#: lazarusidestrconsts.lisgrouplocalvariables 10857msgid "Group automatically defined local variables" 10858msgstr "" 10859 10860#: lazarusidestrconsts.lisgroupnameemptyclearinstead 10861msgid "The group name cannot be empty. Clear breakpoints' group(s)?" 10862msgstr "" 10863 10864#: lazarusidestrconsts.lisgroupnameinput 10865msgid "Group name:" 10866msgstr "" 10867 10868#: lazarusidestrconsts.lisgroupnameinvalid 10869msgid "BreakpointGroup name must be a valid Pascal identifier name." 10870msgstr "" 10871 10872#: lazarusidestrconsts.lisgroupsetnew 10873msgid "Set new group ..." 10874msgstr "" 10875 10876#: lazarusidestrconsts.lisgroupsetnone 10877msgid "Clear group(s)" 10878msgstr "" 10879 10880#: lazarusidestrconsts.lisgroupsfordebugoutput 10881msgid "Enable or Disable groups of debug output. Valid Options are:" 10882msgstr "" 10883 10884#: lazarusidestrconsts.lisgrowtolarges 10885msgid "Grow to Largest" 10886msgstr "" 10887 10888#: lazarusidestrconsts.lishashelp 10889msgid "Has Help" 10890msgstr "" 10891 10892#: lazarusidestrconsts.lisheadercolors 10893msgid "Header colors" 10894msgstr "" 10895 10896#: lazarusidestrconsts.lisheadercommentforclass 10897msgid "Header comment for class" 10898msgstr "Comentari de capçalera per a la classe" 10899 10900#: lazarusidestrconsts.lishelp 10901msgctxt "lazarusidestrconsts.lishelp" 10902msgid "Help" 10903msgstr "Ajuda" 10904 10905#: lazarusidestrconsts.lishelpentries 10906msgid "Help entries" 10907msgstr "" 10908 10909#: lazarusidestrconsts.lishelpselectordialog 10910msgid "Help selector" 10911msgstr "" 10912 10913#: lazarusidestrconsts.lishexadecimal 10914msgid "Hexadecimal" 10915msgstr "" 10916 10917#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage 10918msgid "Help for Free Pascal Compiler message" 10919msgstr "" 10920 10921#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh 10922msgid "Hide all hints and warnings by inserting IDE directives {%H-}" 10923msgstr "" 10924 10925#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh 10926msgid "Hide message at %s by inserting IDE directive {%H-}" 10927msgstr "" 10928 10929#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh 10930msgid "Hide message by inserting IDE directive {%H-}" 10931msgstr "" 10932 10933#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit 10934#, object-pascal-format 10935msgid "Hide message by inserting {$warn %s off} to unit \"%s\"" 10936msgstr "" 10937 10938#: lazarusidestrconsts.lishidesearch 10939msgid "Hide Search" 10940msgstr "" 10941 10942#: lazarusidestrconsts.lishidewindow 10943msgctxt "lazarusidestrconsts.lishidewindow" 10944msgid "Hide window" 10945msgstr "" 10946 10947#: lazarusidestrconsts.lishidewithpackageoptionvm 10948#, object-pascal-format 10949msgid "Hide with package option (-vm%s)" 10950msgstr "" 10951 10952#: lazarusidestrconsts.lishidewithprojectoptionvm 10953#, object-pascal-format 10954msgid "Hide with project option (-vm%s)" 10955msgstr "" 10956 10957#: lazarusidestrconsts.lishint 10958msgctxt "lazarusidestrconsts.lishint" 10959msgid "Hint" 10960msgstr "" 10961 10962#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals 10963msgid "Hint: A default value can be defined in the conditionals." 10964msgstr "" 10965 10966#: lazarusidestrconsts.lishintatpropertysnameshowsdescription 10967msgid "A hint at property's name shows its description." 10968msgstr "" 10969 10970#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename 10971msgid "Hint: Check if two packages contain a unit with the same name." 10972msgstr "" 10973 10974#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths 10975msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from." 10976msgstr "" 10977 10978#: lazarusidestrconsts.lishints 10979#, object-pascal-format 10980msgid ", Hints: %s" 10981msgstr "" 10982 10983#: lazarusidestrconsts.lishintsaveall 10984msgid "Save all" 10985msgstr "Desa-ho tot" 10986 10987#: lazarusidestrconsts.lishintstepinto 10988msgid "Step Into" 10989msgstr "Pas a pas per instruccions" 10990 10991#: lazarusidestrconsts.lishintstepout 10992msgid "Run until function returns" 10993msgstr "" 10994 10995#: lazarusidestrconsts.lishintstepover 10996msgid "Step Over" 10997msgstr "Pas a pas per funcions" 10998 10999#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon 11000#, object-pascal-format 11001msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." 11002msgstr "Suggeriment: La funció de la cadena del recurs espera una constant de cadena.%sSi us plau, seleccioneu l'expressió i torneu-ho a provar." 11003 11004#: lazarusidestrconsts.lishinttoggleformunit 11005msgid "Toggle Form/Unit" 11006msgstr "Canvia forma/unitat" 11007 11008#: lazarusidestrconsts.lishintviewforms 11009msgid "View Forms" 11010msgstr "Mostra les formes" 11011 11012#: lazarusidestrconsts.lishintviewunits 11013msgid "View Units" 11014msgstr "Mostra les unitats" 11015 11016#: lazarusidestrconsts.lishitcount 11017msgid "Hitcount" 11018msgstr "" 11019 11020#: lazarusidestrconsts.lishlpoptsdatabases 11021msgid "Databases" 11022msgstr "Base de dades" 11023 11024#: lazarusidestrconsts.lishlpoptshelpoptions 11025msgid "Help Options" 11026msgstr "Opcions de l'ajuda" 11027 11028#: lazarusidestrconsts.lishlpoptsproperties 11029msgid "Properties:" 11030msgstr "Propietats:" 11031 11032#: lazarusidestrconsts.lishlpoptsviewers 11033msgid "Viewers" 11034msgstr "Visualitzadors" 11035 11036#: lazarusidestrconsts.lishofpcdochtmlpath 11037msgid "FPC Doc HTML Path" 11038msgstr "" 11039 11040#: lazarusidestrconsts.lishorizontal 11041msgid "Horizontal" 11042msgstr "Horitzontal" 11043 11044#: lazarusidestrconsts.lishorizontallinesbetweenproperties 11045msgid "Horizontal lines between properties." 11046msgstr "" 11047 11048#: lazarusidestrconsts.lisid 11049msgctxt "lazarusidestrconsts.lisid" 11050msgid "ID" 11051msgstr "ID" 11052 11053#: lazarusidestrconsts.lisidcaddition 11054msgid "Addition" 11055msgstr "" 11056 11057#: lazarusidestrconsts.lisidcopening 11058msgid "Opening" 11059msgstr "" 11060 11061#: lazarusidestrconsts.liside 11062msgid "IDE" 11063msgstr "" 11064 11065#: lazarusidestrconsts.lisidebuildoptions 11066msgid "IDE build options" 11067msgstr "" 11068 11069#: lazarusidestrconsts.lisidecompileandrestart 11070msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages." 11071msgstr "" 11072 11073#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus 11074#, object-pascal-format 11075msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s" 11076msgstr "" 11077 11078#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage 11079#, object-pascal-format 11080msgid "Creating Makefile for package %s" 11081msgstr "" 11082 11083#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage 11084#, object-pascal-format 11085msgid "Error: running 'compile after' tool failed for package %s" 11086msgstr "" 11087 11088#: lazarusidestrconsts.lisideinfoinformationabouttheide 11089msgid "Information about the IDE" 11090msgstr "" 11091 11092#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage 11093#, object-pascal-format 11094msgid "WARNING: unit name invalid %s, package=%s" 11095msgstr "" 11096 11097#: lazarusidestrconsts.lisidemacros 11098msgid "IDE Macros" 11099msgstr "" 11100 11101#: lazarusidestrconsts.lisidemaintainsscaledinmainunit 11102msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit." 11103msgstr "" 11104 11105#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit 11106msgid "The IDE maintains the title in main unit." 11107msgstr "" 11108 11109#: lazarusidestrconsts.lisidentifier 11110msgid "identifier" 11111msgstr "" 11112 11113#: lazarusidestrconsts.lisidentifierbeginswith 11114msgid "Identifier begins with ..." 11115msgstr "" 11116 11117#: lazarusidestrconsts.lisidentifiercontains 11118msgid "Identifier contains ..." 11119msgstr "" 11120 11121#: lazarusidestrconsts.lisideoptions 11122msgid "IDE Options:" 11123msgstr "Opcions IDE:" 11124 11125#: lazarusidestrconsts.lisidetitleshowsbuildmode 11126msgid "IDE title shows selected build mode" 11127msgstr "" 11128 11129#: lazarusidestrconsts.lisidetitleshowsprojectdir 11130msgid "IDE title shows project directory" 11131msgstr "" 11132 11133#: lazarusidestrconsts.lisidetitlestartswithprojectname 11134msgid "IDE title starts with project name" 11135msgstr "" 11136 11137#: lazarusidestrconsts.lisiecoallbuildmodes 11138msgid "All build modes" 11139msgstr "" 11140 11141#: lazarusidestrconsts.lisiecocompileroptionsof 11142msgid "Compiler options of" 11143msgstr "" 11144 11145#: lazarusidestrconsts.lisiecocurrentbuildmode 11146msgid "Current build mode" 11147msgstr "" 11148 11149#: lazarusidestrconsts.lisiecoerroropeningxml 11150msgid "Error opening XML" 11151msgstr "" 11152 11153#: lazarusidestrconsts.lisiecoerroropeningxmlfile 11154#, object-pascal-format 11155msgid "Error opening XML file \"%s\":%s%s" 11156msgstr "" 11157 11158#: lazarusidestrconsts.lisiecoexportcompileroptions 11159msgid "Export Compiler Options" 11160msgstr "" 11161 11162#: lazarusidestrconsts.lisiecoexportfileexists 11163msgid "Export file exists" 11164msgstr "" 11165 11166#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti 11167#, object-pascal-format 11168msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" 11169msgstr "" 11170 11171#: lazarusidestrconsts.lisiecoimportcompileroptions 11172msgid "Import Compiler Options" 11173msgstr "" 11174 11175#: lazarusidestrconsts.lisiecoloadfromfile 11176msgid "Load from file" 11177msgstr "Carrega des de l'arxiu" 11178 11179#: lazarusidestrconsts.lisieconocompileroptionsinfile 11180#, object-pascal-format 11181msgid "File \"%s\" does not contain compiler options." 11182msgstr "" 11183 11184#: lazarusidestrconsts.lisiecorecentfiles 11185msgid "Recent files" 11186msgstr "Arxius recents" 11187 11188#: lazarusidestrconsts.lisiecosavetofile 11189msgid "Save to file" 11190msgstr "Desa a l'arxiu" 11191 11192#: lazarusidestrconsts.lisifnotchecked 11193msgid "If not checked:" 11194msgstr "" 11195 11196#: lazarusidestrconsts.lisifonlysessioninfochangedthenask 11197msgid "If only the session info changed, ask about saving it." 11198msgstr "" 11199 11200#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst 11201#, object-pascal-format 11202msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" 11203msgstr "" 11204 11205#: lazarusidestrconsts.lisignore 11206#, fuzzy 11207msgctxt "lazarusidestrconsts.lisignore" 11208msgid "Ignore" 11209msgstr "Ignora" 11210 11211#: lazarusidestrconsts.lisignoreall 11212msgid "Ignore all" 11213msgstr "" 11214 11215#: lazarusidestrconsts.lisignoreandcontinue 11216msgid "Ignore and continue" 11217msgstr "" 11218 11219#: lazarusidestrconsts.lisignoreexceptiontype 11220msgid "Ignore this exception type" 11221msgstr "" 11222 11223#: lazarusidestrconsts.lisignoreuseasancestor 11224#, object-pascal-format 11225msgid "Ignore, use %s as ancestor" 11226msgstr "" 11227 11228#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage 11229msgid "Imitate indentation of current unit, project or package" 11230msgstr "" 11231 11232#: lazarusidestrconsts.lisimplementationcommentforclass 11233msgid "Implementation comment for class" 11234msgstr "" 11235 11236#: lazarusidestrconsts.lisimport 11237msgctxt "lazarusidestrconsts.lisimport" 11238msgid "Import" 11239msgstr "" 11240 11241#: lazarusidestrconsts.lisimportant 11242msgctxt "lazarusidestrconsts.lisimportant" 11243msgid "Important" 11244msgstr "" 11245 11246#: lazarusidestrconsts.lisimportenvironmentoptions 11247msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" 11248msgid "Import environment options" 11249msgstr "" 11250 11251#: lazarusidestrconsts.lisimportfromfile 11252msgid "Import from File" 11253msgstr "" 11254 11255#: lazarusidestrconsts.lisimportingbuildmodesnotsupported 11256msgid "Importing BuildModes is not supported for packages." 11257msgstr "" 11258 11259#: lazarusidestrconsts.lisimportlist 11260msgid "Import list" 11261msgstr "importar la llista" 11262 11263#: lazarusidestrconsts.lisimportpackagelistxml 11264msgid "Import package list (*.xml)" 11265msgstr "" 11266 11267#: lazarusidestrconsts.lisimpossible 11268msgid "Impossible" 11269msgstr "" 11270 11271#: lazarusidestrconsts.lisinasourcedirectoryofthepackage 11272#, object-pascal-format 11273msgid "In a source directory of the package \"%s\"." 11274msgstr "" 11275 11276#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates 11277msgid "In a source directory of the project. Check for duplicates." 11278msgstr "" 11279 11280#: lazarusidestrconsts.lisincludeallsubdirectories 11281msgid "Include all subdirectories" 11282msgstr "" 11283 11284#: lazarusidestrconsts.lisincludefilter 11285msgid "Include filter" 11286msgstr "" 11287 11288#: lazarusidestrconsts.lisincludepath 11289msgid "include path" 11290msgstr "trajectòria dels fitxers inclosos" 11291 11292#: lazarusidestrconsts.lisincludepaths 11293msgid "Include paths" 11294msgstr "" 11295 11296#: lazarusidestrconsts.lisincludesubdirectories 11297msgid "Include subdirectories" 11298msgstr "" 11299 11300#: lazarusidestrconsts.lisincompatibleppu 11301#, object-pascal-format 11302msgid ", incompatible ppu=%s" 11303msgstr "" 11304 11305#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound 11306msgid "Incorrect configuration directory found" 11307msgstr "" 11308 11309#: lazarusidestrconsts.lisincorrectfppkgconfiguration 11310#, object-pascal-format 11311msgid "there is a problem with the Fppkg configuration. (%s)" 11312msgstr "" 11313 11314#: lazarusidestrconsts.lisindentationforpascalsources 11315msgid "Indentation for Pascal sources" 11316msgstr "" 11317 11318#: lazarusidestrconsts.lisindex 11319msgid "Index" 11320msgstr "" 11321 11322#: lazarusidestrconsts.lisinformation 11323msgid "Information" 11324msgstr "" 11325 11326#: lazarusidestrconsts.lisinformationaboutunit 11327#, object-pascal-format 11328msgid "Information about %s" 11329msgstr "Informació de %s" 11330 11331#: lazarusidestrconsts.lisinformationaboutusedfpc 11332msgid "Information about used FPC" 11333msgstr "" 11334 11335#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag 11336msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." 11337msgstr "" 11338 11339#: lazarusidestrconsts.lisinfrontofrelated 11340msgid "In front of related" 11341msgstr "" 11342 11343#: lazarusidestrconsts.lisinheriteditem 11344msgid "Inherited Item" 11345msgstr "" 11346 11347#: lazarusidestrconsts.lisinheritedparameters 11348msgid "Inherited parameters" 11349msgstr "" 11350 11351#: lazarusidestrconsts.lisinheritedprojectcomponent 11352msgid "Inherited project component" 11353msgstr "" 11354 11355#: lazarusidestrconsts.lisinitializelocalvariable 11356msgid "Initialize Local Variable" 11357msgstr "" 11358 11359#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil 11360#, object-pascal-format 11361msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" 11362msgstr "" 11363 11364#: lazarusidestrconsts.lisinsert 11365msgctxt "lazarusidestrconsts.lisinsert" 11366msgid "Insert" 11367msgstr "Insereix" 11368 11369#: lazarusidestrconsts.lisinsertassignment 11370#, object-pascal-format 11371msgid "Insert Assignment %s := ..." 11372msgstr "" 11373 11374#: lazarusidestrconsts.lisinsertdate 11375msgid "insert date" 11376msgstr "" 11377 11378#: lazarusidestrconsts.lisinsertdateandtime 11379msgid "insert date and time" 11380msgstr "" 11381 11382#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring 11383msgid "Insert date and time. Optional: format string." 11384msgstr "" 11385 11386#: lazarusidestrconsts.lisinsertdateoptionalformatstring 11387msgid "Insert date. Optional: format string." 11388msgstr "" 11389 11390#: lazarusidestrconsts.lisinsertendifneeded 11391msgid "insert end if needed" 11392msgstr "" 11393 11394#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure 11395msgid "" 11396"Insert header of current procedure.\n" 11397"\n" 11398"Optional Parameters (comma separated):\n" 11399"WithStart, // proc keyword e.g. 'function', 'class procedure'\n" 11400"WithoutClassKeyword,// without 'class' proc keyword\n" 11401"AddClassName, // extract/add ClassName.\n" 11402"WithoutClassName, // skip classname\n" 11403"WithoutName, // skip function name\n" 11404"WithoutParamList, // skip param list\n" 11405"WithVarModifiers, // extract 'var', 'out', 'const'\n" 11406"WithParameterNames, // extract parameter names\n" 11407"WithoutParamTypes, // skip colon, param types and default values\n" 11408"WithDefaultValues, // extract default values\n" 11409"WithResultType, // extract colon + result type\n" 11410"WithOfObject, // extract 'of object'\n" 11411"WithCallingSpecs, // extract cdecl; inline;\n" 11412"WithProcModifiers, // extract forward; alias; external;\n" 11413"WithComments, // extract comments and spaces\n" 11414"InUpperCase, // turn to uppercase\n" 11415"CommentsToSpace, // replace comments with a single space\n" 11416" // (default is to skip unnecessary space,\n" 11417" // e.g 'Do ;' normally becomes 'Do;'\n" 11418" // with this option you get 'Do ;')\n" 11419"WithoutBrackets, // skip start- and end-bracket of parameter list\n" 11420"WithoutSemicolon, // skip semicolon at end\n" 11421msgstr "" 11422 11423#: lazarusidestrconsts.lisinsertmacro 11424msgctxt "lazarusidestrconsts.lisinsertmacro" 11425msgid "Insert Macro" 11426msgstr "Insereix Macroinstrucció" 11427 11428#: lazarusidestrconsts.lisinsertnameofcurrentprocedure 11429msgid "Insert name of current procedure." 11430msgstr "" 11431 11432#: lazarusidestrconsts.lisinsertprintshorttag 11433msgid "Insert PrintShort tag" 11434msgstr "" 11435 11436#: lazarusidestrconsts.lisinsertprintshorttag2 11437msgid "Insert printshort tag" 11438msgstr "" 11439 11440#: lazarusidestrconsts.lisinsertprocedurehead 11441msgid "insert procedure head" 11442msgstr "" 11443 11444#: lazarusidestrconsts.lisinsertprocedurename 11445msgid "insert procedure name" 11446msgstr "" 11447 11448#: lazarusidestrconsts.lisinsertsemicolonifneeded 11449msgid "Insert semicolon if needed" 11450msgstr "" 11451 11452#: lazarusidestrconsts.lisinserttime 11453msgid "insert time" 11454msgstr "" 11455 11456#: lazarusidestrconsts.lisinserttimeoptionalformatstring 11457msgid "Insert time. Optional: format string." 11458msgstr "" 11459 11460#: lazarusidestrconsts.lisinserturltag 11461msgid "Insert url tag" 11462msgstr "" 11463 11464#: lazarusidestrconsts.lisinsession 11465msgid "In session" 11466msgstr "" 11467 11468#: lazarusidestrconsts.lisinspect 11469msgid "&Inspect" 11470msgstr "" 11471 11472#: lazarusidestrconsts.lisinspectaddwatch 11473msgctxt "lazarusidestrconsts.lisinspectaddwatch" 11474msgid "Add watch" 11475msgstr "" 11476 11477#: lazarusidestrconsts.lisinspectclassinherit 11478#, object-pascal-format 11479msgid "%s: class %s inherits from %s" 11480msgstr "" 11481 11482#: lazarusidestrconsts.lisinspectdata 11483msgid "Data" 11484msgstr "" 11485 11486#: lazarusidestrconsts.lisinspectdialog 11487msgid "Debug Inspector" 11488msgstr "" 11489 11490#: lazarusidestrconsts.lisinspectmethods 11491msgid "Methods" 11492msgstr "" 11493 11494#: lazarusidestrconsts.lisinspectpointerto 11495#, object-pascal-format 11496msgid "Pointer to %s" 11497msgstr "" 11498 11499#: lazarusidestrconsts.lisinspectproperties 11500msgctxt "lazarusidestrconsts.lisinspectproperties" 11501msgid "Properties" 11502msgstr "" 11503 11504#: lazarusidestrconsts.lisinspectshowcolclass 11505msgid "Show class column" 11506msgstr "" 11507 11508#: lazarusidestrconsts.lisinspectshowcoltype 11509msgid "Show type column" 11510msgstr "" 11511 11512#: lazarusidestrconsts.lisinspectshowcolvisibility 11513msgid "Show visibility column" 11514msgstr "" 11515 11516#: lazarusidestrconsts.lisinspectunavailableerror 11517#, object-pascal-format 11518msgid "%s: unavailable (error: %s)" 11519msgstr "" 11520 11521#: lazarusidestrconsts.lisinspectuseinstance 11522msgid "Instance" 11523msgstr "" 11524 11525#: lazarusidestrconsts.lisinspectuseinstancehint 11526msgid "Use instance class" 11527msgstr "" 11528 11529#: lazarusidestrconsts.lisinstallationfailed 11530msgid "Installation failed" 11531msgstr "Instal·lació fallida" 11532 11533#: lazarusidestrconsts.lisinstalled 11534msgid "installed" 11535msgstr "" 11536 11537#: lazarusidestrconsts.lisinstallitilikethefat 11538msgid "Install it, I like the fat" 11539msgstr "" 11540 11541#: lazarusidestrconsts.lisinstallpackagesmsg 11542#, object-pascal-format 11543msgid "" 11544"The following packages are not installed, but available in the main repository: %s.\n" 11545"Do you wish to install missing packages?" 11546msgstr "" 11547 11548#: lazarusidestrconsts.lisinstallselection 11549msgid "Install selection" 11550msgstr "Instal·la la selecció" 11551 11552#: lazarusidestrconsts.lisinstalluninstallpackages 11553msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" 11554msgid "Install/Uninstall Packages" 11555msgstr "" 11556 11557#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile 11558msgid "Instead of compile package create a simple Makefile." 11559msgstr "" 11560 11561#: lazarusidestrconsts.lisinsufficientencoding 11562msgid "Insufficient encoding" 11563msgstr "" 11564 11565#: lazarusidestrconsts.lisinteractive 11566msgid "Interactive" 11567msgstr "" 11568 11569#: lazarusidestrconsts.lisinternalerror 11570#, object-pascal-format 11571msgid "internal error: %s" 11572msgstr "" 11573 11574#: lazarusidestrconsts.lisinvaliddelete 11575msgid "Invalid delete" 11576msgstr "L'eliminació no és vàlida" 11577 11578#: lazarusidestrconsts.lisinvalidexecutable 11579msgid "Invalid Executable" 11580msgstr "" 11581 11582#: lazarusidestrconsts.lisinvalidexecutablemessagetext 11583#, object-pascal-format 11584msgid "The file \"%s\" is not executable." 11585msgstr "" 11586 11587#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction 11588#, object-pascal-format 11589msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." 11590msgstr "L'expressió no és vàlida.%sSuggeriment: La funció de la cadena del recurs espera una constant de cadena en un sol fitxer. Si us plau, seleccioneu l'expressió i torneu-ho a provar." 11591 11592#: lazarusidestrconsts.lisinvalidfilename 11593msgid "Invalid file name" 11594msgstr "" 11595 11596#: lazarusidestrconsts.lisinvalidfilter 11597msgid "Invalid filter" 11598msgstr "" 11599 11600#: lazarusidestrconsts.lisinvalidlinecolumninmessage 11601#, object-pascal-format 11602msgid "Invalid line, column in message%s%s" 11603msgstr "" 11604 11605#: lazarusidestrconsts.lisinvalidmacrosin 11606#, object-pascal-format 11607msgid "Invalid macros in \"%s\"" 11608msgstr "" 11609 11610#: lazarusidestrconsts.lisinvalidmacrosinexternaltool 11611#, object-pascal-format 11612msgid "Invalid macros \"%s\" in external tool \"%s\"" 11613msgstr "" 11614 11615#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie 11616#, object-pascal-format 11617msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." 11618msgstr "" 11619 11620#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword 11621#, object-pascal-format 11622msgid "Invalid macro name \"%s\". The name is a keyword." 11623msgstr "" 11624 11625#: lazarusidestrconsts.lisinvalidmask 11626msgid "Invalid Mask" 11627msgstr "" 11628 11629#: lazarusidestrconsts.lisinvalidmode 11630#, object-pascal-format 11631msgid "Invalid mode %s" 11632msgstr "" 11633 11634#: lazarusidestrconsts.lisinvalidmultiselection 11635msgid "Invalid multiselection" 11636msgstr "La multiselecció no és vàlida" 11637 11638#: lazarusidestrconsts.lisinvalidoff 11639msgid "Invalid (Off)" 11640msgstr "" 11641 11642#: lazarusidestrconsts.lisinvalidon 11643msgid "Invalid (On)" 11644msgstr "" 11645 11646#: lazarusidestrconsts.lisinvalidpascalidentifiercap 11647msgid "Invalid Pascal Identifier" 11648msgstr "L'identificador de Pascal no és vàlid" 11649 11650#: lazarusidestrconsts.lisinvalidpascalidentifiername 11651#, object-pascal-format 11652msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?" 11653msgstr "" 11654 11655#: lazarusidestrconsts.lisinvalidprocname 11656msgid "Invalid proc name" 11657msgstr "El nom del procediment no és vàlid" 11658 11659#: lazarusidestrconsts.lisinvalidprojectfilename 11660msgid "Invalid project filename" 11661msgstr "El nom del fitxer del projecte no és vàlid" 11662 11663#: lazarusidestrconsts.lisinvalidpublishingdirectory 11664msgid "Invalid publishing Directory" 11665msgstr "" 11666 11667#: lazarusidestrconsts.lisinvalidselection 11668msgid "Invalid selection" 11669msgstr "La selecció no és vàlida" 11670 11671#: lazarusidestrconsts.lisinvalidversionin 11672#, object-pascal-format 11673msgid "invalid version in %s" 11674msgstr "" 11675 11676#: lazarusidestrconsts.lisisalreadypartoftheproject 11677#, object-pascal-format 11678msgid "%s is already part of the Project." 11679msgstr "%s ja forma part del Projecte." 11680 11681#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject 11682#, object-pascal-format, fuzzy, badformat 11683#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" 11684msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" 11685msgstr "%s%s%s no és un nom de projecte vàlid. %s Si us plau, escolliu-ne un altre (p.e. project1.lpi)" 11686 11687#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed 11688#, object-pascal-format 11689msgid "%s is a %s.%sThis circular dependency is not allowed." 11690msgstr "" 11691 11692#: lazarusidestrconsts.lisisddirectorynotfound 11693msgid "directory not found" 11694msgstr "" 11695 11696#: lazarusidestrconsts.lisissues 11697msgid "Issues" 11698msgstr "" 11699 11700#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe 11701#, object-pascal-format 11702msgid "I wonder how you did that. Error in the %s:" 11703msgstr "" 11704 11705#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory 11706msgid "I wonder how you did that: Error in the base directory:" 11707msgstr "" 11708 11709#: lazarusidestrconsts.lisjhjumphistory 11710#, fuzzy 11711#| msgid "Jump History ..." 11712msgctxt "lazarusidestrconsts.lisjhjumphistory" 11713msgid "Jump History" 11714msgstr "Mostra la història dels salts ..." 11715 11716#: lazarusidestrconsts.lisjumptoerror 11717msgid "Jump to error" 11718msgstr "" 11719 11720#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion 11721msgid "When an error in the sources is found at identifier completion, jump to it." 11722msgstr "" 11723 11724#: lazarusidestrconsts.lisjumptoprocedure 11725#, object-pascal-format 11726msgid "Jump to procedure %s" 11727msgstr "" 11728 11729#: lazarusidestrconsts.liskb 11730#, object-pascal-format 11731msgid "%s KB" 11732msgstr "" 11733 11734#: lazarusidestrconsts.liskeep2 11735msgid "Keep" 11736msgstr "" 11737 11738#: lazarusidestrconsts.liskeepfileopen 11739msgid "Keep converted files open in editor" 11740msgstr "" 11741 11742#: lazarusidestrconsts.liskeepfileopenhint 11743msgid "All project files will be open in editor after conversion" 11744msgstr "" 11745 11746#: lazarusidestrconsts.liskeepininstalllist 11747msgid "Keep in install list" 11748msgstr "" 11749 11750#: lazarusidestrconsts.liskeepname 11751msgid "Keep name" 11752msgstr "Manté el nom" 11753 11754#: lazarusidestrconsts.liskeepopen 11755msgid "Keep open" 11756msgstr "" 11757 11758#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate 11759msgid "Keep relative indentation of multi line template" 11760msgstr "" 11761 11762#: lazarusidestrconsts.liskeepsubindentation 11763msgid "Keep indentation" 11764msgstr "" 11765 11766#: lazarusidestrconsts.liskeepthemandcontinue 11767msgid "Keep them and continue" 11768msgstr "Mantin-los i continua" 11769 11770#: lazarusidestrconsts.liskey 11771msgctxt "lazarusidestrconsts.liskey" 11772msgid "Key" 11773msgstr "Tecla" 11774 11775#: lazarusidestrconsts.liskeycatcustom 11776msgid "Custom commands" 11777msgstr "Ordres personalitzades" 11778 11779#: lazarusidestrconsts.liskeycatdesigner 11780msgid "Designer commands" 11781msgstr "Ordres del dissenyador" 11782 11783#: lazarusidestrconsts.liskeycatobjinspector 11784msgid "Object Inspector commands" 11785msgstr "" 11786 11787#: lazarusidestrconsts.liskeyor2keysequence 11788msgid "Key (or 2 key sequence)" 11789msgstr "" 11790 11791#: lazarusidestrconsts.liskmabortbuilding 11792msgid "Abort building" 11793msgstr "" 11794 11795#: lazarusidestrconsts.liskmaddbpaddress 11796msgid "Add Address Breakpoint" 11797msgstr "" 11798 11799#: lazarusidestrconsts.liskmaddbpsource 11800msgid "Add Source Breakpoint" 11801msgstr "" 11802 11803#: lazarusidestrconsts.liskmaddbpwatchpoint 11804msgid "Add Data/WatchPoint" 11805msgstr "" 11806 11807#: lazarusidestrconsts.liskmaddwatch 11808msgctxt "lazarusidestrconsts.liskmaddwatch" 11809msgid "Add watch" 11810msgstr "" 11811 11812#: lazarusidestrconsts.liskmbuildmanymodes 11813msgid "Build many modes" 11814msgstr "" 11815 11816#: lazarusidestrconsts.liskmbuildprojectprogram 11817msgid "Build project/program" 11818msgstr "" 11819 11820#: lazarusidestrconsts.liskmchoosekeymappingscheme 11821msgid "Choose Keymapping scheme" 11822msgstr "" 11823 11824#: lazarusidestrconsts.liskmclassic 11825msgid "Classic" 11826msgstr "Clàssic" 11827 11828#: lazarusidestrconsts.liskmcleanupandbuild 11829msgctxt "lazarusidestrconsts.liskmcleanupandbuild" 11830msgid "Clean up and build" 11831msgstr "" 11832 11833#: lazarusidestrconsts.liskmcloseproject 11834msgid "Close project" 11835msgstr "" 11836 11837#: lazarusidestrconsts.liskmcodetoolsdefineseditor 11838msgid "CodeTools defines editor" 11839msgstr "" 11840 11841#: lazarusidestrconsts.liskmcompileprojectprogram 11842msgid "Compile project/program" 11843msgstr "" 11844 11845#: lazarusidestrconsts.liskmconfigbuildfile 11846msgid "Config \"Build File\"" 11847msgstr "" 11848 11849#: lazarusidestrconsts.liskmconfigurecustomcomponents 11850msgid "Configure Custom Components" 11851msgstr "" 11852 11853#: lazarusidestrconsts.liskmcontextsensitivehelp 11854msgid "Context sensitive help" 11855msgstr "" 11856 11857#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage 11858msgid "Convert Delphi package to Lazarus package" 11859msgstr "" 11860 11861#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject 11862msgid "Convert Delphi Project to Lazarus Project" 11863msgstr "" 11864 11865#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit 11866msgid "Convert Delphi Unit to Lazarus Unit" 11867msgstr "" 11868 11869#: lazarusidestrconsts.liskmconvertdfmfiletolfm 11870msgid "Convert DFM File to LFM" 11871msgstr "" 11872 11873#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard 11874msgid "Copy selected components" 11875msgstr "" 11876 11877#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard 11878msgid "Cut selected components" 11879msgstr "" 11880 11881#: lazarusidestrconsts.liskmdefaulttoosx 11882msgid "Default adapted to macOS" 11883msgstr "" 11884 11885#: lazarusidestrconsts.liskmdeletelastchar 11886msgid "Delete last char" 11887msgstr "" 11888 11889#: lazarusidestrconsts.liskmdiffeditorfiles 11890msgid "Diff Editor Files" 11891msgstr "" 11892 11893#: lazarusidestrconsts.liskmeditcodetemplates 11894msgid "Edit Code Templates" 11895msgstr "" 11896 11897#: lazarusidestrconsts.liskmeditcontextsensitivehelp 11898msgid "Edit context sensitive help" 11899msgstr "" 11900 11901#: lazarusidestrconsts.liskmencloseselection 11902msgid "Enclose Selection" 11903msgstr "" 11904 11905#: lazarusidestrconsts.liskmevaluatemodify 11906msgid "Evaluate/Modify" 11907msgstr "" 11908 11909#: lazarusidestrconsts.liskmexampleprojects 11910msgid "Example Projects" 11911msgstr "" 11912 11913#: lazarusidestrconsts.liskmexternaltoolssettings 11914msgid "External Tools settings" 11915msgstr "" 11916 11917#: lazarusidestrconsts.liskmfindincremental 11918msgid "Find Incremental" 11919msgstr "" 11920 11921#: lazarusidestrconsts.liskmgotomarker0 11922msgid "Go to bookmark 0" 11923msgstr "" 11924 11925#: lazarusidestrconsts.liskmgotomarker1 11926msgid "Go to bookmark 1" 11927msgstr "" 11928 11929#: lazarusidestrconsts.liskmgotomarker2 11930msgid "Go to bookmark 2" 11931msgstr "" 11932 11933#: lazarusidestrconsts.liskmgotomarker3 11934msgid "Go to bookmark 3" 11935msgstr "" 11936 11937#: lazarusidestrconsts.liskmgotomarker4 11938msgid "Go to bookmark 4" 11939msgstr "" 11940 11941#: lazarusidestrconsts.liskmgotomarker5 11942msgid "Go to bookmark 5" 11943msgstr "" 11944 11945#: lazarusidestrconsts.liskmgotomarker6 11946msgid "Go to bookmark 6" 11947msgstr "" 11948 11949#: lazarusidestrconsts.liskmgotomarker7 11950msgid "Go to bookmark 7" 11951msgstr "" 11952 11953#: lazarusidestrconsts.liskmgotomarker8 11954msgid "Go to bookmark 8" 11955msgstr "" 11956 11957#: lazarusidestrconsts.liskmgotomarker9 11958msgid "Go to bookmark 9" 11959msgstr "" 11960 11961#: lazarusidestrconsts.liskmgotosourceeditor1 11962msgid "Go to source editor 1" 11963msgstr "" 11964 11965#: lazarusidestrconsts.liskmgotosourceeditor10 11966msgid "Go to source editor 10" 11967msgstr "" 11968 11969#: lazarusidestrconsts.liskmgotosourceeditor2 11970msgid "Go to source editor 2" 11971msgstr "" 11972 11973#: lazarusidestrconsts.liskmgotosourceeditor3 11974msgid "Go to source editor 3" 11975msgstr "" 11976 11977#: lazarusidestrconsts.liskmgotosourceeditor4 11978msgid "Go to source editor 4" 11979msgstr "" 11980 11981#: lazarusidestrconsts.liskmgotosourceeditor5 11982msgid "Go to source editor 5" 11983msgstr "" 11984 11985#: lazarusidestrconsts.liskmgotosourceeditor6 11986msgid "Go to source editor 6" 11987msgstr "" 11988 11989#: lazarusidestrconsts.liskmgotosourceeditor7 11990msgid "Go to source editor 7" 11991msgstr "" 11992 11993#: lazarusidestrconsts.liskmgotosourceeditor8 11994msgid "Go to source editor 8" 11995msgstr "" 11996 11997#: lazarusidestrconsts.liskmgotosourceeditor9 11998msgid "Go to source editor 9" 11999msgstr "" 12000 12001#: lazarusidestrconsts.liskminsertdateandtime 12002msgid "Insert date and time" 12003msgstr "" 12004 12005#: lazarusidestrconsts.liskminsertusername 12006msgid "Insert username" 12007msgstr "" 12008 12009#: lazarusidestrconsts.liskminspect 12010msgid "Inspect" 12011msgstr "" 12012 12013#: lazarusidestrconsts.liskmkeymappingscheme 12014msgid "Keymapping Scheme" 12015msgstr "" 12016 12017#: lazarusidestrconsts.liskmlazarusdefault 12018msgid "Lazarus default" 12019msgstr "" 12020 12021#: lazarusidestrconsts.liskmmacosxapple 12022msgid "macOS, Apple style" 12023msgstr "" 12024 12025#: lazarusidestrconsts.liskmmacosxlaz 12026msgid "macOS, Lazarus style" 12027msgstr "" 12028 12029#: lazarusidestrconsts.liskmnewpackage 12030msgid "New package" 12031msgstr "" 12032 12033#: lazarusidestrconsts.liskmnewproject 12034msgid "New project" 12035msgstr "" 12036 12037#: lazarusidestrconsts.liskmnewprojectfromfile 12038msgid "New project from file" 12039msgstr "" 12040 12041#: lazarusidestrconsts.liskmnewunit 12042#, fuzzy 12043msgctxt "lazarusidestrconsts.liskmnewunit" 12044msgid "New Unit" 12045msgstr "Nova unitat" 12046 12047#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme 12048msgid "Note: All keys will be set to the values of the chosen scheme." 12049msgstr "" 12050 12051#: lazarusidestrconsts.liskmopenpackagefile 12052msgid "Open package file" 12053msgstr "" 12054 12055#: lazarusidestrconsts.liskmopenrecent 12056msgctxt "lazarusidestrconsts.liskmopenrecent" 12057msgid "Open Recent" 12058msgstr "" 12059 12060#: lazarusidestrconsts.liskmopenrecentpackage 12061msgid "Open recent package" 12062msgstr "" 12063 12064#: lazarusidestrconsts.liskmopenrecentproject 12065msgid "Open recent project" 12066msgstr "" 12067 12068#: lazarusidestrconsts.liskmpastecomponentsfromclipboard 12069msgid "Paste Components" 12070msgstr "" 12071 12072#: lazarusidestrconsts.liskmpauseprogram 12073msgid "Pause program" 12074msgstr "" 12075 12076#: lazarusidestrconsts.liskmpublishproject 12077msgid "Publish project" 12078msgstr "" 12079 12080#: lazarusidestrconsts.liskmquickcompilenolinking 12081msgid "Quick compile, no linking" 12082msgstr "" 12083 12084#: lazarusidestrconsts.liskmremoveactivefilefromproject 12085msgid "Remove Active File from Project" 12086msgstr "" 12087 12088#: lazarusidestrconsts.liskmrunprogram 12089msgid "Run program" 12090msgstr "" 12091 12092#: lazarusidestrconsts.liskmsaveall 12093msgid "SaveAll" 12094msgstr "" 12095 12096#: lazarusidestrconsts.liskmsaveas 12097msgid "SaveAs" 12098msgstr "" 12099 12100#: lazarusidestrconsts.liskmsaveproject 12101msgid "Save project" 12102msgstr "" 12103 12104#: lazarusidestrconsts.liskmsaveprojectas 12105msgid "Save project as" 12106msgstr "" 12107 12108#: lazarusidestrconsts.liskmselectlineend 12109#, fuzzy 12110msgctxt "lazarusidestrconsts.liskmselectlineend" 12111msgid "Select Line End" 12112msgstr "Selecciona al final de la línia" 12113 12114#: lazarusidestrconsts.liskmselectlinestart 12115#, fuzzy 12116msgctxt "lazarusidestrconsts.liskmselectlinestart" 12117msgid "Select Line Start" 12118msgstr "Selecciona al començament de la línia" 12119 12120#: lazarusidestrconsts.liskmselectpagebottom 12121#, fuzzy 12122msgctxt "lazarusidestrconsts.liskmselectpagebottom" 12123msgid "Select Page Bottom" 12124msgstr "Selecciona la pàgina inferior" 12125 12126#: lazarusidestrconsts.liskmselectpagetop 12127#, fuzzy 12128msgctxt "lazarusidestrconsts.liskmselectpagetop" 12129msgid "Select Page Top" 12130msgstr "Selecciona la pàgina superior" 12131 12132#: lazarusidestrconsts.liskmselectwordleft 12133#, fuzzy 12134msgctxt "lazarusidestrconsts.liskmselectwordleft" 12135msgid "Select Word Left" 12136msgstr "Selecciona una paraula a l'esquerra" 12137 12138#: lazarusidestrconsts.liskmselectwordright 12139#, fuzzy 12140msgctxt "lazarusidestrconsts.liskmselectwordright" 12141msgid "Select Word Right" 12142msgstr "Selecciona una paraula a la dreta" 12143 12144#: lazarusidestrconsts.liskmsetfreebookmark 12145msgid "Set free Bookmark" 12146msgstr "" 12147 12148#: lazarusidestrconsts.liskmsetmarker0 12149msgid "Set bookmark 0" 12150msgstr "" 12151 12152#: lazarusidestrconsts.liskmsetmarker1 12153msgid "Set bookmark 1" 12154msgstr "" 12155 12156#: lazarusidestrconsts.liskmsetmarker2 12157msgid "Set bookmark 2" 12158msgstr "" 12159 12160#: lazarusidestrconsts.liskmsetmarker3 12161msgid "Set bookmark 3" 12162msgstr "" 12163 12164#: lazarusidestrconsts.liskmsetmarker4 12165msgid "Set bookmark 4" 12166msgstr "" 12167 12168#: lazarusidestrconsts.liskmsetmarker5 12169msgid "Set bookmark 5" 12170msgstr "" 12171 12172#: lazarusidestrconsts.liskmsetmarker6 12173msgid "Set bookmark 6" 12174msgstr "" 12175 12176#: lazarusidestrconsts.liskmsetmarker7 12177msgid "Set bookmark 7" 12178msgstr "" 12179 12180#: lazarusidestrconsts.liskmsetmarker8 12181msgid "Set bookmark 8" 12182msgstr "" 12183 12184#: lazarusidestrconsts.liskmsetmarker9 12185msgid "Set bookmark 9" 12186msgstr "" 12187 12188#: lazarusidestrconsts.liskmstopprogram 12189msgid "Stop Program" 12190msgstr "" 12191 12192#: lazarusidestrconsts.liskmtogglebetweenunitandform 12193msgid "Toggle between Unit and Form" 12194msgstr "" 12195 12196#: lazarusidestrconsts.liskmtogglemarker0 12197msgid "Toggle bookmark 0" 12198msgstr "" 12199 12200#: lazarusidestrconsts.liskmtogglemarker1 12201msgid "Toggle bookmark 1" 12202msgstr "" 12203 12204#: lazarusidestrconsts.liskmtogglemarker2 12205msgid "Toggle bookmark 2" 12206msgstr "" 12207 12208#: lazarusidestrconsts.liskmtogglemarker3 12209msgid "Toggle bookmark 3" 12210msgstr "" 12211 12212#: lazarusidestrconsts.liskmtogglemarker4 12213msgid "Toggle bookmark 4" 12214msgstr "" 12215 12216#: lazarusidestrconsts.liskmtogglemarker5 12217msgid "Toggle bookmark 5" 12218msgstr "" 12219 12220#: lazarusidestrconsts.liskmtogglemarker6 12221msgid "Toggle bookmark 6" 12222msgstr "" 12223 12224#: lazarusidestrconsts.liskmtogglemarker7 12225msgid "Toggle bookmark 7" 12226msgstr "" 12227 12228#: lazarusidestrconsts.liskmtogglemarker8 12229msgid "Toggle bookmark 8" 12230msgstr "" 12231 12232#: lazarusidestrconsts.liskmtogglemarker9 12233msgid "Toggle bookmark 9" 12234msgstr "" 12235 12236#: lazarusidestrconsts.liskmtoggleviewassembler 12237msgctxt "lazarusidestrconsts.liskmtoggleviewassembler" 12238msgid "View Assembler" 12239msgstr "" 12240 12241#: lazarusidestrconsts.liskmtoggleviewbreakpoints 12242msgid "View Breakpoints" 12243msgstr "" 12244 12245#: lazarusidestrconsts.liskmtoggleviewcallstack 12246#, fuzzy 12247msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack" 12248msgid "View Call Stack" 12249msgstr "Mostra la pila de les crides" 12250 12251#: lazarusidestrconsts.liskmtoggleviewcodebrowser 12252msgid "Toggle view Code Browser" 12253msgstr "" 12254 12255#: lazarusidestrconsts.liskmtoggleviewcodeexplorer 12256msgid "Toggle view Code Explorer" 12257msgstr "" 12258 12259#: lazarusidestrconsts.liskmtoggleviewcomponentpalette 12260msgid "Toggle View Component Palette" 12261msgstr "" 12262 12263#: lazarusidestrconsts.liskmtoggleviewdebugevents 12264msgid "View Debuger Event Log" 12265msgstr "" 12266 12267#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput 12268msgid "View Debugger Output" 12269msgstr "" 12270 12271#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor 12272msgid "Toggle view Documentation Editor" 12273msgstr "" 12274 12275#: lazarusidestrconsts.liskmtoggleviewhistory 12276msgctxt "lazarusidestrconsts.liskmtoggleviewhistory" 12277msgid "View History" 12278msgstr "" 12279 12280#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons 12281msgid "Toggle view IDE speed buttons" 12282msgstr "" 12283 12284#: lazarusidestrconsts.liskmtoggleviewlocalvariables 12285msgid "View Local Variables" 12286msgstr "" 12287 12288#: lazarusidestrconsts.liskmtoggleviewmessages 12289msgid "Toggle view Messages" 12290msgstr "" 12291 12292#: lazarusidestrconsts.liskmtoggleviewobjectinspector 12293msgid "Toggle view Object Inspector" 12294msgstr "" 12295 12296#: lazarusidestrconsts.liskmtoggleviewpseudoterminal 12297msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal" 12298msgid "View Console In/Output" 12299msgstr "" 12300 12301#: lazarusidestrconsts.liskmtoggleviewregisters 12302msgid "View Registers" 12303msgstr "" 12304 12305#: lazarusidestrconsts.liskmtoggleviewsearchresults 12306msgid "Toggle view Search Results" 12307msgstr "" 12308 12309#: lazarusidestrconsts.liskmtoggleviewsourceeditor 12310msgid "Toggle view Source Editor" 12311msgstr "" 12312 12313#: lazarusidestrconsts.liskmtoggleviewthreads 12314msgctxt "lazarusidestrconsts.liskmtoggleviewthreads" 12315msgid "View Threads" 12316msgstr "" 12317 12318#: lazarusidestrconsts.liskmtoggleviewwatches 12319msgid "View Watches" 12320msgstr "" 12321 12322#: lazarusidestrconsts.liskmviewjumphistory 12323msgid "View jump history" 12324msgstr "" 12325 12326#: lazarusidestrconsts.liskmviewprojectoptions 12327msgid "View project options" 12328msgstr "" 12329 12330#: lazarusidestrconsts.liskmviewprojectsource 12331msgid "View Project Source" 12332msgstr "" 12333 12334#: lazarusidestrconsts.liskmviewunitinfo 12335msgid "View Unit Info" 12336msgstr "" 12337 12338#: lazarusidestrconsts.lislastopened 12339msgid "Last opened" 12340msgstr "" 12341 12342#: lazarusidestrconsts.lislaunchingapplicationinvalid 12343msgid "Launching application invalid" 12344msgstr "L'execució de l'aplicació no és vàlida" 12345 12346#: lazarusidestrconsts.lislaunchingcmdline 12347msgid "Launching target command line" 12348msgstr "Executant línia d'ordres de destinació" 12349 12350#: lazarusidestrconsts.lislazarus 12351msgctxt "lazarusidestrconsts.lislazarus" 12352msgid "Lazarus" 12353msgstr "Lazarus" 12354 12355#: lazarusidestrconsts.lislazarusdefault 12356msgid "Lazarus Default" 12357msgstr "" 12358 12359#: lazarusidestrconsts.lislazarusdirectory 12360msgid "Lazarus directory" 12361msgstr "Directori del Lazarus" 12362 12363#: lazarusidestrconsts.lislazarusdiroverride 12364msgid "directory to be used as a basedirectory" 12365msgstr "" 12366 12367#: lazarusidestrconsts.lislazaruseditorv 12368#, object-pascal-format 12369msgid "Lazarus IDE v%s" 12370msgstr "" 12371 12372#: lazarusidestrconsts.lislazaruside 12373msgid "Lazarus IDE" 12374msgstr "" 12375 12376#: lazarusidestrconsts.lislazaruslanguageid 12377msgid "Lazarus language ID (e.g. en, de, br, fi)" 12378msgstr "" 12379 12380#: lazarusidestrconsts.lislazaruslanguagename 12381msgid "Lazarus language name (e.g. english, deutsch)" 12382msgstr "" 12383 12384#: lazarusidestrconsts.lislazarusoptionsprojectfilename 12385msgid "lazarus [options] <project-filename>" 12386msgstr "lazarus [opcions] <projecte-nomfitxer>" 12387 12388#: lazarusidestrconsts.lislazbuildaboaction 12389msgctxt "lazarusidestrconsts.lislazbuildaboaction" 12390msgid "Action" 12391msgstr "" 12392 12393#: lazarusidestrconsts.lislazbuildabochooseoutputdir 12394msgid "Choose output directory of the IDE executable " 12395msgstr "" 12396 12397#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile 12398msgid "Are you sure you want to delete this build profile?" 12399msgstr "" 12400 12401#: lazarusidestrconsts.lislazbuildbuildmany 12402msgid "Build Many" 12403msgstr "" 12404 12405#: lazarusidestrconsts.lislazbuildcommonsettings 12406msgid "Common Settings" 12407msgstr "" 12408 12409#: lazarusidestrconsts.lislazbuildconfirmbuild 12410msgid "Confirm before build" 12411msgstr "" 12412 12413#: lazarusidestrconsts.lislazbuildconfirmdeletion 12414msgid "Confirm deletion" 12415msgstr "" 12416 12417#: lazarusidestrconsts.lislazbuilddebugide 12418msgid "Debug IDE" 12419msgstr "" 12420 12421#: lazarusidestrconsts.lislazbuilddefines 12422msgid "Defines" 12423msgstr "" 12424 12425#: lazarusidestrconsts.lislazbuilddefineswithoutd 12426msgid "Defines without -d" 12427msgstr "" 12428 12429#: lazarusidestrconsts.lislazbuildeditdefines 12430msgctxt "lazarusidestrconsts.lislazbuildeditdefines" 12431msgid "Edit Defines" 12432msgstr "" 12433 12434#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile 12435msgid "Edit list of defines which can be used by any profile" 12436msgstr "" 12437 12438#: lazarusidestrconsts.lislazbuilderrorwritingfile 12439msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" 12440msgid "Error writing file" 12441msgstr "S'ha produït un error mentre s'escrivia el fitxer" 12442 12443#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow 12444#, object-pascal-format 12445msgid "%s%s%s%slazbuild is non interactive, aborting now." 12446msgstr "" 12447 12448#: lazarusidestrconsts.lislazbuildmanageprofiles 12449msgid "Manage Build Profiles" 12450msgstr "" 12451 12452#: lazarusidestrconsts.lislazbuildmanageprofiles2 12453msgid "Manage profiles" 12454msgstr "" 12455 12456#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile 12457msgid "Name of the active profile" 12458msgstr "" 12459 12460#: lazarusidestrconsts.lislazbuildnewprof 12461msgid "Add New Profile" 12462msgstr "" 12463 12464#: lazarusidestrconsts.lislazbuildnewprofinfo 12465msgid "Current build options will be associated with:" 12466msgstr "" 12467 12468#: lazarusidestrconsts.lislazbuildnormalide 12469msgid "Normal IDE" 12470msgstr "" 12471 12472#: lazarusidestrconsts.lislazbuildoptimizedide 12473msgid "Optimized IDE" 12474msgstr "" 12475 12476#: lazarusidestrconsts.lislazbuildoptions 12477msgid "Options:" 12478msgstr "Opcions:" 12479 12480#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler 12481msgid "Options passed to compiler" 12482msgstr "" 12483 12484#: lazarusidestrconsts.lislazbuildprofile 12485msgid "Profile to build" 12486msgstr "" 12487 12488#: lazarusidestrconsts.lislazbuildrenameprof 12489msgid "Rename Profile" 12490msgstr "" 12491 12492#: lazarusidestrconsts.lislazbuildrenameprofinfo 12493msgid "New name for profile:" 12494msgstr "" 12495 12496#: lazarusidestrconsts.lislazbuildrestartafterbuild 12497msgid "Restart after building IDE" 12498msgstr "" 12499 12500#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically 12501msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically" 12502msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" 12503msgstr "" 12504 12505#: lazarusidestrconsts.lislazbuildselectprofilestobuild 12506msgid "Select profiles to build" 12507msgstr "" 12508 12509#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding 12510msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding" 12511msgid "Show confirmation dialog when building directly from Tools menu" 12512msgstr "" 12513 12514#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline 12515msgid "Show options and defines for command line" 12516msgstr "" 12517 12518#: lazarusidestrconsts.lislazbuildtargetcpu 12519msgid "Target CPU:" 12520msgstr "" 12521 12522#: lazarusidestrconsts.lislazbuildtargetdirectory 12523msgid "Target directory:" 12524msgstr "" 12525 12526#: lazarusidestrconsts.lislazbuildtargetos 12527msgid "Target OS:" 12528msgstr "SO dest:" 12529 12530#: lazarusidestrconsts.lislazbuildunabletowritefile 12531#, object-pascal-format 12532msgid "Unable to write file \"%s\":%s" 12533msgstr "" 12534 12535#: lazarusidestrconsts.lislazbuildupdaterevinc 12536msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc" 12537msgid "Update revision.inc" 12538msgstr "" 12539 12540#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog 12541msgid "Update revision info in \"About Lazarus\" dialog" 12542msgstr "" 12543 12544#: lazarusidestrconsts.lislazcleanupbuildall 12545msgctxt "lazarusidestrconsts.lislazcleanupbuildall" 12546msgid "Clean Up + Build all" 12547msgstr "" 12548 12549#: lazarusidestrconsts.lislazver 12550msgid "Lazarus Version (e.g. 1.2.4)" 12551msgstr "" 12552 12553#: lazarusidestrconsts.lislclwidgettype 12554#, fuzzy 12555#| msgid "LCL Widget Type" 12556msgid "LCL widget type" 12557msgstr "Tipus de giny LCL" 12558 12559#: lazarusidestrconsts.lisldaddlinktoinherited 12560msgid "Add link to inherited" 12561msgstr "" 12562 12563#: lazarusidestrconsts.lisldcopyfrominherited 12564msgid "Copy from inherited" 12565msgstr "" 12566 12567#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo 12568#, object-pascal-format 12569msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s" 12570msgstr "" 12571 12572#: lazarusidestrconsts.lisldmoveentriestoinherited 12573msgid "Move entries to inherited" 12574msgstr "" 12575 12576#: lazarusidestrconsts.lisldnovalidfpdocpath 12577msgid "No valid FPDoc path" 12578msgstr "" 12579 12580#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe 12581#, object-pascal-format 12582msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." 12583msgstr "" 12584 12585#: lazarusidestrconsts.lisleft 12586msgctxt "lazarusidestrconsts.lisleft" 12587msgid "Left" 12588msgstr "Esquerra" 12589 12590#: lazarusidestrconsts.lisleftborderspacespinedithint 12591msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." 12592msgstr "" 12593 12594#: lazarusidestrconsts.lisleftgroupboxcaption 12595msgid "Left anchoring" 12596msgstr "" 12597 12598#: lazarusidestrconsts.lisleftsiblingcomboboxhint 12599msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 12600msgstr "" 12601 12602#: lazarusidestrconsts.lisleftsides 12603msgid "Left sides" 12604msgstr "Costats esquerres" 12605 12606#: lazarusidestrconsts.lisleftspaceequally 12607msgid "Left space equally" 12608msgstr "Iguala l'espai esquerra" 12609 12610#: lazarusidestrconsts.lisless 12611msgctxt "lazarusidestrconsts.lisless" 12612msgid "Less" 12613msgstr "" 12614 12615#: lazarusidestrconsts.lislevels 12616msgctxt "lazarusidestrconsts.lislevels" 12617msgid "Levels" 12618msgstr "" 12619 12620#: lazarusidestrconsts.lislfmfile 12621msgid "LFM file" 12622msgstr "Fitxer LFM" 12623 12624#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties 12625msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." 12626msgstr "" 12627 12628#: lazarusidestrconsts.lislfmfilecorrupt 12629msgid "LFM file corrupt" 12630msgstr "El fitxer LFM està corromput" 12631 12632#: lazarusidestrconsts.lislfmisok 12633msgid "LFM is ok" 12634msgstr "" 12635 12636#: lazarusidestrconsts.lislgplnotice 12637msgid "" 12638"<description>\n" 12639"\n" 12640"Copyright (C) <year> <name of author> <contact>\n" 12641"\n" 12642"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 12643"\n" 12644"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 12645"\n" 12646"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 12647msgstr "" 12648 12649#: lazarusidestrconsts.lislibrarypath 12650msgid "library path" 12651msgstr "trajectòria de les biblioteques" 12652 12653#: lazarusidestrconsts.lislibraryprogramdescriptor 12654msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)." 12655msgstr "" 12656 12657#: lazarusidestrconsts.lisline 12658msgid "Line:" 12659msgstr "" 12660 12661#: lazarusidestrconsts.lislinelength 12662msgid "Line/Length" 12663msgstr "" 12664 12665#: lazarusidestrconsts.lislink 12666msgid "Link:" 12667msgstr "" 12668 12669#: lazarusidestrconsts.lislinkeroptions 12670msgid "linker options" 12671msgstr "opcions de l'enllaçador" 12672 12673#: lazarusidestrconsts.lislinktarget 12674msgid "Link target" 12675msgstr "" 12676 12677#: lazarusidestrconsts.lislistofallcasevalues 12678msgid "list of all case values" 12679msgstr "" 12680 12681#: lazarusidestrconsts.lisloadingfailed 12682#, object-pascal-format 12683msgid "Loading %s failed." 12684msgstr "" 12685 12686#: lazarusidestrconsts.lisloadmacrofrom 12687msgid "Load macro from" 12688msgstr "" 12689 12690#: lazarusidestrconsts.lislocal 12691msgid "&Local" 12692msgstr "" 12693 12694#: lazarusidestrconsts.lislocals 12695#, fuzzy 12696msgctxt "lazarusidestrconsts.lislocals" 12697msgid "Local Variables" 12698msgstr "Variables Locals" 12699 12700#: lazarusidestrconsts.lislocalsdlgcopyall 12701msgid "Copy &all" 12702msgstr "" 12703 12704#: lazarusidestrconsts.lislocalsdlgcopyname 12705msgid "&Copy Name" 12706msgstr "" 12707 12708#: lazarusidestrconsts.lislocalsdlgcopynamevalue 12709msgid "Co&py Name and Value" 12710msgstr "" 12711 12712#: lazarusidestrconsts.lislocalsdlgcopyrawvalue 12713msgid "Copy &RAW Value" 12714msgstr "" 12715 12716#: lazarusidestrconsts.lislocalsdlgcopyvalue 12717msgid "C&opy Value" 12718msgstr "" 12719 12720#: lazarusidestrconsts.lislocalsnotevaluated 12721msgid "Locals not evaluated" 12722msgstr "" 12723 12724#: lazarusidestrconsts.lislogcallstack 12725msgid "Log Call Stack" 12726msgstr "" 12727 12728#: lazarusidestrconsts.lislogcallstacklimit 12729msgid "(frames limit. 0 - no limits)" 12730msgstr "" 12731 12732#: lazarusidestrconsts.lislogevalexpression 12733msgctxt "lazarusidestrconsts.lislogevalexpression" 12734msgid "Eval expression" 12735msgstr "" 12736 12737#: lazarusidestrconsts.lislogmessage 12738msgid "Log Message" 12739msgstr "" 12740 12741#: lazarusidestrconsts.lislowercasestring 12742msgid "lowercase string" 12743msgstr "" 12744 12745#: lazarusidestrconsts.lislowercasestringgivenasparameter 12746msgid "Lowercase string given as parameter." 12747msgstr "" 12748 12749#: lazarusidestrconsts.lislpicompatibilitymodecheckbox 12750msgid "Maximize compatibility of project files (LPI and LPS)" 12751msgstr "" 12752 12753#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint 12754msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions." 12755msgstr "" 12756 12757#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox 12758msgid "Maximize compatibility of package file (LPK)" 12759msgstr "" 12760 12761#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint 12762msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions." 12763msgstr "" 12764 12765#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative 12766#, object-pascal-format 12767msgid "lpk has vanished on disk. Using as alternative%s" 12768msgstr "" 12769 12770#: lazarusidestrconsts.lislpkismissing 12771msgid "lpk is missing" 12772msgstr "" 12773 12774#: lazarusidestrconsts.lislrsincludefiles 12775msgid "Lazarus resources (.lrs) include files" 12776msgstr "" 12777 12778#: lazarusidestrconsts.lismacpreferences 12779msgid "Preferences..." 12780msgstr "" 12781 12782#: lazarusidestrconsts.lismacro 12783#, object-pascal-format 12784msgid "Macro %s" 12785msgstr "" 12786 12787#: lazarusidestrconsts.lismacropromptenterdata 12788msgid "Enter data" 12789msgstr "Entra les dades" 12790 12791#: lazarusidestrconsts.lismacropromptenterrunparameters 12792msgid "Enter run parameters" 12793msgstr "Entra els paràmetres d'execució" 12794 12795#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject 12796#, fuzzy 12797#| msgid "Main Unit has Uses Section containing all Units of project" 12798msgid "Main unit has Uses section containing all units of project" 12799msgstr "La unitat principal té secció USES amb totes les unitats del projecte" 12800 12801#: lazarusidestrconsts.lismainunitispascalsource 12802msgid "Main unit is Pascal source" 12803msgstr "" 12804 12805#: lazarusidestrconsts.lismainunitispascalsourcehint 12806msgid "Assume Pascal even if it does not end with .pas/.pp suffix." 12807msgstr "" 12808 12809#: lazarusidestrconsts.lismakecurrent 12810msgctxt "lazarusidestrconsts.lismakecurrent" 12811msgid "Current" 12812msgstr "" 12813 12814#: lazarusidestrconsts.lismakeexe 12815msgid "Make Executable" 12816msgstr "Fes executable" 12817 12818#: lazarusidestrconsts.lismakenotfound 12819msgid "Make not found" 12820msgstr "No s'ha trobat Make" 12821 12822#: lazarusidestrconsts.lismakeresourcestring 12823msgid "Make ResourceString" 12824msgstr "Fes cadena del recurs" 12825 12826#: lazarusidestrconsts.lismakeresstrappendtosection 12827msgid "Append to section" 12828msgstr "Afegeix a la secció" 12829 12830#: lazarusidestrconsts.lismakeresstrchooseanothername 12831#, object-pascal-format, fuzzy, badformat 12832#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." 12833msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." 12834msgstr "La cadena del recurs %s%s%s ja existeix. Si us plau, escolliu-ne un altre nom. %s Escolliu - Ignora - per afegir-la de tota manera" 12835 12836#: lazarusidestrconsts.lismakeresstrconversionoptions 12837msgid "Conversion Options" 12838msgstr "Opcions de conversió" 12839 12840#: lazarusidestrconsts.lismakeresstrcustomidentifier 12841msgid "Custom identifier" 12842msgstr "Identificador personalitzat" 12843 12844#: lazarusidestrconsts.lismakeresstrdialogidentifier 12845msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" 12846msgid "Identifier" 12847msgstr "Identificador" 12848 12849#: lazarusidestrconsts.lismakeresstridentifierlength 12850msgid "Identifier length:" 12851msgstr "Longitud de l'identificador" 12852 12853#: lazarusidestrconsts.lismakeresstridentifierprefix 12854msgid "Identifier prefix:" 12855msgstr "Prefix de l'identificador" 12856 12857#: lazarusidestrconsts.lismakeresstrinsertalphabetically 12858msgid "Insert alphabetically" 12859msgstr "Insereix alfabèticament" 12860 12861#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive 12862msgid "Insert context sensitive" 12863msgstr "Insereix sensitivament al context" 12864 12865#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect 12866msgid "Invalid Resourcestring section" 12867msgstr "La secció de la cadena del recurs no és vàlida" 12868 12869#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring 12870msgid "Please choose a resourcestring section from the list." 12871msgstr "" 12872 12873#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis 12874msgid "Resourcestring already exists" 12875msgstr "Ja existeix la cadena del recurs" 12876 12877#: lazarusidestrconsts.lismakeresstrresourcestringsection 12878msgid "Resourcestring section:" 12879msgstr "Secció de cadena del recurs" 12880 12881#: lazarusidestrconsts.lismakeresstrsourcepreview 12882msgid "Source preview" 12883msgstr "Visualització prèvia del codi font" 12884 12885#: lazarusidestrconsts.lismakeresstrstringconstantinsource 12886msgid "String constant in source" 12887msgstr "Constant de cadena en el codi font" 12888 12889#: lazarusidestrconsts.lismakeresstrstringswithsamevalue 12890msgid "Strings with same value:" 12891msgstr "Cadenes amb el mateix valor:" 12892 12893#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto 12894msgid "Make sure all ppu files of a package are in its output directory." 12895msgstr "" 12896 12897#: lazarusidestrconsts.lismanagesourceeditors 12898msgid "Manage Source Editors ..." 12899msgstr "" 12900 12901#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul 12902msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system." 12903msgstr "" 12904 12905#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault 12906#, object-pascal-format 12907msgid "Maximum parallel processes, 0 means default (%s)" 12908msgstr "" 12909 12910#: lazarusidestrconsts.lismaxs 12911#, object-pascal-format 12912msgid "Max %d" 12913msgstr "" 12914 12915#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage 12916#, object-pascal-format 12917msgid "%s Maybe you have to recompile the package." 12918msgstr "" 12919 12920#: lazarusidestrconsts.lismb 12921#, object-pascal-format 12922msgid "%s MB" 12923msgstr "" 12924 12925#: lazarusidestrconsts.lismeaction 12926msgctxt "lazarusidestrconsts.lismeaction" 12927msgid "Action" 12928msgstr "" 12929 12930#: lazarusidestrconsts.lismemorydump 12931msgid "Memory Dump" 12932msgstr "" 12933 12934#: lazarusidestrconsts.lismenuabortbuild 12935msgid "Abort Build" 12936msgstr "Avorta el muntatge" 12937 12938#: lazarusidestrconsts.lismenuaboutfpc 12939msgid "About FPC" 12940msgstr "" 12941 12942#: lazarusidestrconsts.lismenuaddbreakpoint 12943#, fuzzy 12944#| msgid "Add breakpoint" 12945msgid "Add &Breakpoint" 12946msgstr "Afegeix un punt de ruptura" 12947 12948#: lazarusidestrconsts.lismenuaddcurfiletopkg 12949msgid "Add Active File to Package ..." 12950msgstr "" 12951 12952#: lazarusidestrconsts.lismenuaddjumppointtohistory 12953#, fuzzy 12954#| msgid "Add jump point to history" 12955msgid "Add Jump Point to History" 12956msgstr "Afegeix un punt de salt a la història" 12957 12958#: lazarusidestrconsts.lismenuaddtoproject 12959#, fuzzy 12960#| msgid "Add editor file to Project" 12961msgid "Add Editor File to Project" 12962msgstr "Afegeix el fitxer de l'editor al Projecte" 12963 12964#: lazarusidestrconsts.lismenuaddwatch 12965#, fuzzy 12966#| msgid "Add watch ..." 12967msgid "Add &Watch ..." 12968msgstr "Afegeix control ..." 12969 12970#: lazarusidestrconsts.lismenubeaklinesinselection 12971msgid "Break Lines in Selection" 12972msgstr "" 12973 12974#: lazarusidestrconsts.lismenubreak 12975msgid "&Break" 12976msgstr "" 12977 12978#: lazarusidestrconsts.lismenubuildfile 12979msgid "Build File" 12980msgstr "Munta el fitxer" 12981 12982#: lazarusidestrconsts.lismenubuildlazarus 12983#, fuzzy 12984#| msgid "Build Lazarus with current profile" 12985msgid "Build Lazarus with Current Profile" 12986msgstr "Munta el Lazarus" 12987 12988#: lazarusidestrconsts.lismenubuildlazarusprof 12989#, object-pascal-format 12990msgid "Build Lazarus with Profile: %s" 12991msgstr "" 12992 12993#: lazarusidestrconsts.lismenuchecklfm 12994#, fuzzy 12995#| msgid "Check LFM file in editor" 12996msgid "Check LFM File in Editor" 12997msgstr "Comprova el fitxer LFM en l'editor" 12998 12999#: lazarusidestrconsts.lismenucleandirectory 13000#, fuzzy 13001#| msgid "Clean directory ..." 13002msgid "Clean Directory ..." 13003msgstr "Neteja el directori ..." 13004 13005#: lazarusidestrconsts.lismenucleanupandbuild 13006msgid "Clean up and Build ..." 13007msgstr "" 13008 13009#: lazarusidestrconsts.lismenucloseall 13010#, fuzzy 13011#| msgid "Close A&ll Editor Files" 13012msgid "Close A&ll" 13013msgstr "Tanca tots els fitxers de l'editor" 13014 13015#: lazarusidestrconsts.lismenucloseeditorfile 13016msgid "&Close Editor File" 13017msgstr "" 13018 13019#: lazarusidestrconsts.lismenucloseproject 13020msgid "Close Project" 13021msgstr "" 13022 13023#: lazarusidestrconsts.lismenucodetoolsdefineseditor 13024#, fuzzy 13025#| msgid "CodeTools defines editor ..." 13026msgid "CodeTools Defines Editor ..." 13027msgstr "Editor de definició de les eines del codi ..." 13028 13029#: lazarusidestrconsts.lismenucommentselection 13030#, fuzzy 13031#| msgid "Comment selection" 13032msgid "Comment Selection" 13033msgstr "Comenta la selecció" 13034 13035#: lazarusidestrconsts.lismenucomparefiles 13036msgid "Compare files ..." 13037msgstr "" 13038 13039#: lazarusidestrconsts.lismenucompilemanymodes 13040msgid "Compile many Modes ..." 13041msgstr "" 13042 13043#: lazarusidestrconsts.lismenucompletecode 13044msgctxt "lazarusidestrconsts.lismenucompletecode" 13045msgid "Complete Code" 13046msgstr "Completa el codi" 13047 13048#: lazarusidestrconsts.lismenucompletecodeinteractive 13049msgid "Complete Code (with dialog)" 13050msgstr "" 13051 13052#: lazarusidestrconsts.lismenuconfigbuildfile 13053msgid "Configure Build+Run File ..." 13054msgstr "Configura Arxiu Build+Run ..." 13055 13056#: lazarusidestrconsts.lismenuconfigcustomcomps 13057#, fuzzy 13058#| msgid "Configure custom components ..." 13059msgid "Configure Custom Components ..." 13060msgstr "Configura els components personalitzats ..." 13061 13062#: lazarusidestrconsts.lismenuconfigexternaltools 13063msgid "Configure External Tools ..." 13064msgstr "" 13065 13066#: lazarusidestrconsts.lismenuconfigurebuildlazarus 13067msgid "Configure \"Build Lazarus\" ..." 13068msgstr "Configura \"Build Lazarus\" ..." 13069 13070#: lazarusidestrconsts.lismenucontexthelp 13071msgid "Context sensitive Help" 13072msgstr "Ajuda sensitiva al context" 13073 13074#: lazarusidestrconsts.lismenucontinue 13075msgid "&Continue" 13076msgstr "" 13077 13078#: lazarusidestrconsts.lismenuconvertdelphipackage 13079#, fuzzy 13080#| msgid "Convert Delphi package to Lazarus package ..." 13081msgid "Convert Delphi Package to Lazarus Package ..." 13082msgstr "Converteix paquet Delphi a paquet Lazarus ..." 13083 13084#: lazarusidestrconsts.lismenuconvertdelphiproject 13085#, fuzzy 13086#| msgid "Convert Delphi project to Lazarus project ..." 13087msgid "Convert Delphi Project to Lazarus Project ..." 13088msgstr "Converteix projecte Delphi a projecte Lazarus ..." 13089 13090#: lazarusidestrconsts.lismenuconvertdelphiunit 13091#, fuzzy 13092#| msgid "Convert Delphi unit to Lazarus unit ..." 13093msgid "Convert Delphi Unit to Lazarus Unit ..." 13094msgstr "Converteix la unitat Delphi a unitat Lazarus ..." 13095 13096#: lazarusidestrconsts.lismenuconvertdfmtolfm 13097#, fuzzy 13098#| msgid "Convert binary DFM to text LFM + check syntax ..." 13099msgid "Convert Binary DFM to Text LFM + Check Syntax ..." 13100msgstr "Converteix el fitxer DFM a LFM ..." 13101 13102#: lazarusidestrconsts.lismenuconvertencoding 13103msgid "Convert Encoding of Projects/Packages ..." 13104msgstr "" 13105 13106#: lazarusidestrconsts.lismenudebugwindows 13107#, fuzzy 13108#| msgid "Debug windows" 13109msgid "Debug Windows" 13110msgstr "Finestres de depuració" 13111 13112#: lazarusidestrconsts.lismenudelphiconversion 13113msgid "Delphi Conversion" 13114msgstr "" 13115 13116#: lazarusidestrconsts.lismenuedit 13117msgid "&Edit" 13118msgstr "&Edita" 13119 13120#: lazarusidestrconsts.lismenueditcodetemplates 13121msgid "Code Templates ..." 13122msgstr "Plantilles de codi ..." 13123 13124#: lazarusidestrconsts.lismenueditcontexthelp 13125msgid "Edit context sensitive Help" 13126msgstr "" 13127 13128#: lazarusidestrconsts.lismenueditinstallpkgs 13129#, fuzzy 13130#| msgid "Install/Uninstall packages ..." 13131msgid "Install/Uninstall Packages ..." 13132msgstr "Configura els paquets intal·lats ..." 13133 13134#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging 13135#, object-pascal-format 13136msgid "Accelerator(&&) key \"%s\" needs changing" 13137msgstr "" 13138 13139#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem 13140msgid "Add a new item above selected item" 13141msgstr "" 13142 13143#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem 13144msgid "Add a new item after selected item" 13145msgstr "" 13146 13147#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem 13148msgid "Add a new item before selected item" 13149msgstr "" 13150 13151#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem 13152msgid "Add a new item below selected item" 13153msgstr "" 13154 13155#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem 13156msgid "Add a submenu at the right of selected item" 13157msgstr "" 13158 13159#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem 13160msgid "Add a submenu below selected item" 13161msgstr "" 13162 13163#: lazarusidestrconsts.lismenueditoraddfromtemplate 13164msgid "&Add from template ..." 13165msgstr "" 13166 13167#: lazarusidestrconsts.lismenueditoraddiconfroms 13168#, object-pascal-format 13169msgid "Add icon from %s" 13170msgstr "" 13171 13172#: lazarusidestrconsts.lismenueditoraddimagelisticon 13173msgid "Add imagelist &icon" 13174msgstr "" 13175 13176#: lazarusidestrconsts.lismenueditoraddmenuitem 13177msgid "Add menu item" 13178msgstr "" 13179 13180#: lazarusidestrconsts.lismenueditoraddnewitemabove 13181msgid "&Add new item above" 13182msgstr "" 13183 13184#: lazarusidestrconsts.lismenueditoraddnewitemafter 13185msgid "Add ne&w item after" 13186msgstr "" 13187 13188#: lazarusidestrconsts.lismenueditoraddnewitembefore 13189msgid "&Add new item before" 13190msgstr "" 13191 13192#: lazarusidestrconsts.lismenueditoraddnewitembelow 13193msgid "Add ne&w item below" 13194msgstr "" 13195 13196#: lazarusidestrconsts.lismenueditoraddonclickhandler 13197msgid "Add &OnClick handler" 13198msgstr "" 13199 13200#: lazarusidestrconsts.lismenueditoraddseparatorafter 13201msgid "Add separator &after" 13202msgstr "" 13203 13204#: lazarusidestrconsts.lismenueditoraddseparatorbefore 13205msgid "Add separator &before" 13206msgstr "" 13207 13208#: lazarusidestrconsts.lismenueditoraddsubmenu 13209msgid "Add submenu" 13210msgstr "" 13211 13212#: lazarusidestrconsts.lismenueditoraddsubmenubelow 13213msgid "Add &submenu below" 13214msgstr "" 13215 13216#: lazarusidestrconsts.lismenueditoraddsubmenuright 13217msgid "Add &submenu right" 13218msgstr "" 13219 13220#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved 13221#, object-pascal-format 13222msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items" 13223msgstr "" 13224 13225#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate 13226msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,," 13227msgstr "" 13228 13229#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate 13230msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,," 13231msgstr "" 13232 13233#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate 13234msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,," 13235msgstr "" 13236 13237#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate 13238msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,," 13239msgstr "" 13240 13241#: lazarusidestrconsts.lismenueditorcaption 13242msgid "Caption" 13243msgstr "" 13244 13245#: lazarusidestrconsts.lismenueditorcaptioneditemss 13246#, object-pascal-format 13247msgid "Captioned items: %s" 13248msgstr "" 13249 13250#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank 13251msgid "Caption should not be blank" 13252msgstr "" 13253 13254#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators 13255#, object-pascal-format 13256msgid "Change conflicting accelerator \"%s\"" 13257msgstr "" 13258 13259#: lazarusidestrconsts.lismenueditorchangeimagelisticon 13260msgid "Change imagelist &icon" 13261msgstr "" 13262 13263#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent 13264#, object-pascal-format 13265msgid "Change %s for %s" 13266msgstr "" 13267 13268#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts 13269#, object-pascal-format 13270msgid "Change shortcut conflict \"%s\"" 13271msgstr "" 13272 13273#: lazarusidestrconsts.lismenueditorchangetheshortcutfors 13274#, object-pascal-format 13275msgid "Change the shortCut for %s" 13276msgstr "" 13277 13278#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors 13279#, object-pascal-format 13280msgid "Change the shortCutKey2 for %s" 13281msgstr "" 13282 13283#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete 13284msgid "Choose template to delete" 13285msgstr "" 13286 13287#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert 13288msgid "Choose template to insert" 13289msgstr "" 13290 13291#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut 13292msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column" 13293msgstr "" 13294 13295#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind 13296msgid "Component is unexpected kind" 13297msgstr "" 13298 13299#: lazarusidestrconsts.lismenueditorcomponentisunnamed 13300msgid "Component is unnamed" 13301msgstr "" 13302 13303#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete 13304msgid "<conflict resolution complete>" 13305msgstr "" 13306 13307#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd 13308#, object-pascal-format 13309msgid "Conflicts found initially: %d" 13310msgstr "" 13311 13312#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels 13313#, object-pascal-format 13314msgid "Deepest nested menu level: %s" 13315msgstr "" 13316 13317#: lazarusidestrconsts.lismenueditordeleteitem 13318#, fuzzy 13319#| msgid "Delete Item" 13320msgid "&Delete item" 13321msgstr "Elimina l'element" 13322 13323#: lazarusidestrconsts.lismenueditordeletemenutemplate 13324msgid "&Delete menu template ..." 13325msgstr "" 13326 13327#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate 13328msgid "Delete saved menu template" 13329msgstr "" 13330 13331#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate 13332msgid "Delete selected menu template" 13333msgstr "" 13334 13335#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems 13336msgid "Delete this item and its subitems?" 13337msgstr "" 13338 13339#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu 13340msgid "Display preview as &Popup menu" 13341msgstr "" 13342 13343#: lazarusidestrconsts.lismenueditoreditcaption 13344msgid "Edit &Caption" 13345msgstr "" 13346 13347#: lazarusidestrconsts.lismenueditoreditingcaptionofs 13348#, object-pascal-format 13349msgid "Editing Caption of %s" 13350msgstr "" 13351 13352#: lazarusidestrconsts.lismenueditoreditingsdots 13353#, object-pascal-format 13354msgid "To resolve conflict edit %s.%s" 13355msgstr "" 13356 13357#: lazarusidestrconsts.lismenueditoreditingsfors 13358#, object-pascal-format 13359msgid "Editing %s for %s" 13360msgstr "" 13361 13362#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected 13363#, object-pascal-format 13364msgid "Editing %s.%s - no menuitem selected" 13365msgstr "" 13366 13367#: lazarusidestrconsts.lismenueditorenteramenudescription 13368msgid "Enter a menu &Description:" 13369msgstr "" 13370 13371#: lazarusidestrconsts.lismenueditorenteranewshortcutfors 13372#, object-pascal-format 13373msgid "Enter a new ShortCut for %s" 13374msgstr "" 13375 13376#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors 13377#, object-pascal-format 13378msgid "Enter a new ShortCutKey2 for %s" 13379msgstr "" 13380 13381#: lazarusidestrconsts.lismenueditorexistingsavedtemplates 13382msgid "Existing saved templates" 13383msgstr "" 13384 13385#: lazarusidestrconsts.lismenueditorfurthershortcutconflict 13386msgid "Further shortcut conflict" 13387msgstr "" 13388 13389#: lazarusidestrconsts.lismenueditorgethelptousethiseditor 13390msgid "Get help to use this editor" 13391msgstr "" 13392 13393#: lazarusidestrconsts.lismenueditorgrabkey 13394msgid "&Grab key" 13395msgstr "" 13396 13397#: lazarusidestrconsts.lismenueditorgroupindexd 13398#, object-pascal-format 13399msgid "GroupIndex: %d" 13400msgstr "" 13401 13402#: lazarusidestrconsts.lismenueditorgroupindexvaluess 13403#, object-pascal-format 13404msgid "Values in use: %s" 13405msgstr "" 13406 13407#: lazarusidestrconsts.lismenueditorinadequatedescription 13408msgid "Inadequate Description" 13409msgstr "" 13410 13411#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs 13412#, object-pascal-format 13413msgid "Insert menu template into root of %s" 13414msgstr "" 13415 13416#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate 13417msgid "Insert selected menu template" 13418msgstr "" 13419 13420#: lazarusidestrconsts.lismenueditorisnotassigned 13421msgid "is not assigned" 13422msgstr "" 13423 13424#: lazarusidestrconsts.lismenueditoritemswithicons 13425#, object-pascal-format 13426msgid "Items with icon: %s" 13427msgstr "" 13428 13429#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators 13430#, object-pascal-format 13431msgid "List shortcuts and &accelerators for %s ..." 13432msgstr "" 13433 13434#: lazarusidestrconsts.lismenueditorlistshortcutsfors 13435#, object-pascal-format 13436msgid "List shortcuts for %s ..." 13437msgstr "" 13438 13439#: lazarusidestrconsts.lismenueditormenueditor 13440msgid "Menu Editor" 13441msgstr "Editor del menú" 13442 13443#: lazarusidestrconsts.lismenueditormenuitemactions 13444msgid "Menu Item actions" 13445msgstr "" 13446 13447#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins 13448#, object-pascal-format 13449msgid "Menuitem shortcut conflicts in %s" 13450msgstr "" 13451 13452#: lazarusidestrconsts.lismenueditormovedown 13453msgid "Move Down (or right)" 13454msgstr "Mou avall (o a la dreta)" 13455 13456#: lazarusidestrconsts.lismenueditormoveitemdown 13457msgid "Mo&ve item down" 13458msgstr "" 13459 13460#: lazarusidestrconsts.lismenueditormoveitemleft 13461msgid "&Move item left" 13462msgstr "" 13463 13464#: lazarusidestrconsts.lismenueditormoveitemright 13465msgid "Mo&ve item right" 13466msgstr "" 13467 13468#: lazarusidestrconsts.lismenueditormoveitemup 13469msgid "&Move item up" 13470msgstr "" 13471 13472#: lazarusidestrconsts.lismenueditormoveselecteditemdown 13473msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown" 13474msgid "Move selected item down" 13475msgstr "" 13476 13477#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft 13478msgid "Move selected item to the left" 13479msgstr "" 13480 13481#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright 13482msgid "Move selected item to the right" 13483msgstr "" 13484 13485#: lazarusidestrconsts.lismenueditormoveselecteditemup 13486msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup" 13487msgid "Move selected item up" 13488msgstr "" 13489 13490#: lazarusidestrconsts.lismenueditormoveup 13491msgid "Move Up (or left)" 13492msgstr "Mou Dalt (o a l'esquerra)" 13493 13494#: lazarusidestrconsts.lismenueditorna 13495msgid "n/a" 13496msgstr "" 13497 13498#: lazarusidestrconsts.lismenueditornomenuselected 13499msgid "(no menu selected)" 13500msgstr "" 13501 13502#: lazarusidestrconsts.lismenueditornone 13503msgid "<none>" 13504msgstr "" 13505 13506#: lazarusidestrconsts.lismenueditornonenone 13507msgid "<none>,<none>" 13508msgstr "" 13509 13510#: lazarusidestrconsts.lismenueditornoshortcutconflicts 13511msgid "<no shortcut conflicts>" 13512msgstr "" 13513 13514#: lazarusidestrconsts.lismenueditornousersavedtemplates 13515msgid "No user-saved templates" 13516msgstr "" 13517 13518#: lazarusidestrconsts.lismenueditorpickaniconfroms 13519#, object-pascal-format 13520msgid "Pick an icon from %s" 13521msgstr "" 13522 13523#: lazarusidestrconsts.lismenueditorpopupassignmentss 13524#, object-pascal-format 13525msgid "Popup assignments: %s" 13526msgstr "" 13527 13528#: lazarusidestrconsts.lismenueditorradioitem 13529msgid "RadioItem" 13530msgstr "" 13531 13532#: lazarusidestrconsts.lismenueditorremainingconflictss 13533#, object-pascal-format 13534msgid "Remaining conflicts: %s" 13535msgstr "" 13536 13537#: lazarusidestrconsts.lismenueditorremoveallseparators 13538msgid "&Remove all separators" 13539msgstr "" 13540 13541#: lazarusidestrconsts.lismenueditorresolvedconflictss 13542#, object-pascal-format 13543msgid "Resolved conflicts: %s" 13544msgstr "" 13545 13546#: lazarusidestrconsts.lismenueditorresolveselectedconflict 13547msgid "Resolve selected conflict" 13548msgstr "" 13549 13550#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts 13551msgid "&Resolve shortcut conflicts ..." 13552msgstr "" 13553 13554#: lazarusidestrconsts.lismenueditorsavedtemplates 13555msgid "Saved templates" 13556msgstr "" 13557 13558#: lazarusidestrconsts.lismenueditorsavemenuasatemplate 13559msgid "&Save menu as a template ..." 13560msgstr "" 13561 13562#: lazarusidestrconsts.lismenueditorsavemenuastemplate 13563msgid "Save menu as template" 13564msgstr "" 13565 13566#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse 13567msgid "Save menu as template for future use" 13568msgstr "" 13569 13570#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate 13571msgid "Save menu shown as a new template" 13572msgstr "" 13573 13574#: lazarusidestrconsts.lismenueditorsconflictswiths 13575#, object-pascal-format 13576msgid "%s conflicts with %s" 13577msgstr "" 13578 13579#: lazarusidestrconsts.lismenueditorseparators 13580msgid "Se¶tors" 13581msgstr "" 13582 13583#: lazarusidestrconsts.lismenueditorshortcutitemss 13584#, object-pascal-format 13585msgid "Shortcut items: %s" 13586msgstr "" 13587 13588#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged 13589msgid "Shortcut not yet changed" 13590msgstr "" 13591 13592#: lazarusidestrconsts.lismenueditorshortcuts 13593msgid "Shortcuts" 13594msgstr "" 13595 13596#: lazarusidestrconsts.lismenueditorshortcuts2 13597msgid "Shortc&uts" 13598msgstr "" 13599 13600#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys 13601msgid "Shortcuts and Accelerator keys" 13602msgstr "" 13603 13604#: lazarusidestrconsts.lismenueditorshortcutsd 13605#, object-pascal-format 13606msgid "Shortcuts (%d)" 13607msgstr "" 13608 13609#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd 13610#, object-pascal-format 13611msgid "Shortcuts (%d) and Accelerator keys (%d)" 13612msgstr "" 13613 13614#: lazarusidestrconsts.lismenueditorshortcutsourceproperty 13615msgid "Shortcut,Source Property" 13616msgstr "" 13617 13618#: lazarusidestrconsts.lismenueditorshortcutsusedins 13619#, object-pascal-format 13620msgid "Shortcuts used in %s" 13621msgstr "" 13622 13623#: lazarusidestrconsts.lismenueditorshortcutsusedinsd 13624#, object-pascal-format 13625msgid "Shortcuts used in %s (%d)" 13626msgstr "" 13627 13628#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil 13629msgid "ShowMenuEditor: TMenu parameter is nil" 13630msgstr "" 13631 13632#: lazarusidestrconsts.lismenueditorsins 13633#, object-pascal-format 13634msgid "\"%s\" in %s" 13635msgstr "" 13636 13637#: lazarusidestrconsts.lismenueditorsisalreadyinuse 13638#, object-pascal-format 13639msgid "" 13640"\"%s\" is already in use in %s as a shortcut.\n" 13641"Try a different shortcut." 13642msgstr "" 13643 13644#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand 13645#, object-pascal-format 13646msgid "Please expand: \"%s\" is not a sufficient Description" 13647msgstr "" 13648 13649#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar 13650msgid "Some widgetsets do not allow separators in the main menubar" 13651msgstr "" 13652 13653#: lazarusidestrconsts.lismenueditorsshortcuts 13654#, object-pascal-format 13655msgid "%s: Shortcuts" 13656msgstr "" 13657 13658#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys 13659#, object-pascal-format 13660msgid "%s: Shortcuts and accelerator keys" 13661msgstr "" 13662 13663#: lazarusidestrconsts.lismenueditorsssonclicks 13664#, object-pascal-format 13665msgid "%s.%s.%s - OnClick: %s" 13666msgstr "" 13667 13668#: lazarusidestrconsts.lismenueditorssubmenu 13669#, object-pascal-format 13670msgid "%s submenu" 13671msgstr "" 13672 13673#: lazarusidestrconsts.lismenueditorstandardtemplates 13674msgid "Standard templates" 13675msgstr "" 13676 13677#: lazarusidestrconsts.lismenueditortemplatedescription 13678msgid "Template description:" 13679msgstr "" 13680 13681#: lazarusidestrconsts.lismenueditortemplates 13682msgid "&Templates" 13683msgstr "" 13684 13685#: lazarusidestrconsts.lismenueditortemplatesaved 13686msgid "Template saved" 13687msgstr "" 13688 13689#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates 13690msgid "" 13691"There are no user-saved menu templates.\n" 13692"\n" 13693"Only standard default templates are available." 13694msgstr "" 13695 13696#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis 13697#, object-pascal-format 13698msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" 13699msgstr "" 13700 13701#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict 13702#, object-pascal-format 13703msgid "" 13704"You have to change the shortcut from %s\n" 13705"to avoid a conflict" 13706msgstr "" 13707 13708#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption 13709msgid "You must enter text for the Caption" 13710msgstr "" 13711 13712#: lazarusidestrconsts.lismenuencloseinifdef 13713msgid "Enclose in $IFDEF ..." 13714msgstr "" 13715 13716#: lazarusidestrconsts.lismenuencloseselection 13717#, fuzzy 13718#| msgid "Enclose selection ..." 13719msgid "Enclose Selection ..." 13720msgstr "Tanca la selecció ..." 13721 13722#: lazarusidestrconsts.lismenuevaluate 13723#, fuzzy 13724#| msgid "Evaluate/Modify ..." 13725msgid "E&valuate/Modify ..." 13726msgstr "Avalua/Modifica ..." 13727 13728#: lazarusidestrconsts.lismenuexampleprojects 13729msgid "Example Projects ..." 13730msgstr "" 13731 13732#: lazarusidestrconsts.lismenuextractproc 13733#, fuzzy 13734#| msgid "Extract procedure ..." 13735msgid "Extract Procedure ..." 13736msgstr "Extrau el procediment ..." 13737 13738#: lazarusidestrconsts.lismenufile 13739msgid "&File" 13740msgstr "&Fitxer" 13741 13742#: lazarusidestrconsts.lismenufind 13743msgctxt "lazarusidestrconsts.lismenufind" 13744msgid "Find" 13745msgstr "Cerca" 13746 13747#: lazarusidestrconsts.lismenufind2 13748msgid "&Find ..." 13749msgstr "" 13750 13751#: lazarusidestrconsts.lismenufindblockotherendofcodeblock 13752#, fuzzy 13753#| msgid "Find other end of code block" 13754msgid "Find Other End of Code Block" 13755msgstr "Cerca l'altre cap del bloc del codi" 13756 13757#: lazarusidestrconsts.lismenufindcodeblockstart 13758#, fuzzy 13759#| msgid "Find code block start" 13760msgid "Find Start of Code Block" 13761msgstr "Cerca l'inici del bloc del codi" 13762 13763#: lazarusidestrconsts.lismenufinddeclarationatcursor 13764#, fuzzy 13765#| msgid "Find Declaration at cursor" 13766msgid "Find Declaration at Cursor" 13767msgstr "Cerca la declaració al cursor" 13768 13769#: lazarusidestrconsts.lismenufindidentifierrefs 13770msgid "Find Identifier References ..." 13771msgstr "Cerca les referències de l'identificador ..." 13772 13773#: lazarusidestrconsts.lismenufindinfiles 13774#, fuzzy 13775#| msgid "Find &in files ..." 13776msgid "Find &in Files ..." 13777msgstr "Cerca &en els Fitxers ..." 13778 13779#: lazarusidestrconsts.lismenufindnext 13780msgid "Find &Next" 13781msgstr "Cerca el següe&nt" 13782 13783#: lazarusidestrconsts.lismenufindprevious 13784msgid "Find &Previous" 13785msgstr "Cerca l'an&terior" 13786 13787#: lazarusidestrconsts.lismenufindreferencesofusedunit 13788msgid "Find References Of Used Unit" 13789msgstr "" 13790 13791#: lazarusidestrconsts.lismenugeneraloptions 13792msgid "Options ..." 13793msgstr "" 13794 13795#: lazarusidestrconsts.lismenugotoincludedirective 13796#, fuzzy 13797#| msgid "Goto include directive" 13798msgid "Goto Include Directive" 13799msgstr "Vés a la directiva Include" 13800 13801#: lazarusidestrconsts.lismenugotoline 13802#, fuzzy 13803#| msgid "Goto line ..." 13804msgid "Goto Line ..." 13805msgstr "Vés a la línia ..." 13806 13807#: lazarusidestrconsts.lismenuguessmisplacedifdef 13808#, fuzzy 13809#| msgid "Guess misplaced IFDEF/ENDIF" 13810msgid "Guess Misplaced IFDEF/ENDIF" 13811msgstr "Suposa IFDEF/ENDIF omès" 13812 13813#: lazarusidestrconsts.lismenuguessunclosedblock 13814#, fuzzy 13815#| msgid "Guess unclosed block" 13816msgid "Guess Unclosed Block" 13817msgstr "Suposa bloc no tancat" 13818 13819#: lazarusidestrconsts.lismenuhelp 13820msgid "&Help" 13821msgstr "A&juda" 13822 13823#: lazarusidestrconsts.lismenuideinternals 13824msgid "IDE Internals" 13825msgstr "" 13826 13827#: lazarusidestrconsts.lismenuincrementalfind 13828msgid "Incremental Find" 13829msgstr "Recerca incremental" 13830 13831#: lazarusidestrconsts.lismenuindentselection 13832#, fuzzy 13833#| msgid "Indent selection" 13834msgid "Indent Selection" 13835msgstr "Sagna la selecció" 13836 13837#: lazarusidestrconsts.lismenuinsertchangelogentry 13838#, fuzzy 13839#| msgid "ChangeLog entry" 13840msgid "ChangeLog Entry" 13841msgstr "Entrada de registre de canvis" 13842 13843#: lazarusidestrconsts.lismenuinsertcharacter 13844#, fuzzy 13845#| msgid "Insert from Character Map" 13846msgid "Insert from Character Map ..." 13847msgstr "Insereix desde el mapa de caràcters" 13848 13849#: lazarusidestrconsts.lismenuinsertcvskeyword 13850#, fuzzy 13851#| msgid "Insert CVS keyword" 13852msgid "Insert CVS Keyword" 13853msgstr "Paraula clau del CVS" 13854 13855#: lazarusidestrconsts.lismenuinsertdatetime 13856#, fuzzy 13857#| msgid "Current date and time" 13858msgid "Current Date and Time" 13859msgstr "Data i hora actuals" 13860 13861#: lazarusidestrconsts.lismenuinsertfilename 13862msgid "Insert Full Filename ..." 13863msgstr "" 13864 13865#: lazarusidestrconsts.lismenuinsertgeneral 13866#, fuzzy 13867#| msgid "General" 13868msgctxt "lazarusidestrconsts.lismenuinsertgeneral" 13869msgid "Insert General" 13870msgstr "General" 13871 13872#: lazarusidestrconsts.lismenuinsertgplnotice 13873#, fuzzy 13874#| msgid "GPL notice" 13875msgid "GPL Notice" 13876msgstr "Comentari GPL" 13877 13878#: lazarusidestrconsts.lismenuinsertgplnoticetranslated 13879msgid "GPL Notice (translated)" 13880msgstr "" 13881 13882#: lazarusidestrconsts.lismenuinsertlgplnotice 13883#, fuzzy 13884#| msgid "LGPL notice" 13885msgid "LGPL Notice" 13886msgstr "Comentari LGPL" 13887 13888#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated 13889msgid "LGPL Notice (translated)" 13890msgstr "" 13891 13892#: lazarusidestrconsts.lismenuinsertmitnotice 13893msgid "MIT Notice" 13894msgstr "" 13895 13896#: lazarusidestrconsts.lismenuinsertmitnoticetranslated 13897msgid "MIT Notice (translated)" 13898msgstr "" 13899 13900#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice 13901msgid "Modified LGPL Notice" 13902msgstr "" 13903 13904#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated 13905msgid "Modified LGPL Notice (translated)" 13906msgstr "" 13907 13908#: lazarusidestrconsts.lismenuinsertusername 13909#, fuzzy 13910#| msgid "Current username" 13911msgid "Current Username" 13912msgstr "Nom d'usuari actual" 13913 13914#: lazarusidestrconsts.lismenuinspect 13915#, fuzzy 13916#| msgid "Inspect ..." 13917msgctxt "lazarusidestrconsts.lismenuinspect" 13918msgid "&Inspect ..." 13919msgstr "Inspecciona ..." 13920 13921#: lazarusidestrconsts.lismenujumpback 13922#, fuzzy 13923#| msgid "Jump back" 13924msgid "Jump Back" 13925msgstr "Salta enrera" 13926 13927#: lazarusidestrconsts.lismenujumpforward 13928#, fuzzy 13929#| msgid "Jump forward" 13930msgid "Jump Forward" 13931msgstr "Salta endavant" 13932 13933#: lazarusidestrconsts.lismenujumpto 13934msgid "Jump to" 13935msgstr "Ves a" 13936 13937#: lazarusidestrconsts.lismenujumptoimplementation 13938msgid "Jump to Implementation" 13939msgstr "" 13940 13941#: lazarusidestrconsts.lismenujumptoimplementationuses 13942msgid "Jump to Implementation uses" 13943msgstr "" 13944 13945#: lazarusidestrconsts.lismenujumptoinitialization 13946msgid "Jump to Initialization" 13947msgstr "" 13948 13949#: lazarusidestrconsts.lismenujumptointerface 13950msgid "Jump to Interface" 13951msgstr "" 13952 13953#: lazarusidestrconsts.lismenujumptointerfaceuses 13954msgid "Jump to Interface uses" 13955msgstr "" 13956 13957#: lazarusidestrconsts.lismenujumptonextbookmark 13958#, fuzzy 13959#| msgid "Jump to next bookmark" 13960msgid "Jump to Next Bookmark" 13961msgstr "Ves al següent marcador" 13962 13963#: lazarusidestrconsts.lismenujumptonexterror 13964#, fuzzy 13965#| msgid "Jump to next error" 13966msgid "Jump to Next Error" 13967msgstr "Salta al següent error" 13968 13969#: lazarusidestrconsts.lismenujumptoprevbookmark 13970#, fuzzy 13971#| msgid "Jump to previous bookmark" 13972msgid "Jump to Previous Bookmark" 13973msgstr "Ves al marcador anterior" 13974 13975#: lazarusidestrconsts.lismenujumptopreverror 13976#, fuzzy 13977#| msgid "Jump to previous error" 13978msgid "Jump to Previous Error" 13979msgstr "Salta a l'error previ" 13980 13981#: lazarusidestrconsts.lismenujumptoprocedurebegin 13982msgid "Jump to Procedure begin" 13983msgstr "" 13984 13985#: lazarusidestrconsts.lismenujumptoprocedureheader 13986msgid "Jump to Procedure header" 13987msgstr "" 13988 13989#: lazarusidestrconsts.lismenulowercaseselection 13990#, fuzzy 13991#| msgid "Lowercase selection" 13992msgid "Lowercase Selection" 13993msgstr "Fica a minúscules la selecció" 13994 13995#: lazarusidestrconsts.lismenumacrolistview 13996msgid "Editor Macros ..." 13997msgstr "" 13998 13999#: lazarusidestrconsts.lismenumakeresourcestring 14000msgid "Make Resource String ..." 14001msgstr "Fes cadena del recurs ..." 14002 14003#: lazarusidestrconsts.lismenumultipaste 14004msgctxt "lazarusidestrconsts.lismenumultipaste" 14005msgid "MultiPaste ..." 14006msgstr "" 14007 14008#: lazarusidestrconsts.lismenunewcomponent 14009msgctxt "lazarusidestrconsts.lismenunewcomponent" 14010msgid "New Component" 14011msgstr "Nou component" 14012 14013#: lazarusidestrconsts.lismenunewcustom 14014#, object-pascal-format 14015msgid "New %s" 14016msgstr "" 14017 14018#: lazarusidestrconsts.lismenunewform 14019msgid "New Form" 14020msgstr "Nova forma" 14021 14022#: lazarusidestrconsts.lismenunewother 14023msgid "New ..." 14024msgstr "Nou ..." 14025 14026#: lazarusidestrconsts.lismenunewpackage 14027msgid "New Package ..." 14028msgstr "" 14029 14030#: lazarusidestrconsts.lismenunewproject 14031msgid "New Project ..." 14032msgstr "Nou projecte ..." 14033 14034#: lazarusidestrconsts.lismenunewprojectfromfile 14035#, fuzzy 14036#| msgid "New Project from file ..." 14037msgid "New Project from File ..." 14038msgstr "Nou projecte des del fitxer ..." 14039 14040#: lazarusidestrconsts.lismenunewunit 14041msgctxt "lazarusidestrconsts.lismenunewunit" 14042msgid "New Unit" 14043msgstr "Nova unitat" 14044 14045#: lazarusidestrconsts.lismenuok 14046#, fuzzy 14047#| msgid "&Ok" 14048msgctxt "lazarusidestrconsts.lismenuok" 14049msgid "&OK" 14050msgstr "D'Ac&ord" 14051 14052#: lazarusidestrconsts.lismenuonlinehelp 14053msgid "Online Help" 14054msgstr "Ajuda en línia" 14055 14056#: lazarusidestrconsts.lismenuopen 14057#, fuzzy 14058#| msgid "Open ..." 14059msgid "&Open ..." 14060msgstr "Obre ..." 14061 14062#: lazarusidestrconsts.lismenuopenfilenameatcursor 14063#, fuzzy 14064#| msgid "Open filename at cursor" 14065msgid "Open Filename at Cursor" 14066msgstr "Obre nom del fitxer al cursor" 14067 14068#: lazarusidestrconsts.lismenuopenfolder 14069msgid "Open Folder ..." 14070msgstr "" 14071 14072#: lazarusidestrconsts.lismenuopenpackage 14073#, fuzzy 14074#| msgid "Open loaded package ..." 14075msgid "Open Loaded Package ..." 14076msgstr "Obre el paquet carregat ..." 14077 14078#: lazarusidestrconsts.lismenuopenpackagefile 14079#, fuzzy 14080#| msgid "Open package file (.lpk) ..." 14081msgid "Open Package File (.lpk) ..." 14082msgstr "Obre arxiu de paquet (.lpk)" 14083 14084#: lazarusidestrconsts.lismenuopenpackageofcurunit 14085#, fuzzy 14086#| msgid "Open package of current unit" 14087msgid "Open Package of Current Unit" 14088msgstr "Obre el paquet de la unitat actual" 14089 14090#: lazarusidestrconsts.lismenuopenproject 14091msgid "Open Project ..." 14092msgstr "Obre el projecte ..." 14093 14094#: lazarusidestrconsts.lismenuopenrecent 14095#, fuzzy 14096#| msgid "Open &Recent ..." 14097msgid "Open &Recent" 14098msgstr "Obre recent ..." 14099 14100#: lazarusidestrconsts.lismenuopenrecentpkg 14101#, fuzzy 14102#| msgid "Open recent package" 14103msgid "Open Recent Package" 14104msgstr "Obre el paquet recent ..." 14105 14106#: lazarusidestrconsts.lismenuopenrecentproject 14107#, fuzzy 14108#| msgid "Open Recent Project ..." 14109msgctxt "lazarusidestrconsts.lismenuopenrecentproject" 14110msgid "Open Recent Project" 14111msgstr "Obre el projecte recent ..." 14112 14113#: lazarusidestrconsts.lismenuopenunit 14114msgid "Open Unit ..." 14115msgstr "" 14116 14117#: lazarusidestrconsts.lismenupackage 14118msgid "Pa&ckage" 14119msgstr "" 14120 14121#: lazarusidestrconsts.lismenupackagegraph 14122#, fuzzy 14123#| msgid "Package Graph ..." 14124msgid "Package Graph" 14125msgstr "Gràfica dels paquets ..." 14126 14127#: lazarusidestrconsts.lismenupackagelinks 14128msgid "Package Links ..." 14129msgstr "" 14130 14131#: lazarusidestrconsts.lismenupastefromclipboard 14132msgctxt "lazarusidestrconsts.lismenupastefromclipboard" 14133msgid "Paste from clipboard" 14134msgstr "" 14135 14136#: lazarusidestrconsts.lismenupkgnewpackagecomponent 14137msgid "New package component" 14138msgstr "" 14139 14140#: lazarusidestrconsts.lismenuprocedurelist 14141msgctxt "lazarusidestrconsts.lismenuprocedurelist" 14142msgid "Procedure List ..." 14143msgstr "Llista de Procediments ..." 14144 14145#: lazarusidestrconsts.lismenuproject 14146msgid "&Project" 14147msgstr "&Projecte" 14148 14149#: lazarusidestrconsts.lismenuprojectinspector 14150msgid "Project Inspector" 14151msgstr "Inspector del projecte" 14152 14153#: lazarusidestrconsts.lismenuprojectoptions 14154msgid "Project Options ..." 14155msgstr "Opcions del projecte ..." 14156 14157#: lazarusidestrconsts.lismenuprojectrun 14158#, fuzzy 14159#| msgid "Run" 14160msgctxt "lazarusidestrconsts.lismenuprojectrun" 14161msgid "&Run" 14162msgstr "Executa" 14163 14164#: lazarusidestrconsts.lismenupublishproject 14165msgid "Publish Project ..." 14166msgstr "Publica el projecte ..." 14167 14168#: lazarusidestrconsts.lismenuquickcompile 14169#, fuzzy 14170#| msgid "Quick compile" 14171msgid "Quick Compile" 14172msgstr "Compilació ràpida" 14173 14174#: lazarusidestrconsts.lismenuquicksyntaxcheck 14175#, fuzzy 14176#| msgid "Quick syntax check" 14177msgid "Quick Syntax Check" 14178msgstr "Comprova la sintaxi ràpidament" 14179 14180#: lazarusidestrconsts.lismenuquicksyntaxcheckok 14181msgid "Quick syntax check OK" 14182msgstr "" 14183 14184#: lazarusidestrconsts.lismenuremovefromproject 14185msgid "Remove from Project ..." 14186msgstr "Elimina del projecte ..." 14187 14188#: lazarusidestrconsts.lismenurenameidentifier 14189msgid "Rename Identifier ..." 14190msgstr "Canvia el nom de l'identificador ..." 14191 14192#: lazarusidestrconsts.lismenureportingbug 14193msgctxt "lazarusidestrconsts.lismenureportingbug" 14194msgid "Reporting a Bug" 14195msgstr "" 14196 14197#: lazarusidestrconsts.lismenuresaveformswithi18n 14198msgid "Resave forms with enabled i18n" 14199msgstr "" 14200 14201#: lazarusidestrconsts.lismenurescanfpcsourcedirectory 14202#, fuzzy 14203#| msgid "Rescan FPC source directory" 14204msgid "Rescan FPC Source Directory" 14205msgstr "Torna a escanejar el directori del codi font del FPC" 14206 14207#: lazarusidestrconsts.lismenuresetdebugger 14208#, fuzzy 14209#| msgid "Reset debugger" 14210msgid "Reset Debugger" 14211msgstr "Reinicia el depurador" 14212 14213#: lazarusidestrconsts.lismenurevert 14214msgid "Revert" 14215msgstr "Reverteix" 14216 14217#: lazarusidestrconsts.lismenurun 14218#, fuzzy 14219msgctxt "lazarusidestrconsts.lismenurun" 14220msgid "&Run" 14221msgstr "E&xecuta" 14222 14223#: lazarusidestrconsts.lismenurunfile 14224msgid "Run File" 14225msgstr "Executa el fitxer" 14226 14227#: lazarusidestrconsts.lismenurunparameters 14228#, fuzzy 14229#| msgid "Run Parameters ..." 14230msgid "Run &Parameters ..." 14231msgstr "Paràmetres de l'execució ..." 14232 14233#: lazarusidestrconsts.lismenuruntocursor 14234#, fuzzy 14235#| msgid "Run to &Cursor" 14236msgctxt "lazarusidestrconsts.lismenuruntocursor" 14237msgid "Run to Cursor" 14238msgstr "Executa al cursor" 14239 14240#: lazarusidestrconsts.lismenurunwithoutdebugging 14241msgid "Run without Debugging" 14242msgstr "" 14243 14244#: lazarusidestrconsts.lismenusave 14245#, fuzzy 14246#| msgid "Save" 14247msgctxt "lazarusidestrconsts.lismenusave" 14248msgid "&Save" 14249msgstr "Desa" 14250 14251#: lazarusidestrconsts.lismenusaveas 14252#, fuzzy 14253#| msgid "Save As ..." 14254msgid "Save &As ..." 14255msgstr "Anomena i desa ..." 14256 14257#: lazarusidestrconsts.lismenusaveproject 14258msgid "Save Project" 14259msgstr "Desa el projecte" 14260 14261#: lazarusidestrconsts.lismenusaveprojectas 14262msgid "Save Project As ..." 14263msgstr "Anomena i desa el projecte ..." 14264 14265#: lazarusidestrconsts.lismenusearch 14266msgid "&Search" 14267msgstr "&Cerca" 14268 14269#: lazarusidestrconsts.lismenuselect 14270msgid "Select" 14271msgstr "Selecciona" 14272 14273#: lazarusidestrconsts.lismenuselectall 14274#, fuzzy 14275#| msgid "Select all" 14276msgctxt "lazarusidestrconsts.lismenuselectall" 14277msgid "Select All" 14278msgstr "Selecciona-ho Tot" 14279 14280#: lazarusidestrconsts.lismenuselectcodeblock 14281#, fuzzy 14282#| msgid "Select code block" 14283msgid "Select Code Block" 14284msgstr "Selecciona el bloc del codi" 14285 14286#: lazarusidestrconsts.lismenuselectline 14287#, fuzzy 14288#| msgid "Select line" 14289msgid "Select Line" 14290msgstr "Selecciona la línia" 14291 14292#: lazarusidestrconsts.lismenuselectparagraph 14293#, fuzzy 14294#| msgid "Select paragraph" 14295msgid "Select Paragraph" 14296msgstr "Selecciona el paràgraf" 14297 14298#: lazarusidestrconsts.lismenuselecttobrace 14299#, fuzzy 14300#| msgid "Select to brace" 14301msgid "Select to Brace" 14302msgstr "Selecciona la tira" 14303 14304#: lazarusidestrconsts.lismenuselectword 14305#, fuzzy 14306#| msgid "Select word" 14307msgid "Select Word" 14308msgstr "Sel·lecciona paraula" 14309 14310#: lazarusidestrconsts.lismenusetfreebookmark 14311#, fuzzy 14312#| msgid "Set a free bookmark" 14313msgctxt "lazarusidestrconsts.lismenusetfreebookmark" 14314msgid "Set a Free Bookmark" 14315msgstr "Estableix un marcador lliure" 14316 14317#: lazarusidestrconsts.lismenushowexecutionpoint 14318msgid "S&how Execution Point" 14319msgstr "" 14320 14321#: lazarusidestrconsts.lismenushowsmarthint 14322msgid "Context sensitive smart hint" 14323msgstr "" 14324 14325#: lazarusidestrconsts.lismenusortselection 14326#, fuzzy 14327#| msgid "Sort selection ..." 14328msgid "Sort Selection ..." 14329msgstr "Ordena la selecció ..." 14330 14331#: lazarusidestrconsts.lismenusource 14332msgid "S&ource" 14333msgstr "" 14334 14335#: lazarusidestrconsts.lismenustepinto 14336#, fuzzy 14337#| msgid "Step in&to" 14338msgid "Step In&to" 14339msgstr "Pas a pas per instruccions" 14340 14341#: lazarusidestrconsts.lismenustepintocontext 14342msgid "Step Into (Context)" 14343msgstr "" 14344 14345#: lazarusidestrconsts.lismenustepintoinstr 14346msgctxt "lazarusidestrconsts.lismenustepintoinstr" 14347msgid "Step Into Instruction" 14348msgstr "" 14349 14350#: lazarusidestrconsts.lismenustepintoinstrhint 14351msgctxt "lazarusidestrconsts.lismenustepintoinstrhint" 14352msgid "Step Into Instruction" 14353msgstr "" 14354 14355#: lazarusidestrconsts.lismenustepout 14356msgid "Step O&ut" 14357msgstr "" 14358 14359#: lazarusidestrconsts.lismenustepover 14360#, fuzzy 14361#| msgid "&Step over" 14362msgid "&Step Over" 14363msgstr "Pas a pas per funcions" 14364 14365#: lazarusidestrconsts.lismenustepovercontext 14366msgid "Step Over (Context)" 14367msgstr "" 14368 14369#: lazarusidestrconsts.lismenustepoverinstr 14370msgctxt "lazarusidestrconsts.lismenustepoverinstr" 14371msgid "Step Over Instruction" 14372msgstr "" 14373 14374#: lazarusidestrconsts.lismenustepoverinstrhint 14375msgctxt "lazarusidestrconsts.lismenustepoverinstrhint" 14376msgid "Step Over Instruction" 14377msgstr "" 14378 14379#: lazarusidestrconsts.lismenusteptocursor 14380msgctxt "lazarusidestrconsts.lismenusteptocursor" 14381msgid "Step over to &Cursor" 14382msgstr "" 14383 14384#: lazarusidestrconsts.lismenuswapcaseselection 14385msgid "Swap Case in Selection" 14386msgstr "" 14387 14388#: lazarusidestrconsts.lismenutabstospacesselection 14389#, fuzzy 14390#| msgid "Tabs to spaces in selection" 14391msgid "Tabs to Spaces in Selection" 14392msgstr "Tabuladors a espais en la selecció" 14393 14394#: lazarusidestrconsts.lismenutemplateabout 14395msgctxt "lazarusidestrconsts.lismenutemplateabout" 14396msgid "About" 14397msgstr "Quant a" 14398 14399#: lazarusidestrconsts.lismenutogglecomment 14400msgid "Toggle Comment in Selection" 14401msgstr "" 14402 14403#: lazarusidestrconsts.lismenutools 14404msgid "&Tools" 14405msgstr "Eine&s" 14406 14407#: lazarusidestrconsts.lismenuuncommentselection 14408#, fuzzy 14409#| msgid "Uncomment selection" 14410msgid "Uncomment Selection" 14411msgstr "Treu comentari de la selecció" 14412 14413#: lazarusidestrconsts.lismenuunindentselection 14414#, fuzzy 14415#| msgid "Unindent selection" 14416msgid "Unindent Selection" 14417msgstr "Dessagna la selecció" 14418 14419#: lazarusidestrconsts.lismenuuppercaseselection 14420#, fuzzy 14421#| msgid "Uppercase selection" 14422msgid "Uppercase Selection" 14423msgstr "Fica a majúscules la selecció" 14424 14425#: lazarusidestrconsts.lismenuuseunit 14426msgctxt "lazarusidestrconsts.lismenuuseunit" 14427msgid "Add Unit to Uses Section ..." 14428msgstr "" 14429 14430#: lazarusidestrconsts.lismenuview 14431msgid "&View" 14432msgstr "&Visualitza" 14433 14434#: lazarusidestrconsts.lismenuviewanchoreditor 14435#, fuzzy 14436#| msgid "View Anchor Editor" 14437msgid "Anchor Editor" 14438msgstr "Mostra l'editor de les àncores" 14439 14440#: lazarusidestrconsts.lismenuviewassembler 14441msgctxt "lazarusidestrconsts.lismenuviewassembler" 14442msgid "Assembler" 14443msgstr "" 14444 14445#: lazarusidestrconsts.lismenuviewbreakpoints 14446msgid "BreakPoints" 14447msgstr "Punts de ruptura" 14448 14449#: lazarusidestrconsts.lismenuviewcallstack 14450msgid "Call Stack" 14451msgstr "Pila de les Crides" 14452 14453#: lazarusidestrconsts.lismenuviewcodebrowser 14454msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" 14455msgid "Code Browser" 14456msgstr "" 14457 14458#: lazarusidestrconsts.lismenuviewcodeexplorer 14459msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" 14460msgid "Code Explorer" 14461msgstr "Explorador del codi" 14462 14463#: lazarusidestrconsts.lismenuviewcomponentpalette 14464#, fuzzy 14465#| msgid "View Component Palette" 14466msgid "Component Palette" 14467msgstr "Vore Paleta de Components" 14468 14469#: lazarusidestrconsts.lismenuviewcomponents 14470msgid "&Components" 14471msgstr "C&omponents" 14472 14473#: lazarusidestrconsts.lismenuviewdebugevents 14474msgctxt "lazarusidestrconsts.lismenuviewdebugevents" 14475msgid "Event Log" 14476msgstr "Bitàcora d'events" 14477 14478#: lazarusidestrconsts.lismenuviewdebugoutput 14479#, fuzzy 14480#| msgid "Debug output" 14481msgid "Debug Output" 14482msgstr "Sortida de depuració" 14483 14484#: lazarusidestrconsts.lismenuviewforms 14485#, fuzzy 14486#| msgid "Forms..." 14487msgid "Forms ..." 14488msgstr "Formes..." 14489 14490#: lazarusidestrconsts.lismenuviewhistory 14491msgctxt "lazarusidestrconsts.lismenuviewhistory" 14492msgid "History" 14493msgstr "" 14494 14495#: lazarusidestrconsts.lismenuviewjumphistory 14496#, fuzzy 14497#| msgid "Jump History ..." 14498msgctxt "lazarusidestrconsts.lismenuviewjumphistory" 14499msgid "Jump History" 14500msgstr "Mostra la història dels salts ..." 14501 14502#: lazarusidestrconsts.lismenuviewlocalvariables 14503msgctxt "lazarusidestrconsts.lismenuviewlocalvariables" 14504msgid "Local Variables" 14505msgstr "Variables Locals" 14506 14507#: lazarusidestrconsts.lismenuviewmessages 14508msgctxt "lazarusidestrconsts.lismenuviewmessages" 14509msgid "Messages" 14510msgstr "Missatges" 14511 14512#: lazarusidestrconsts.lismenuviewobjectinspector 14513msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" 14514msgid "Object Inspector" 14515msgstr "Inspector dels objectes" 14516 14517#: lazarusidestrconsts.lismenuviewprojectsource 14518msgid "&View Project Source" 14519msgstr "" 14520 14521#: lazarusidestrconsts.lismenuviewpseudoterminal 14522msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal" 14523msgid "Console In/Output" 14524msgstr "" 14525 14526#: lazarusidestrconsts.lismenuviewregisters 14527msgctxt "lazarusidestrconsts.lismenuviewregisters" 14528msgid "Registers" 14529msgstr "" 14530 14531#: lazarusidestrconsts.lismenuviewrestrictionbrowser 14532msgid "Restriction Browser" 14533msgstr "" 14534 14535#: lazarusidestrconsts.lismenuviewsearchresults 14536msgid "Search Results" 14537msgstr "Cerca els resultats" 14538 14539#: lazarusidestrconsts.lismenuviewsourceeditor 14540msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" 14541msgid "Source Editor" 14542msgstr "Editor del codi font" 14543 14544#: lazarusidestrconsts.lismenuviewtaborder 14545msgid "Tab Order" 14546msgstr "" 14547 14548#: lazarusidestrconsts.lismenuviewthreads 14549msgctxt "lazarusidestrconsts.lismenuviewthreads" 14550msgid "Threads" 14551msgstr "" 14552 14553#: lazarusidestrconsts.lismenuviewtoggleformunit 14554#, fuzzy 14555#| msgid "Toggle form/unit view" 14556msgid "Toggle Form/Unit View" 14557msgstr "Canvia visió forma/unitat" 14558 14559#: lazarusidestrconsts.lismenuviewunitdependencies 14560#, fuzzy 14561#| msgid "Unit Dependencies ..." 14562msgctxt "lazarusidestrconsts.lismenuviewunitdependencies" 14563msgid "Unit Dependencies" 14564msgstr "Mostra les dependències de les unitats" 14565 14566#: lazarusidestrconsts.lismenuviewunitinfo 14567#, fuzzy 14568#| msgid "Unit Information" 14569msgid "Unit Information ..." 14570msgstr "Mostra la informació de les unitats" 14571 14572#: lazarusidestrconsts.lismenuviewunits 14573#, fuzzy 14574#| msgid "Units..." 14575msgid "Units ..." 14576msgstr "Unitats..." 14577 14578#: lazarusidestrconsts.lismenuviewwatches 14579msgctxt "lazarusidestrconsts.lismenuviewwatches" 14580msgid "Watches" 14581msgstr "Controls" 14582 14583#: lazarusidestrconsts.lismenuwhatneedsbuilding 14584msgid "What Needs Building" 14585msgstr "" 14586 14587#: lazarusidestrconsts.lismenuwindow 14588msgid "&Window" 14589msgstr "" 14590 14591#: lazarusidestrconsts.lismeother 14592#, fuzzy 14593#| msgid "Other" 14594msgctxt "lazarusidestrconsts.lismeother" 14595msgid "Other tabs" 14596msgstr "Altres" 14597 14598#: lazarusidestrconsts.lismeprojects 14599msgid "Projects" 14600msgstr "" 14601 14602#: lazarusidestrconsts.lismessageseditor 14603msgid "Messages Editor" 14604msgstr "" 14605 14606#: lazarusidestrconsts.lismessageswindow 14607msgid "Messages Window" 14608msgstr "" 14609 14610#: lazarusidestrconsts.lismethodclassnotfound 14611msgid "Method class not found" 14612msgstr "" 14613 14614#: lazarusidestrconsts.lismissingdirectory 14615#, object-pascal-format 14616msgid "missing directory \"%s\"" 14617msgstr "" 14618 14619#: lazarusidestrconsts.lismissingevents 14620msgid "Missing Events" 14621msgstr "" 14622 14623#: lazarusidestrconsts.lismissingexecutable 14624#, object-pascal-format 14625msgid "missing executable \"%s\"" 14626msgstr "" 14627 14628#: lazarusidestrconsts.lismissingidentifiers 14629msgid "Missing identifiers" 14630msgstr "" 14631 14632#: lazarusidestrconsts.lismissingpackages 14633msgid "Missing Packages" 14634msgstr "Paquets que falten" 14635 14636#: lazarusidestrconsts.lismissingunitschoices 14637msgid "Your choices are:" 14638msgstr "" 14639 14640#: lazarusidestrconsts.lismissingunitscomment 14641msgid "Comment Out" 14642msgstr "" 14643 14644#: lazarusidestrconsts.lismissingunitsfordelphi 14645msgid "For Delphi only" 14646msgstr "" 14647 14648#: lazarusidestrconsts.lismissingunitsinfo1 14649msgid "1) Comment out the selected units." 14650msgstr "" 14651 14652#: lazarusidestrconsts.lismissingunitsinfo1b 14653msgid "1) Use the units only for Delphi." 14654msgstr "" 14655 14656#: lazarusidestrconsts.lismissingunitsinfo2 14657msgid "2) Search for units. Found paths are added to project settings." 14658msgstr "" 14659 14660#: lazarusidestrconsts.lismissingunitsinfo3 14661msgid "3) Abort now, install packages or fix paths and try again." 14662msgstr "" 14663 14664#: lazarusidestrconsts.lismissingunitssearch 14665msgid "Search Unit Path" 14666msgstr "" 14667 14668#: lazarusidestrconsts.lismissingunitsskip 14669msgid "Skip this Unit" 14670msgstr "" 14671 14672#: lazarusidestrconsts.lismitnotice 14673msgid "" 14674"<description>\n" 14675"\n" 14676"Copyright (c) <year> <copyright holders>\n" 14677"\n" 14678"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" 14679"\n" 14680"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" 14681"\n" 14682"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." 14683msgstr "" 14684 14685#: lazarusidestrconsts.lismmadditionsandoverrides 14686msgid "Additions and Overrides" 14687msgstr "" 14688 14689#: lazarusidestrconsts.lismmaddscustomoptions 14690msgid "Adds custom options:" 14691msgstr "" 14692 14693#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag 14694msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" 14695msgstr "" 14696 14697#: lazarusidestrconsts.lismmapplytoallpackages 14698msgid "Apply to all packages." 14699msgstr "" 14700 14701#: lazarusidestrconsts.lismmapplytoallpackagesandprojects 14702msgid "Apply to all packages and projects." 14703msgstr "" 14704 14705#: lazarusidestrconsts.lismmapplytoallpackagesmatching 14706#, object-pascal-format 14707msgid "Apply to all packages matching name \"%s\"" 14708msgstr "" 14709 14710#: lazarusidestrconsts.lismmapplytoproject 14711msgid "Apply to project." 14712msgstr "" 14713 14714#: lazarusidestrconsts.lismmcreateanewgroupofoptions 14715msgid "Create a new group of options" 14716msgstr "" 14717 14718#: lazarusidestrconsts.lismmcustomoption 14719msgid "Custom Option" 14720msgstr "" 14721 14722#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption 14723msgid "Delete the selected target or option" 14724msgstr "" 14725 14726#: lazarusidestrconsts.lismmdoesnotaddcustomoptions 14727msgid "Does not add custom options:" 14728msgstr "" 14729 14730#: lazarusidestrconsts.lismmdoesnothaveidemacro 14731#, object-pascal-format 14732msgid "Does not have IDE Macro %s:=%s" 14733msgstr "" 14734 14735#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu 14736msgid "Does not override OutDir (-FU)" 14737msgstr "" 14738 14739#: lazarusidestrconsts.lismmexcludeallpackagesmatching 14740#, object-pascal-format 14741msgid "Exclude all packages matching name \"%s\"" 14742msgstr "" 14743 14744#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound 14745#, object-pascal-format 14746msgid "expected \":=\" after macro name but found \"%s\"" 14747msgstr "" 14748 14749#: lazarusidestrconsts.lismmexpectedmacronamebutfound 14750#, object-pascal-format 14751msgid "expected macro name but found \"%s\"" 14752msgstr "" 14753 14754#: lazarusidestrconsts.lismmfromto 14755#, object-pascal-format 14756msgid "From %s to %s" 14757msgstr "" 14758 14759#: lazarusidestrconsts.lismmidemacro 14760msgid "IDE Macro" 14761msgstr "" 14762 14763#: lazarusidestrconsts.lismmidemacro2 14764#, object-pascal-format 14765msgid "IDE Macro %s:=%s" 14766msgstr "" 14767 14768#: lazarusidestrconsts.lismminvalidcharacterat 14769#, object-pascal-format 14770msgid "invalid character \"%s\" at %s" 14771msgstr "" 14772 14773#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue 14774#, object-pascal-format 14775msgid "invalid character in macro value \"%s\"" 14776msgstr "" 14777 14778#: lazarusidestrconsts.lismmmissingmacroname 14779msgid "missing macro name" 14780msgstr "" 14781 14782#: lazarusidestrconsts.lismmmoveselecteditemdown 14783msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown" 14784msgid "Move selected item down" 14785msgstr "" 14786 14787#: lazarusidestrconsts.lismmmoveselecteditemup 14788msgctxt "lazarusidestrconsts.lismmmoveselecteditemup" 14789msgid "Move selected item up" 14790msgstr "" 14791 14792#: lazarusidestrconsts.lismmnewtarget 14793msgid "New Target" 14794msgstr "" 14795 14796#: lazarusidestrconsts.lismmoverrideoutdirfu 14797#, object-pascal-format 14798msgid "Override OutDir (-FU): %s" 14799msgstr "" 14800 14801#: lazarusidestrconsts.lismmoverrideoutputdirectory 14802msgid "Override output directory (-FU)" 14803msgstr "" 14804 14805#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget 14806msgid "Override output directory -FU of target" 14807msgstr "" 14808 14809#: lazarusidestrconsts.lismmredolastundotothisgrid 14810msgid "Redo last undo to this grid" 14811msgstr "" 14812 14813#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32 14814msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32" 14815msgstr "" 14816 14817#: lazarusidestrconsts.lismmsets 14818#, object-pascal-format 14819msgid "Set \"%s\"" 14820msgstr "" 14821 14822#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml 14823msgid "Stored in IDE (environmentoptions.xml)" 14824msgstr "" 14825 14826#: lazarusidestrconsts.lismmstoredinprojectlpi 14827msgid "Stored in project (.lpi)" 14828msgstr "" 14829 14830#: lazarusidestrconsts.lismmstoredinsessionofprojectlps 14831msgid "Stored in session of project (.lps)" 14832msgstr "" 14833 14834#: lazarusidestrconsts.lismmtargets 14835msgid "Targets: " 14836msgstr "" 14837 14838#: lazarusidestrconsts.lismmundolastchangetothisgrid 14839msgid "Undo last change to this grid" 14840msgstr "" 14841 14842#: lazarusidestrconsts.lismmusesystemencoding 14843msgid "Use system encoding" 14844msgstr "" 14845 14846#: lazarusidestrconsts.lismmusesystemencodinghint 14847msgid "Disable support for UTF-8 default string encoding." 14848msgstr "" 14849 14850#: lazarusidestrconsts.lismmvalues 14851#, object-pascal-format 14852msgid "Value \"%s\"" 14853msgstr "" 14854 14855#: lazarusidestrconsts.lismmwas 14856#, object-pascal-format 14857msgid "(was \"%s\")" 14858msgstr "" 14859 14860#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject 14861msgid "WidgetSet change is available only for LCL projects" 14862msgstr "" 14863 14864#: lazarusidestrconsts.lismode 14865#, object-pascal-format 14866msgid ", Mode: %s" 14867msgstr "" 14868 14869#: lazarusidestrconsts.lismodifiedlgplnotice 14870msgid "" 14871"<description>\n" 14872"\n" 14873"Copyright (C) <year> <name of author> <contact>\n" 14874"\n" 14875"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" 14876"\n" 14877"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" 14878"\n" 14879"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 14880"\n" 14881"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 14882msgstr "" 14883 14884#: lazarusidestrconsts.lismodify 14885msgid "&Modify" 14886msgstr "" 14887 14888#: lazarusidestrconsts.lismore 14889msgctxt "lazarusidestrconsts.lismore" 14890msgid "More" 14891msgstr "" 14892 14893#: lazarusidestrconsts.lismoresub 14894msgctxt "lazarusidestrconsts.lismoresub" 14895msgid "More" 14896msgstr "" 14897 14898#: lazarusidestrconsts.lismove 14899msgid "Move" 14900msgstr "" 14901 14902#: lazarusidestrconsts.lismovedown 14903msgid "Move Down" 14904msgstr "" 14905 14906#: lazarusidestrconsts.lismovefiles 14907msgid "Move Files" 14908msgstr "" 14909 14910#: lazarusidestrconsts.lismovefiles2 14911msgid "Move files?" 14912msgstr "" 14913 14914#: lazarusidestrconsts.lismovefilesfromtothedirectoryof 14915#, object-pascal-format 14916msgid "Move %s file(s) from %s to the directory%s%s%sof %s?" 14917msgstr "" 14918 14919#: lazarusidestrconsts.lismoveonepositiondown 14920#, object-pascal-format 14921msgid "Move \"%s\" one position down" 14922msgstr "" 14923 14924#: lazarusidestrconsts.lismoveonepositionup 14925#, object-pascal-format 14926msgid "Move \"%s\" one position up" 14927msgstr "" 14928 14929#: lazarusidestrconsts.lismoveorcopyfiles 14930msgid "Move or Copy files?" 14931msgstr "" 14932 14933#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage 14934#, object-pascal-format 14935msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?" 14936msgstr "" 14937 14938#: lazarusidestrconsts.lismovepage 14939msgid "Move Page" 14940msgstr "" 14941 14942#: lazarusidestrconsts.lismoveselecteddown 14943msgid "Move selected item down (Ctrl+Down)" 14944msgstr "" 14945 14946#: lazarusidestrconsts.lismoveselectedup 14947msgid "Move selected item up (Ctrl+Up)" 14948msgstr "" 14949 14950#: lazarusidestrconsts.lismoveto 14951msgid "Move to: " 14952msgstr "" 14953 14954#: lazarusidestrconsts.lismoveup 14955msgid "Move Up" 14956msgstr "" 14957 14958#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa 14959msgid "Moving these units will break their uses sections. See Messages window for details." 14960msgstr "" 14961 14962#: lazarusidestrconsts.lismpcstyle 14963msgid "C style: \" => \\\"" 14964msgstr "" 14965 14966#: lazarusidestrconsts.lismpescapequotes 14967msgid "Escape "es" 14968msgstr "" 14969 14970#: lazarusidestrconsts.lismpmultipaste 14971msgctxt "lazarusidestrconsts.lismpmultipaste" 14972msgid "MultiPaste" 14973msgstr "" 14974 14975#: lazarusidestrconsts.lismppascalstyle 14976msgid "Pascal style: ' => ''" 14977msgstr "" 14978 14979#: lazarusidestrconsts.lismppasteoptions 14980msgid "Paste &options" 14981msgstr "" 14982 14983#: lazarusidestrconsts.lismppreview 14984msgid "&Preview" 14985msgstr "" 14986 14987#: lazarusidestrconsts.lismptextaftereachline 14988msgid "Text &after each line" 14989msgstr "" 14990 14991#: lazarusidestrconsts.lismptextbeforeeachline 14992msgid "Text &before each line" 14993msgstr "" 14994 14995#: lazarusidestrconsts.lismptrimclipboardcontents 14996msgid "&Trim clipboard contents" 14997msgstr "" 14998 14999#: lazarusidestrconsts.lisms 15000msgid "(ms)" 15001msgstr "" 15002 15003#: lazarusidestrconsts.lismsgcolors 15004msgid "Message colors" 15005msgstr "" 15006 15007#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons 15008msgid "Multiple directories are separated with semicolons" 15009msgstr "" 15010 15011#: lazarusidestrconsts.lismultiplepack 15012msgid ", multiple packages: " 15013msgstr "" 15014 15015#: lazarusidestrconsts.lismvsavemessagestofiletxt 15016msgid "Save messages to file (*.txt)" 15017msgstr "Desa missatges a arxiu (*.txt)" 15018 15019#: lazarusidestrconsts.lisname 15020msgctxt "lazarusidestrconsts.lisname" 15021msgid "Name" 15022msgstr "Nom" 15023 15024#: lazarusidestrconsts.lisnameconflict 15025msgid "Name conflict" 15026msgstr "" 15027 15028#: lazarusidestrconsts.lisnameofactivebuildmode 15029msgid "Name of active build mode" 15030msgstr "" 15031 15032#: lazarusidestrconsts.lisnameofnewprocedure 15033msgid "Name of new procedure" 15034msgstr "Nom del nou procediment" 15035 15036#: lazarusidestrconsts.lisnever 15037msgctxt "lazarusidestrconsts.lisnever" 15038msgid "Never" 15039msgstr "" 15040 15041#: lazarusidestrconsts.lisnew 15042msgctxt "lazarusidestrconsts.lisnew" 15043msgid "New" 15044msgstr "Nou" 15045 15046#: lazarusidestrconsts.lisnewclass 15047msgid "New Class" 15048msgstr "Nova Classe" 15049 15050#: lazarusidestrconsts.lisnewconsoleapplication 15051msgid "New console application" 15052msgstr "" 15053 15054#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype 15055#, object-pascal-format 15056msgid "Create a new editor file.%sChoose a type." 15057msgstr "Crea un nou fitxer d'editor.%sEscolliu-ne un tipus" 15058 15059#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile 15060msgid "Create a new empty text file." 15061msgstr "Crea un nou fitxer de text buit." 15062 15063#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype 15064#, object-pascal-format 15065msgid "Create a new project.%sChoose a type." 15066msgstr "Crea un nou projecte.%sEscolliu-ne un tipus." 15067 15068#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun 15069#, object-pascal-format 15070msgid "Create a new standard package.%sA package is a collection of units and components." 15071msgstr "Crea un nou paquet normalitzat.%sUn paquet és una col·lecció d'unitats i components." 15072 15073#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule 15074msgid "Create a new unit with a datamodule." 15075msgstr "Crea una nova unitat amb un mòdul de dades." 15076 15077#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe 15078msgid "Create a new unit with a frame." 15079msgstr "" 15080 15081#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform 15082msgid "Create a new unit with a LCL form." 15083msgstr "Crea una nova unitat amb una forma LCL." 15084 15085#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent 15086msgid "Inherit from a project form or component" 15087msgstr "" 15088 15089#: lazarusidestrconsts.lisnewdlgnoitemselected 15090msgid "No item selected" 15091msgstr "No hi ha cap element seleccionat" 15092 15093#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst 15094msgid "Please select an item first." 15095msgstr "Si us plau, primer seleccioneu un element." 15096 15097#: lazarusidestrconsts.lisnewencoding 15098msgid "New encoding:" 15099msgstr "" 15100 15101#: lazarusidestrconsts.lisnewmacroname 15102#, object-pascal-format 15103msgid "Macro %d" 15104msgstr "" 15105 15106#: lazarusidestrconsts.lisnewmacroname2 15107msgid "New Macroname" 15108msgstr "" 15109 15110#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting 15111msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order." 15112msgstr "" 15113 15114#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd 15115msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last." 15116msgstr "" 15117 15118#: lazarusidestrconsts.lisnewpage 15119msgid "New page" 15120msgstr "" 15121 15122#: lazarusidestrconsts.lisnewproject 15123#, fuzzy, badformat 15124#| msgid "%s - (new project)" 15125msgid "(new project)" 15126msgstr "%s - (nou projecte)" 15127 15128#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved 15129msgid "New recorded macros. Not to be saved" 15130msgstr "" 15131 15132#: lazarusidestrconsts.lisnewunitsareaddedtousessections 15133msgid "New units are added to uses sections" 15134msgstr "" 15135 15136#: lazarusidestrconsts.lisno 15137msgid "No" 15138msgstr "" 15139 15140#: lazarusidestrconsts.lisnoautosaveactivedesktop 15141msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually." 15142msgstr "" 15143 15144#: lazarusidestrconsts.lisnobackupfiles 15145msgid "No backup files" 15146msgstr "" 15147 15148#: lazarusidestrconsts.lisnobuildprofilesselected 15149msgid "No profiles are selected to be built." 15150msgstr "" 15151 15152#: lazarusidestrconsts.lisnochange 15153msgid "No change" 15154msgstr "Cap canvi" 15155 15156#: lazarusidestrconsts.lisnocodeselected 15157msgid "No code selected" 15158msgstr "No hi ha codi seleccionat" 15159 15160#: lazarusidestrconsts.lisnocompileroptionsinherited 15161msgid "No compiler options inherited." 15162msgstr "No s'han heretat les opcions del compilador" 15163 15164#: lazarusidestrconsts.lisnofppkgprefix 15165msgid "empty Free Pascal compiler prefix." 15166msgstr "" 15167 15168#: lazarusidestrconsts.lisnohints 15169msgid "no hints" 15170msgstr "" 15171 15172#: lazarusidestrconsts.lisnoidewindowselected 15173msgid "No IDE window selected" 15174msgstr "" 15175 15176#: lazarusidestrconsts.lisnolfmfile 15177msgid "No LFM file" 15178msgstr "" 15179 15180#: lazarusidestrconsts.lisnomacroselected 15181msgid "No macro selected" 15182msgstr "" 15183 15184#: lazarusidestrconsts.lisnomessageselected 15185msgid "(no message selected)" 15186msgstr "" 15187 15188#: lazarusidestrconsts.lisnoname 15189msgid "noname" 15190msgstr "sense nom" 15191 15192#: lazarusidestrconsts.lisnone 15193#, object-pascal-format 15194msgid "%snone" 15195msgstr "" 15196 15197#: lazarusidestrconsts.lisnoneclicktochooseone 15198msgid "none, click to choose one" 15199msgstr "" 15200 15201#: lazarusidestrconsts.lisnoneselected 15202msgid "(None selected)" 15203msgstr "" 15204 15205#: lazarusidestrconsts.lisnonodeselected 15206msgid "no node selected" 15207msgstr "" 15208 15209#: lazarusidestrconsts.lisnopascalfile 15210msgid "No Pascal file" 15211msgstr "" 15212 15213#: lazarusidestrconsts.lisnoprogramfilesfound 15214#, object-pascal-format 15215msgid "No program file \"%s\" found." 15216msgstr "" 15217 15218#: lazarusidestrconsts.lisnoresourcestringsectionfound 15219msgid "No ResourceString Section found" 15220msgstr "No s'ha trobat la secció de la cadena del recurs" 15221 15222#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta 15223msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" 15224msgstr "" 15225 15226#: lazarusidestrconsts.lisnostringconstantfound 15227msgid "No string constant found" 15228msgstr "No s'ha trobat la constant de cadena" 15229 15230#: lazarusidestrconsts.lisnotadesigntimepackage 15231msgid "Not a designtime package" 15232msgstr "" 15233 15234#: lazarusidestrconsts.lisnotaninstallpackage 15235msgid "Not an install package" 15236msgstr "" 15237 15238#: lazarusidestrconsts.lisnotavalidfppkgprefix 15239msgid "Free Pascal compiler not found at the given prefix." 15240msgstr "" 15241 15242#: lazarusidestrconsts.lisnotavalidpascalidentifier 15243msgid "Not a valid Pascal identifier" 15244msgstr "" 15245 15246#: lazarusidestrconsts.lisnote 15247msgctxt "lazarusidestrconsts.lisnote" 15248msgid "Note" 15249msgstr "" 15250 15251#: lazarusidestrconsts.lisnotebooktabposbottom 15252msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" 15253msgid "Bottom" 15254msgstr "" 15255 15256#: lazarusidestrconsts.lisnotebooktabposleft 15257msgctxt "lazarusidestrconsts.lisnotebooktabposleft" 15258msgid "Left" 15259msgstr "Esquerra" 15260 15261#: lazarusidestrconsts.lisnotebooktabposright 15262msgctxt "lazarusidestrconsts.lisnotebooktabposright" 15263msgid "Right" 15264msgstr "Dreta" 15265 15266#: lazarusidestrconsts.lisnotebooktabpostop 15267msgctxt "lazarusidestrconsts.lisnotebooktabpostop" 15268msgid "Top" 15269msgstr "" 15270 15271#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal 15272msgid "NOTE: Could not create Define Template for Free Pascal Sources" 15273msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Free Pascal" 15274 15275#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources 15276msgid "NOTE: Could not create Define Template for Lazarus Sources" 15277msgstr "Nota: No s'ha pogut crear la plantilla definida per les fonts del Lazarus" 15278 15279#: lazarusidestrconsts.lisnotemplateselected 15280msgid "no template selected" 15281msgstr "" 15282 15283#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated 15284#, object-pascal-format 15285msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated" 15286msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated." 15287msgstr "" 15288 15289#: lazarusidestrconsts.lisnotimplemented 15290msgid "Not implemented" 15291msgstr "" 15292 15293#: lazarusidestrconsts.lisnotimplementedyet 15294#, object-pascal-format 15295msgid "Not implemented yet:%s%s" 15296msgstr "" 15297 15298#: lazarusidestrconsts.lisnotinstalled 15299msgid "not installed" 15300msgstr "" 15301 15302#: lazarusidestrconsts.lisnotinstalledpackages 15303msgid "Not installed packages" 15304msgstr "" 15305 15306#: lazarusidestrconsts.lisnotnow 15307msgid "Not now" 15308msgstr "Ara no" 15309 15310#: lazarusidestrconsts.lisnowloadedscheme 15311msgid "Now loaded: " 15312msgstr "" 15313 15314#: lazarusidestrconsts.lisnpcreate 15315msgid "Create" 15316msgstr "Crea" 15317 15318#: lazarusidestrconsts.lisnpcreateanewproject 15319msgid "Create a new project" 15320msgstr "Crea un nou projecte" 15321 15322#: lazarusidestrconsts.lisnumberoffilestoconvert 15323#, object-pascal-format 15324msgid "Number of files to convert: %s" 15325msgstr "" 15326 15327#: lazarusidestrconsts.lisobjectinspectorbecomesvisible 15328msgid "Object Inspector becomes visible when components are selected in designer." 15329msgstr "" 15330 15331#: lazarusidestrconsts.lisobjectpascaldefault 15332msgid "Object Pascal - default" 15333msgstr "" 15334 15335#: lazarusidestrconsts.lisobjectpath 15336msgid "object path" 15337msgstr "trajectòria dels objectes" 15338 15339#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab 15340msgid "Switch to Object Inspector Favorites tab" 15341msgstr "" 15342 15343#: lazarusidestrconsts.lisoff 15344msgid "? (Off)" 15345msgstr "" 15346 15347#: lazarusidestrconsts.lisofpackage 15348#, object-pascal-format 15349msgid " of package %s" 15350msgstr "" 15351 15352#: lazarusidestrconsts.lisoftheprojectinspector 15353msgid " of the Project Inspector" 15354msgstr "" 15355 15356#: lazarusidestrconsts.lisoifaddtofavoriteproperties 15357msgid "Add to favorite properties" 15358msgstr "" 15359 15360#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty 15361#, object-pascal-format 15362msgid "Choose a base class for the favorite property \"%s\"." 15363msgstr "" 15364 15365#: lazarusidestrconsts.lisoifclassnotfound 15366#, object-pascal-format, fuzzy, badformat 15367#| msgid "Class %s%s%s not found." 15368msgid "Class \"%s\" not found." 15369msgstr "No s'ha trobat la Classe %s%s%S" 15370 15371#: lazarusidestrconsts.lisoifremovefromfavoriteproperties 15372msgid "Remove from favorite properties" 15373msgstr "" 15374 15375#: lazarusidestrconsts.lisoipautoinstalldynamic 15376msgid "auto install dynamic" 15377msgstr "auto intal·la dinàmicament" 15378 15379#: lazarusidestrconsts.lisoipautoinstallstatic 15380msgid "auto install static" 15381msgstr "auto intal·la estàticament" 15382 15383#: lazarusidestrconsts.lisoipdescription 15384msgid "Description: " 15385msgstr "Descripció: " 15386 15387#: lazarusidestrconsts.lisoipdescriptiondescription 15388#, object-pascal-format 15389msgid "%sDescription: %s" 15390msgstr "%sDescripció: %s" 15391 15392#: lazarusidestrconsts.lisoipfilename 15393#, object-pascal-format 15394msgid "Filename: %s" 15395msgstr "Nom del fitxer: %s" 15396 15397#: lazarusidestrconsts.lisoipinstalleddynamic 15398msgid "installed dynamic" 15399msgstr "instal·lat dinàmicament" 15400 15401#: lazarusidestrconsts.lisoipinstalledstatic 15402msgid "installed static" 15403msgstr "instal·lat estàticament" 15404 15405#: lazarusidestrconsts.lisoiplicenselicense 15406#, object-pascal-format 15407msgid "%sLicense: %s" 15408msgstr "" 15409 15410#: lazarusidestrconsts.lisoipmissing 15411msgid "missing" 15412msgstr "falta" 15413 15414#: lazarusidestrconsts.lisoipmodified 15415msgid "modified" 15416msgstr "modificat" 15417 15418#: lazarusidestrconsts.lisoipopenloadedpackage 15419#, fuzzy 15420#| msgid "Open loaded package" 15421msgid "Open Loaded Package" 15422msgstr "Obre el paquet carregat" 15423 15424#: lazarusidestrconsts.lisoippackagename 15425msgid "Package Name" 15426msgstr "Nom del paquet" 15427 15428#: lazarusidestrconsts.lisoippleaseselectapackage 15429msgid "Please select a package" 15430msgstr "Si us plau, seleccioneu un paquet" 15431 15432#: lazarusidestrconsts.lisoipreadonly 15433msgid "readonly" 15434msgstr "només de lectura" 15435 15436#: lazarusidestrconsts.lisoipstate 15437msgctxt "lazarusidestrconsts.lisoipstate" 15438msgid "State" 15439msgstr "Estat" 15440 15441#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound 15442#, object-pascal-format, fuzzy 15443#| msgid "%sThis package is installed, but the lpk file was not found" 15444msgid "%sThis package is installed but the lpk file was not found" 15445msgstr "%sAquest paquet està intal·lat, però no s'ha trobat el fitxer lpk" 15446 15447#: lazarusidestrconsts.lisok 15448msgctxt "lazarusidestrconsts.lisok" 15449msgid "OK" 15450msgstr "D'Acord" 15451 15452#: lazarusidestrconsts.lisoldclass 15453msgid "Old Class" 15454msgstr "" 15455 15456#: lazarusidestrconsts.lison 15457msgid "? (On)" 15458msgstr "" 15459 15460#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey 15461msgid "On break line (i.e. return or enter key)" 15462msgstr "" 15463 15464#: lazarusidestrconsts.lisonlinepackage 15465msgid "available in the main repository" 15466msgstr "" 15467 15468#: lazarusidestrconsts.lisonly32bit 15469msgid "only 32bit" 15470msgstr "" 15471 15472#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden 15473msgid "Only available on Windows. Run the tool hidden." 15474msgstr "" 15475 15476#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole 15477msgid "Only available on Windows. Run tool in a new console." 15478msgstr "" 15479 15480#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression 15481msgid "Only messages fitting this regular expression:" 15482msgstr "" 15483 15484#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated 15485msgid "Only messages with these FPC IDs (comma separated):" 15486msgstr "" 15487 15488#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild 15489msgid "Only register the Lazarus package files (.lpk). Do not build." 15490msgstr "" 15491 15492#: lazarusidestrconsts.lisonlysearchforwholewords 15493msgid "Only search for whole words" 15494msgstr "Cerca només paraules senceres" 15495 15496#: lazarusidestrconsts.lisonpastefromclipboard 15497msgid "On paste from clipboard" 15498msgstr "" 15499 15500#: lazarusidestrconsts.lisopen 15501msgctxt "lazarusidestrconsts.lisopen" 15502msgid "Open" 15503msgstr "Obre" 15504 15505#: lazarusidestrconsts.lisopenasxmlfile 15506msgid "Open as XML file" 15507msgstr "Obre com arxiu XML" 15508 15509#: lazarusidestrconsts.lisopendesigneronopenunit 15510msgid "Open designer on open unit" 15511msgstr "" 15512 15513#: lazarusidestrconsts.lisopendesigneronopenunithint 15514msgid "Form is loaded in designer always when source unit is opened." 15515msgstr "" 15516 15517#: lazarusidestrconsts.lisopenexistingfile 15518msgid "Open existing file" 15519msgstr "" 15520 15521#: lazarusidestrconsts.lisopenfile 15522#, fuzzy 15523#| msgid "Open file" 15524msgctxt "lazarusidestrconsts.lisopenfile" 15525msgid "Open File" 15526msgstr "Obre el fitxer" 15527 15528#: lazarusidestrconsts.lisopenfile2 15529#, fuzzy 15530#| msgid "Open file" 15531msgctxt "lazarusidestrconsts.lisopenfile2" 15532msgid "Open file" 15533msgstr "Obre el fitxer" 15534 15535#: lazarusidestrconsts.lisopenfileatcursor 15536msgid "Open file at cursor" 15537msgstr "" 15538 15539#: lazarusidestrconsts.lisopeninfileman 15540msgid "Open in file manager" 15541msgstr "" 15542 15543#: lazarusidestrconsts.lisopeninfilemanhint 15544msgid "Open destination directory in file manager" 15545msgstr "" 15546 15547#: lazarusidestrconsts.lisopenlfm 15548#, object-pascal-format 15549msgid "Open %s" 15550msgstr "Obre %s" 15551 15552#: lazarusidestrconsts.lisopenpackage 15553msgid "Open Package?" 15554msgstr "Voleu obrir el paquet?" 15555 15556#: lazarusidestrconsts.lisopenpackage2 15557#, object-pascal-format 15558msgid "Open package %s" 15559msgstr "" 15560 15561#: lazarusidestrconsts.lisopenpackagefile 15562msgid "Open Package File" 15563msgstr "Obre fitxer del paquet" 15564 15565#: lazarusidestrconsts.lisopenproject 15566msgid "Open Project?" 15567msgstr "Voleu obrir el projecte?" 15568 15569#: lazarusidestrconsts.lisopenproject2 15570msgid "Open project" 15571msgstr "Obre projecte" 15572 15573#: lazarusidestrconsts.lisopenprojectagain 15574msgid "Open project again" 15575msgstr "Opre projecte de nou" 15576 15577#: lazarusidestrconsts.lisopenprojectfile 15578msgid "Open Project File" 15579msgstr "Obre el fitxer de projecte" 15580 15581#: lazarusidestrconsts.lisopensymlink 15582msgid "Open symlink" 15583msgstr "" 15584 15585#: lazarusidestrconsts.lisopentarget 15586msgid "Open target" 15587msgstr "" 15588 15589#: lazarusidestrconsts.lisopenthefileasnormalsource 15590msgid "Open the file as normal source" 15591msgstr "" 15592 15593#: lazarusidestrconsts.lisopenthepackage 15594#, object-pascal-format 15595msgid "Open the package %s?" 15596msgstr "Obrir el paquet %s?" 15597 15598#: lazarusidestrconsts.lisopentheproject 15599#, object-pascal-format 15600msgid "Open the project %s?" 15601msgstr "Obrir el projecte %s?" 15602 15603#: lazarusidestrconsts.lisopentooloptions 15604msgid "Open Tool Options" 15605msgstr "" 15606 15607#: lazarusidestrconsts.lisopenunit 15608msgid "Open Unit" 15609msgstr "" 15610 15611#: lazarusidestrconsts.lisopenurl 15612msgid "Open URL" 15613msgstr "" 15614 15615#: lazarusidestrconsts.lisopenxml 15616msgid "Open XML" 15617msgstr "" 15618 15619#: lazarusidestrconsts.lisoptions 15620#, fuzzy 15621msgctxt "lazarusidestrconsts.lisoptions" 15622msgid "Options" 15623msgstr "Opcions" 15624 15625#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb 15626msgid "Options changed, recompiling clean with -B" 15627msgstr "" 15628 15629#: lazarusidestrconsts.lisoptionvalueignored 15630msgid "ignored" 15631msgstr "" 15632 15633#: lazarusidestrconsts.lisor 15634msgid "or" 15635msgstr "" 15636 15637#: lazarusidestrconsts.lisos 15638#, object-pascal-format 15639msgid ", OS: %s" 15640msgstr "" 15641 15642#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa 15643#, object-pascal-format 15644msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path." 15645msgstr "" 15646 15647#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource 15648#, object-pascal-format 15649msgid "output directory of %s contains Pascal unit source \"%s\"" 15650msgstr "" 15651 15652#: lazarusidestrconsts.lisoutputfilenameofproject 15653msgid "Output filename of project" 15654msgstr "" 15655 15656#: lazarusidestrconsts.lisoverridelanguage 15657msgid "Override language. For example --language=de. For possible values see files in the languages directory." 15658msgstr "" 15659 15660#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype 15661msgid "Override function result string types with the first parameter expression type" 15662msgstr "" 15663 15664#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd 15665#, object-pascal-format 15666msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" 15667msgstr "" 15668 15669#: lazarusidestrconsts.lisoverridetheprojectbuildmode 15670#, object-pascal-format 15671msgid "%soverride the project or IDE build mode." 15672msgstr "" 15673 15674#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 15675#, object-pascal-format 15676msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" 15677msgstr "" 15678 15679#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau 15680#, object-pascal-format 15681msgid "%soverride the project operating system. e.g. win32 linux. default: %s" 15682msgstr "" 15683 15684#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond 15685#, object-pascal-format 15686msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" 15687msgstr "" 15688 15689#: lazarusidestrconsts.lisoverwritefile 15690msgid "Overwrite file?" 15691msgstr "Voleu sobrescriure el fitxer?" 15692 15693#: lazarusidestrconsts.lisoverwritefileondisk 15694msgid "Overwrite file on disk" 15695msgstr "Sobreescriu arxiu al disc" 15696 15697#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot 15698msgid "'Owner' is already used by TReader/TWriter. Please choose another name." 15699msgstr "" 15700 15701#: lazarusidestrconsts.lispackage 15702msgid "Package" 15703msgstr "Paquet" 15704 15705#: lazarusidestrconsts.lispackage2 15706#, object-pascal-format 15707msgid "package %s" 15708msgstr "" 15709 15710#: lazarusidestrconsts.lispackage3 15711#, object-pascal-format 15712msgid ", package %s" 15713msgstr "" 15714 15715#: lazarusidestrconsts.lispackageinfo 15716#, fuzzy 15717#| msgid "Package Info" 15718msgid "Package info" 15719msgstr "Informació del Paquet" 15720 15721#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint 15722#, object-pascal-format 15723msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages." 15724msgstr "" 15725 15726#: lazarusidestrconsts.lispackagenamebeginswith 15727msgid "Package name begins with ..." 15728msgstr "" 15729 15730#: lazarusidestrconsts.lispackagenamecontains 15731msgid "Package name contains ..." 15732msgstr "" 15733 15734#: lazarusidestrconsts.lispackageneedsanoutputdirectory 15735msgid "Package needs an output directory." 15736msgstr "" 15737 15738#: lazarusidestrconsts.lispackageneedsinstallation 15739msgid "Package needs installation" 15740msgstr "S'ha d'instal·lar el paquet" 15741 15742#: lazarusidestrconsts.lispackageoption 15743#, object-pascal-format 15744msgid "Package \"%s\" Option" 15745msgstr "" 15746 15747#: lazarusidestrconsts.lispackageoutputdirectories 15748msgid "Package output directories" 15749msgstr "" 15750 15751#: lazarusidestrconsts.lispackagesourcedirectories 15752msgid "Package source directories" 15753msgstr "" 15754 15755#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes 15756#, object-pascal-format 15757msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s" 15758msgstr "" 15759 15760#: lazarusidestrconsts.lispackageunit 15761msgid "package unit" 15762msgstr "" 15763 15764#: lazarusidestrconsts.lispage 15765msgctxt "lazarusidestrconsts.lispage" 15766msgid "Page" 15767msgstr "" 15768 15769#: lazarusidestrconsts.lispagename 15770msgid "Page name" 15771msgstr "" 15772 15773#: lazarusidestrconsts.lispagenamealreadyexists 15774#, object-pascal-format 15775msgid "Page name \"%s\" already exists. Not added." 15776msgstr "" 15777 15778#: lazarusidestrconsts.lispanic 15779msgctxt "lazarusidestrconsts.lispanic" 15780msgid "Panic" 15781msgstr "" 15782 15783#: lazarusidestrconsts.lisparsed 15784msgid ", parsed " 15785msgstr "" 15786 15787#: lazarusidestrconsts.lisparser 15788#, object-pascal-format 15789msgid "parser \"%s\": %s" 15790msgstr "" 15791 15792#: lazarusidestrconsts.lisparsers 15793msgid "Parsers:" 15794msgstr "" 15795 15796#: lazarusidestrconsts.lispasscount 15797msgid "Pass Count" 15798msgstr "" 15799 15800#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues 15801#, object-pascal-format 15802msgid "passing compiler define \"%s\" twice with different values" 15803msgstr "" 15804 15805#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues 15806#, object-pascal-format 15807msgid "passing compiler option -%s twice with different values" 15808msgstr "" 15809 15810#: lazarusidestrconsts.lispaste 15811msgctxt "lazarusidestrconsts.lispaste" 15812msgid "Paste" 15813msgstr "Enganxa" 15814 15815#: lazarusidestrconsts.lispasteclipboard 15816msgid "paste clipboard" 15817msgstr "" 15818 15819#: lazarusidestrconsts.lispastefromclipboard 15820msgctxt "lazarusidestrconsts.lispastefromclipboard" 15821msgid "Paste from clipboard." 15822msgstr "" 15823 15824#: lazarusidestrconsts.lispastelcolors 15825msgid "Pastel Colors" 15826msgstr "" 15827 15828#: lazarusidestrconsts.lispath 15829msgid "Path" 15830msgstr "" 15831 15832#: lazarusidestrconsts.lispatheditbrowse 15833msgctxt "lazarusidestrconsts.lispatheditbrowse" 15834msgid "Browse" 15835msgstr "Navega" 15836 15837#: lazarusidestrconsts.lispatheditdeleteinvalidpaths 15838msgid "Delete Invalid Paths" 15839msgstr "" 15840 15841#: lazarusidestrconsts.lispatheditmovepathdown 15842#, fuzzy 15843#| msgid "Move path down" 15844msgid "Move path down (Ctrl+Down)" 15845msgstr "Mou la trajectòria avall" 15846 15847#: lazarusidestrconsts.lispatheditmovepathup 15848#, fuzzy 15849#| msgid "Move path up" 15850msgid "Move path up (Ctrl+Up)" 15851msgstr "Mou la trajectòria amunt" 15852 15853#: lazarusidestrconsts.lispatheditoraddhint 15854msgid "Add new path to the list" 15855msgstr "" 15856 15857#: lazarusidestrconsts.lispatheditordeletehint 15858msgid "Delete the selected path" 15859msgstr "" 15860 15861#: lazarusidestrconsts.lispatheditordeleteinvalidhint 15862msgid "Remove non-existent (gray) paths from the list" 15863msgstr "" 15864 15865#: lazarusidestrconsts.lispatheditorreplacehint 15866msgid "Replace the selected path with a new path" 15867msgstr "" 15868 15869#: lazarusidestrconsts.lispatheditortempladdhint 15870msgid "Add template to the list" 15871msgstr "" 15872 15873#: lazarusidestrconsts.lispatheditpathtemplates 15874msgid "Path templates" 15875msgstr "Plantilles de la trajectòria" 15876 15877#: lazarusidestrconsts.lispatheditsearchpaths 15878msgid "Search paths:" 15879msgstr "Trajectòries de recerca:" 15880 15881#: lazarusidestrconsts.lispathisnodirectory 15882msgid "is not a directory" 15883msgstr "" 15884 15885#: lazarusidestrconsts.lispathoftheinstantfpccache 15886msgid "path of the instantfpc cache" 15887msgstr "" 15888 15889#: lazarusidestrconsts.lispathofthemakeutility 15890msgid "Path of the make utility" 15891msgstr "" 15892 15893#: lazarusidestrconsts.lispathtoinstance 15894msgid "Path to failed Instance:" 15895msgstr "" 15896 15897#: lazarusidestrconsts.lispause 15898msgctxt "lazarusidestrconsts.lispause" 15899msgid "Pause" 15900msgstr "Pausa" 15901 15902#: lazarusidestrconsts.lispckcleartousethepackagename 15903msgid "Clear to use the package name" 15904msgstr "" 15905 15906#: lazarusidestrconsts.lispckdisablei18noflfm 15907msgid "Disable I18N of lfm" 15908msgstr "" 15909 15910#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem 15911msgid "Add Files from File System" 15912msgstr "" 15913 15914#: lazarusidestrconsts.lispckeditaddotheritems 15915msgid "Add other items" 15916msgstr "" 15917 15918#: lazarusidestrconsts.lispckeditaddtoproject 15919#, fuzzy 15920#| msgid "Add to project" 15921msgctxt "lazarusidestrconsts.lispckeditaddtoproject" 15922msgid "Add to Project" 15923msgstr "Afegeix al projecte" 15924 15925#: lazarusidestrconsts.lispckeditapplychanges 15926msgid "Apply changes" 15927msgstr "Aplica els canvis" 15928 15929#: lazarusidestrconsts.lispckeditavailableonline 15930msgid "(available online)" 15931msgstr "" 15932 15933#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit 15934#, object-pascal-format 15935msgid "Call %sRegister%s procedure of selected unit" 15936msgstr "Crida %sRegistre%s procediment de l'unitat seleccionada" 15937 15938#: lazarusidestrconsts.lispckeditcheckavailabilityonline 15939msgid "Check availability online" 15940msgstr "" 15941 15942#: lazarusidestrconsts.lispckeditcleanupdependencies 15943msgid "Clean up dependencies ..." 15944msgstr "" 15945 15946#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency 15947msgid "Clear default/preferred filename of dependency" 15948msgstr "" 15949 15950#: lazarusidestrconsts.lispckeditcommonoptions 15951msgid "Common" 15952msgstr "" 15953 15954#: lazarusidestrconsts.lispckeditcompileeverything 15955msgid "Compile everything?" 15956msgstr "Voleu compilar-ho tot?" 15957 15958#: lazarusidestrconsts.lispckeditcompilepackage 15959msgid "Compile package" 15960msgstr "Compila el paquet" 15961 15962#: lazarusidestrconsts.lispckeditcompileroptionsforpackage 15963#, object-pascal-format 15964msgid "Compiler Options for Package %s" 15965msgstr "Opcions del compilador pel paquet %s" 15966 15967#: lazarusidestrconsts.lispckeditcreatefpmakefile 15968msgid "Create fpmake.pp" 15969msgstr "" 15970 15971#: lazarusidestrconsts.lispckeditcreatemakefile 15972msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" 15973msgid "Create Makefile" 15974msgstr "Crea Makefile" 15975 15976#: lazarusidestrconsts.lispckeditdefault 15977#, object-pascal-format 15978msgid "%s, default: %s" 15979msgstr "" 15980 15981#: lazarusidestrconsts.lispckeditdependencyproperties 15982msgid "Dependency Properties" 15983msgstr "" 15984 15985#: lazarusidestrconsts.lispckediteditgeneraloptions 15986#, fuzzy 15987#| msgid "Edit General Options" 15988msgid "Edit general options" 15989msgstr "Edita les opcions generals" 15990 15991#: lazarusidestrconsts.lispckeditfileproperties 15992msgid "File Properties" 15993msgstr "Propietats del fitxer" 15994 15995#: lazarusidestrconsts.lispckeditfpmakepackage 15996msgid "(fpmake)" 15997msgstr "" 15998 15999#: lazarusidestrconsts.lispckeditinstall 16000msgid "Install" 16001msgstr "Instal·la" 16002 16003#: lazarusidestrconsts.lispckeditinvalidmaximumversion 16004msgid "Invalid maximum version" 16005msgstr "la versió màxima no és vàlida" 16006 16007#: lazarusidestrconsts.lispckeditinvalidminimumversion 16008msgid "Invalid minimum version" 16009msgstr "La versió mínima no és vàlida" 16010 16011#: lazarusidestrconsts.lispckeditmaximumversion 16012msgid "Maximum Version:" 16013msgstr "Número màxim de versió:" 16014 16015#: lazarusidestrconsts.lispckeditminimumversion 16016msgid "Minimum Version:" 16017msgstr "Número mínim de la versió:" 16018 16019#: lazarusidestrconsts.lispckeditmodified 16020#, object-pascal-format 16021msgid "Modified: %s" 16022msgstr "Modificat: %s" 16023 16024#: lazarusidestrconsts.lispckeditmovedependencydown 16025msgid "Move dependency down" 16026msgstr "Mou la dependènncia avall" 16027 16028#: lazarusidestrconsts.lispckeditmovedependencyup 16029msgid "Move dependency up" 16030msgstr "Mou la dependència amunt" 16031 16032#: lazarusidestrconsts.lispckeditpackage 16033#, object-pascal-format 16034msgid "Package %s" 16035msgstr "Paquet %s" 16036 16037#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage 16038#, object-pascal-format, fuzzy, badformat 16039#| msgid "Package %s%s%s has changed.%sSave package?" 16040msgid "Package \"%s\" has changed.%sSave package?" 16041msgstr "El paquet %s%s%s ha canviat.%sEl voleu desar?" 16042 16043#: lazarusidestrconsts.lispckeditpackagenotsaved 16044#, object-pascal-format 16045msgid "package %s not saved" 16046msgstr "no s'ha desat el paquet %s" 16047 16048#: lazarusidestrconsts.lispckeditpage 16049#, object-pascal-format 16050msgid "%s, Page: %s" 16051msgstr "%s, Pàgina: %s" 16052 16053#: lazarusidestrconsts.lispckeditreadddependency 16054msgid "Re-Add dependency" 16055msgstr "Torna a afegir la dependència" 16056 16057#: lazarusidestrconsts.lispckeditreaddfile 16058msgid "Re-Add file" 16059msgstr "Torna a afegir el fitxer" 16060 16061#: lazarusidestrconsts.lispckeditreadonly 16062#, object-pascal-format 16063msgid "Read Only: %s" 16064msgstr "Només de lectura: %s" 16065 16066#: lazarusidestrconsts.lispckeditrecompileallrequired 16067#, fuzzy 16068#| msgid "Recompile all required" 16069msgid "Recompile All Required" 16070msgstr "S'ha de tornar a compilar tot" 16071 16072#: lazarusidestrconsts.lispckeditrecompileclean 16073#, fuzzy 16074#| msgid "Recompile clean" 16075msgid "Recompile Clean" 16076msgstr "Torna a compilar en net" 16077 16078#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages 16079msgid "Re-Compile this and all required packages?" 16080msgstr "Voleu tornar a compilar aquest i tots el paquets requerits?" 16081 16082#: lazarusidestrconsts.lispckeditregisteredplugins 16083msgid "Registered plugins" 16084msgstr "Connectors registrats" 16085 16086#: lazarusidestrconsts.lispckeditregisterunit 16087msgid "Register unit" 16088msgstr "Registra la unitat" 16089 16090#: lazarusidestrconsts.lispckeditremovedependency 16091msgid "Remove dependency" 16092msgstr "Elimina la dependència" 16093 16094#: lazarusidestrconsts.lispckeditremovedependency2 16095msgid "Remove Dependency?" 16096msgstr "Voleu eliminar la dependència?" 16097 16098#: lazarusidestrconsts.lispckeditremovedependencyfrompackage 16099#, object-pascal-format, fuzzy, badformat 16100#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" 16101msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" 16102msgstr "Voleu eliminar la dependència %s%s%s%s del paquet %s%s%s?" 16103 16104#: lazarusidestrconsts.lispckeditremovedfiles 16105msgid "Removed Files" 16106msgstr "" 16107 16108#: lazarusidestrconsts.lispckeditremovedrequiredpackages 16109msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages" 16110msgid "Removed required packages" 16111msgstr "S'han eliminat els paquets requerits" 16112 16113#: lazarusidestrconsts.lispckeditremovefile 16114msgid "Remove file" 16115msgstr "Elimina el fitxer" 16116 16117#: lazarusidestrconsts.lispckeditremovefile2 16118msgid "Remove file?" 16119msgstr "Voleu eliminar el fitxer?" 16120 16121#: lazarusidestrconsts.lispckeditremovefilefrompackage 16122#, object-pascal-format, fuzzy, badformat 16123#| msgid "Remove file %s%s%s%sfrom package %s%s%s?" 16124msgid "Remove file \"%s\"%sfrom package \"%s\"?" 16125msgstr "Voleu eliminar el fitxer %s%s%s%s del paquet %s%s%s?" 16126 16127#: lazarusidestrconsts.lispckeditremoveselecteditem 16128msgid "Remove selected item" 16129msgstr "Elimina l'element seleccionat" 16130 16131#: lazarusidestrconsts.lispckeditrequiredpackages 16132msgid "Required Packages" 16133msgstr "Paquets requerits" 16134 16135#: lazarusidestrconsts.lispckeditsavepackage 16136#, fuzzy 16137#| msgid "Save package" 16138msgid "Save Package" 16139msgstr "Desa el paquet" 16140 16141#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency 16142msgid "Store file name as default for this dependency" 16143msgstr "" 16144 16145#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency 16146msgid "Store file name as preferred for this dependency" 16147msgstr "" 16148 16149#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion 16150#, object-pascal-format, fuzzy, badformat 16151#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" 16152msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 16153msgstr "La versió màxima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" 16154 16155#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion 16156#, object-pascal-format, fuzzy, badformat 16157#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" 16158msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 16159msgstr "La versió mínima %s%s%s no és una versió vàlida de paquet.%s(un bon exemple 1.2.3.4)" 16160 16161#: lazarusidestrconsts.lispckedituninstall 16162msgid "Uninstall" 16163msgstr "Desinstal·la" 16164 16165#: lazarusidestrconsts.lispckeditviewpackagesource 16166msgctxt "lazarusidestrconsts.lispckeditviewpackagesource" 16167msgid "View Package Source" 16168msgstr "Mostra les fonts dels paquets" 16169 16170#: lazarusidestrconsts.lispckexplbase 16171msgid "Base, cannot be uninstalled" 16172msgstr "" 16173 16174#: lazarusidestrconsts.lispckexplinstalled 16175msgctxt "lazarusidestrconsts.lispckexplinstalled" 16176msgid "Installed" 16177msgstr "Instal·lat" 16178 16179#: lazarusidestrconsts.lispckexplinstallonnextstart 16180msgid "Install on next start" 16181msgstr "Instal·la en el proper inici" 16182 16183#: lazarusidestrconsts.lispckexplstate 16184#, object-pascal-format 16185msgid "%sState: " 16186msgstr "%sEstat: " 16187 16188#: lazarusidestrconsts.lispckexpluninstallonnextstart 16189#, fuzzy 16190#| msgid "Uninstall on next start" 16191msgid "Uninstall on next start (unless needed by an installed package)" 16192msgstr "Desinstal·la en el proper inici" 16193 16194#: lazarusidestrconsts.lispckexpluninstallpackage 16195#, object-pascal-format 16196msgctxt "lazarusidestrconsts.lispckexpluninstallpackage" 16197msgid "Uninstall package %s" 16198msgstr "" 16199 16200#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects 16201msgid "Add options to dependent packages and projects" 16202msgstr "Afegeix les opcions en els paquets i projectes dependents" 16203 16204#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects 16205msgid "Add paths to dependent packages/projects" 16206msgstr "Afegeix les trajectòries en els paquets/projectes dependents" 16207 16208#: lazarusidestrconsts.lispckoptsauthor 16209#, fuzzy 16210#| msgid "Author:" 16211msgid "Author" 16212msgstr "Autor" 16213 16214#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded 16215msgid "Automatically rebuild as needed" 16216msgstr "Munta de nou automàticament quan es necessiti" 16217 16218#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall 16219msgid "Auto rebuild when rebuilding all" 16220msgstr "Munta de nou automàticament quan es munti tot" 16221 16222#: lazarusidestrconsts.lispckoptscustom 16223msgid "Custom" 16224msgstr "Personalitzat" 16225 16226#: lazarusidestrconsts.lispckoptsdescriptionabstract 16227#, fuzzy 16228#| msgid "Description/Abstract" 16229msgid "Description / Abstract" 16230msgstr "Descripció/Abstracte" 16231 16232#: lazarusidestrconsts.lispckoptsdesigntime 16233msgid "Designtime" 16234msgstr "" 16235 16236#: lazarusidestrconsts.lispckoptsdesigntimeandruntime 16237#, fuzzy 16238#| msgid "Designtime and Runtime" 16239msgid "Designtime and runtime" 16240msgstr "Temps de disseny i temp d'execució" 16241 16242#: lazarusidestrconsts.lispckoptsideintegration 16243msgid "IDE Integration" 16244msgstr "Integració IDE" 16245 16246#: lazarusidestrconsts.lispckoptsinclude 16247msgid "Include" 16248msgstr "Inclou" 16249 16250#: lazarusidestrconsts.lispckoptsinvalidpackagetype 16251msgid "Invalid package type" 16252msgstr "El tipus del paquet no és vàlid" 16253 16254#: lazarusidestrconsts.lispckoptslibrary 16255msgid "Library" 16256msgstr "Biblioteca" 16257 16258#: lazarusidestrconsts.lispckoptslicense 16259#, fuzzy 16260#| msgid "License:" 16261msgid "License" 16262msgstr "llicència:" 16263 16264#: lazarusidestrconsts.lispckoptslinker 16265msgid "Linker" 16266msgstr "Enllaçador" 16267 16268#: lazarusidestrconsts.lispckoptsmajor 16269msgid "Major" 16270msgstr "Major" 16271 16272#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically 16273msgid "Manual compilation (never automatically)" 16274msgstr "Compilació manual (mai automàticament)" 16275 16276#: lazarusidestrconsts.lispckoptsminor 16277msgid "Minor" 16278msgstr "Menor" 16279 16280#: lazarusidestrconsts.lispckoptsobject 16281msgid "Object" 16282msgstr "Objecte" 16283 16284#: lazarusidestrconsts.lispckoptspackagefileoptions 16285msgid "Additional Package File Options" 16286msgstr "" 16287 16288#: lazarusidestrconsts.lispckoptspackageoptions 16289msgid "Package Options" 16290msgstr "Opcions del paquet" 16291 16292#: lazarusidestrconsts.lispckoptspackagetype 16293#, fuzzy 16294#| msgid "PackageType" 16295msgid "Package type" 16296msgstr "Tipus de paquet" 16297 16298#: lazarusidestrconsts.lispckoptsprovides 16299msgid "Provides" 16300msgstr "" 16301 16302#: lazarusidestrconsts.lispckoptsrelease 16303msgid "Release" 16304msgstr "Llença" 16305 16306#: lazarusidestrconsts.lispckoptsruntime 16307msgid "Runtime" 16308msgstr "" 16309 16310#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans 16311#, object-pascal-format, fuzzy, badformat 16312#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." 16313msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." 16314msgstr "El paquet %s%s%s té el senyalador d'auto-intal·lar.%sAixò vol dir que s'instal·larà a l'IDE. Els paquets d'intal·lació%shan de ser paquets de temps de disseny." 16315 16316#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages 16317msgid "This package provides the same as the following packages:" 16318msgstr "" 16319 16320#: lazarusidestrconsts.lispckoptsupdaterebuild 16321#, fuzzy 16322#| msgid "Update/Rebuild" 16323msgid "Update / Rebuild" 16324msgstr "Actualitza/Munta de nou" 16325 16326#: lazarusidestrconsts.lispckoptsusage 16327msgid "Usage" 16328msgstr "Utilització" 16329 16330#: lazarusidestrconsts.lispckpackage 16331msgid "Package:" 16332msgstr "" 16333 16334#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa 16335msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon." 16336msgstr "" 16337 16338#: lazarusidestrconsts.lispckshowunneededdependencies 16339msgid "Show unneeded dependencies" 16340msgstr "" 16341 16342#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring 16343msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked." 16344msgstr "" 16345 16346#: lazarusidestrconsts.lispdabort 16347msgctxt "lazarusidestrconsts.lispdabort" 16348msgid "Abort" 16349msgstr "Avortar" 16350 16351#: lazarusidestrconsts.lispdprogress 16352msgid "Progress" 16353msgstr "Progrés" 16354 16355#: lazarusidestrconsts.lispecollapsedirectory 16356msgid "Collapse directory" 16357msgstr "" 16358 16359#: lazarusidestrconsts.lispeconflictfound 16360msgid "Conflict found" 16361msgstr "" 16362 16363#: lazarusidestrconsts.lispeeditvirtualunit 16364msgid "Edit Virtual Unit" 16365msgstr "" 16366 16367#: lazarusidestrconsts.lispeexpanddirectory 16368msgid "Expand directory" 16369msgstr "" 16370 16371#: lazarusidestrconsts.lispefilename 16372msgid "Filename:" 16373msgstr "Nom d'arxiu:" 16374 16375#: lazarusidestrconsts.lispefixfilescase 16376msgid "Fix Files Case" 16377msgstr "" 16378 16379#: lazarusidestrconsts.lispeinvalidunitfilename 16380msgid "Invalid unit filename" 16381msgstr "Nom d'arxiu per l'unitat no vàlid" 16382 16383#: lazarusidestrconsts.lispeinvalidunitname 16384msgid "Invalid unitname" 16385msgstr "Nom d'unitat no vàlida" 16386 16387#: lazarusidestrconsts.lispemissingfilesofpackage 16388#, object-pascal-format 16389msgid "Missing files of package %s" 16390msgstr "" 16391 16392#: lazarusidestrconsts.lispendingon 16393msgid "Pending (On)" 16394msgstr "" 16395 16396#: lazarusidestrconsts.lispenewfilenotinincludepath 16397msgid "New file not in include path" 16398msgstr "" 16399 16400#: lazarusidestrconsts.lispenofilesmissingallfilesexist 16401msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist" 16402msgid "No files missing. All files exist." 16403msgstr "" 16404 16405#: lazarusidestrconsts.lisperemovefiles 16406msgid "Remove files" 16407msgstr "" 16408 16409#: lazarusidestrconsts.lisperevertpackage 16410msgid "Revert Package" 16411msgstr "" 16412 16413#: lazarusidestrconsts.lispesavepackageas 16414msgid "Save Package As ..." 16415msgstr "" 16416 16417#: lazarusidestrconsts.lispeshowdirectoryhierarchy 16418msgid "Show directory hierarchy" 16419msgstr "" 16420 16421#: lazarusidestrconsts.lispeshowmissingfiles 16422msgid "Show Missing Files" 16423msgstr "" 16424 16425#: lazarusidestrconsts.lispesortfiles 16426msgid "Sort Files Permanently" 16427msgstr "" 16428 16429#: lazarusidestrconsts.lispesortfilesalphabetically 16430msgid "Sort files alphabetically" 16431msgstr "" 16432 16433#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea 16434#, object-pascal-format 16435msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" 16436msgstr "" 16437 16438#: lazarusidestrconsts.lispeunitname 16439msgid "Unitname:" 16440msgstr "Nom d'unitat:" 16441 16442#: lazarusidestrconsts.lispeuseallunitsindirectory 16443msgid "Use all units in directory" 16444msgstr "" 16445 16446#: lazarusidestrconsts.lispeusenounitsindirectory 16447msgid "Use no units in directory" 16448msgstr "" 16449 16450#: lazarusidestrconsts.lispkgcleanuppackagedependencies 16451msgid "Clean up package dependencies" 16452msgstr "" 16453 16454#: lazarusidestrconsts.lispkgclearselection 16455msgid "Clear Selection" 16456msgstr "" 16457 16458#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition 16459msgid "CompiledSrcPath addition" 16460msgstr "Afegeix CompiledSrcPath" 16461 16462#: lazarusidestrconsts.lispkgdefsnamespaces 16463msgid "Namespaces" 16464msgstr "" 16465 16466#: lazarusidestrconsts.lispkgdefsoutputdirectory 16467msgid "Output directory" 16468msgstr "Directori de la sortida" 16469 16470#: lazarusidestrconsts.lispkgdefssrcdirmark 16471msgid "Package Source Directory Mark" 16472msgstr "Marca del directori font del paquet" 16473 16474#: lazarusidestrconsts.lispkgdefsunitpath 16475msgid "Unit Path" 16476msgstr "Trajectòria de la unitat" 16477 16478#: lazarusidestrconsts.lispkgdeletedependencies 16479msgid "Delete dependencies" 16480msgstr "" 16481 16482#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand 16483#, object-pascal-format 16484msgid "Do you really want to forget all changes to package %s and reload it from file?" 16485msgstr "Voleu obviar tots els canvis del paquet %s i recarregar-lo del fitxer?" 16486 16487#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath 16488msgid "New unit not in unitpath" 16489msgstr "La nova unitat no és a la trajectòria de les unitats" 16490 16491#: lazarusidestrconsts.lispkgeditpublishpackage 16492msgid "Publish Package" 16493msgstr "Publica el paquet" 16494 16495#: lazarusidestrconsts.lispkgeditrevertpackage 16496msgid "Revert package?" 16497msgstr "Voleu revertir el paquet?" 16498 16499#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage 16500#, object-pascal-format, fuzzy, badformat 16501#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?" 16502msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?" 16503msgstr "El fitxer %s%s%s%sja no és a la trajectòria d'unitats del paquet.%s%sVoleu afegir %s%s%s a la trajectòria de les unitats? " 16504 16505#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage 16506msgid "More functions for the package" 16507msgstr "" 16508 16509#: lazarusidestrconsts.lispkgfiletypebinary 16510msgctxt "lazarusidestrconsts.lispkgfiletypebinary" 16511msgid "Binary" 16512msgstr "Binari" 16513 16514#: lazarusidestrconsts.lispkgfiletypeinclude 16515msgid "Include file" 16516msgstr "Inclou el fitxer" 16517 16518#: lazarusidestrconsts.lispkgfiletypeissues 16519msgid "Issues xml file" 16520msgstr "" 16521 16522#: lazarusidestrconsts.lispkgfiletypelfm 16523msgid "LFM - Lazarus form text" 16524msgstr "LFM - Lazarus Form Text" 16525 16526#: lazarusidestrconsts.lispkgfiletypelrs 16527msgid "LRS - Lazarus resource" 16528msgstr "LRS - Lazarus Resource" 16529 16530#: lazarusidestrconsts.lispkgfiletypemainunit 16531msgid "Main Unit" 16532msgstr "" 16533 16534#: lazarusidestrconsts.lispkgfiletypetext 16535msgctxt "lazarusidestrconsts.lispkgfiletypetext" 16536msgid "Text" 16537msgstr "Text" 16538 16539#: lazarusidestrconsts.lispkgfiletypevirtualunit 16540msgid "Virtual Unit" 16541msgstr "Unitat virtual" 16542 16543#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid 16544msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16545msgstr "" 16546 16547#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid 16548msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16549msgstr "" 16550 16551#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid 16552msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16553msgstr "" 16554 16555#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid 16556msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16557msgstr "" 16558 16559#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid 16560msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16561msgstr "" 16562 16563#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid 16564msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16565msgstr "" 16566 16567#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage 16568#, object-pascal-format, fuzzy, badformat 16569#| msgid "%sAdding new Dependency for package %s: package %s%s" 16570msgid "%sAdding new Dependency for package %s: package %s" 16571msgstr "%sS'està afegint nova dependència pel paquet %s: paquet %s%s" 16572 16573#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage 16574#, object-pascal-format, fuzzy, badformat 16575#| msgid "%sAdding new Dependency for project %s: package %s%s" 16576msgid "%sAdding new Dependency for project %s: package %s" 16577msgstr "%sS'està afegint nova dependència pel projecte %s: paquet %s%s" 16578 16579#: lazarusidestrconsts.lispkgmangaddunittousesclause 16580msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." 16581msgstr "" 16582 16583#: lazarusidestrconsts.lispkgmangambiguousunitsfound 16584msgid "Ambiguous units found" 16585msgstr "" 16586 16587#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages 16588msgid "Automatically installed packages" 16589msgstr "Paquets instal·lats automàticament" 16590 16591#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu 16592#, object-pascal-format 16593msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." 16594msgstr "%sAmbdós paquets estan connectats. Això vol dir, o que un paquet utilitza l'altre o que un tercer els utilitza tots dos." 16595 16596#: lazarusidestrconsts.lispkgmangbrokendependency 16597msgid "Broken dependency" 16598msgstr "Dependència Interrompuda" 16599 16600#: lazarusidestrconsts.lispkgmangcirculardependencies 16601msgid "Circular dependencies found" 16602msgstr "" 16603 16604#: lazarusidestrconsts.lispkgmangcompilepackage 16605#, object-pascal-format 16606msgid "Compile package %s" 16607msgstr "" 16608 16609#: lazarusidestrconsts.lispkgmangdeletefailed 16610msgid "Delete failed" 16611msgstr "Ha fallat l'eliminació" 16612 16613#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile 16614msgid "Delete Old Package File?" 16615msgstr "Voleu eliminar el fitxer de paquet antic?" 16616 16617#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 16618#, object-pascal-format, fuzzy, badformat 16619#| msgid "Delete old package file %s%s%s?" 16620msgid "Delete old package file \"%s\"?" 16621msgstr "Voleu eliminar el fitxer de paquet antic %s%s%s?" 16622 16623#: lazarusidestrconsts.lispkgmangdependencywithoutowner 16624#, object-pascal-format 16625msgid "Dependency without Owner: %s" 16626msgstr "Dependència sense propietari: %s" 16627 16628#: lazarusidestrconsts.lispkgmangerrorreadingfile 16629msgid "Error reading file" 16630msgstr "S'ha produït un error mentre es llegia el fitxer" 16631 16632#: lazarusidestrconsts.lispkgmangerrorreadingpackage 16633msgid "Error Reading Package" 16634msgstr "S'ha produït un error mentre es llegia el paquet" 16635 16636#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage 16637#, object-pascal-format 16638msgid "Error: updating po files failed for package %s" 16639msgstr "" 16640 16641#: lazarusidestrconsts.lispkgmangerrorwritingfile 16642msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" 16643msgid "Error writing file" 16644msgstr "S'ha produït un error mentre s'escrivia el fitxer" 16645 16646#: lazarusidestrconsts.lispkgmangerrorwritingpackage 16647msgid "Error Writing Package" 16648msgstr "S'ha produït un error mentre s'escrivia el paquet" 16649 16650#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage 16651msgid "File is already in package" 16652msgstr "El fitxer ja és al paquet" 16653 16654#: lazarusidestrconsts.lispkgmangfileisinproject 16655msgid "File is in Project" 16656msgstr "El fitxer forma part del projecte" 16657 16658#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename 16659msgid "Filename differs from Packagename" 16660msgstr "El nom del fitxer és diferent del nom del paquet" 16661 16662#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage 16663msgid "Filename is used by other package" 16664msgstr "El nom del fitxer està essent utilitzat per un altre paquet" 16665 16666#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject 16667msgid "Filename is used by project" 16668msgstr "El nom del fitxer està essent utilitzat pel projecte" 16669 16670#: lazarusidestrconsts.lispkgmangfilenotfound 16671#, object-pascal-format, fuzzy, badformat 16672#| msgid "File %s%s%s not found." 16673msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" 16674msgid "File \"%s\" not found." 16675msgstr "No s'ha trobat el fitxer %s%s%s." 16676 16677#: lazarusidestrconsts.lispkgmangfilenotsaved 16678msgid "File not saved" 16679msgstr "No s'ha desat el fitxer" 16680 16681#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac 16682#, object-pascal-format 16683msgid "Installing the package %s will automatically install the package:" 16684msgstr "L'instal·lació del paquet %s instal·larà automàticament el paquet:" 16685 16686#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 16687#, object-pascal-format 16688msgid "Installing the package %s will automatically install the packages:" 16689msgstr "L'instal·lació del paquet %s instal·larà automàticament els paquets:" 16690 16691#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename 16692msgid "invalid Compiler filename" 16693msgstr "el nom del fitxer del compilador no és vàlid" 16694 16695#: lazarusidestrconsts.lispkgmanginvalidfileextension 16696msgid "Invalid file extension" 16697msgstr "L'extensió del fitxer no és vàlida" 16698 16699#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension 16700msgid "Invalid package file extension" 16701msgstr "L'extensió del paquet no és vàlida" 16702 16703#: lazarusidestrconsts.lispkgmanginvalidpackagefilename 16704msgid "Invalid package filename" 16705msgstr "El nom del fitxer del paquet no és vàlid" 16706 16707#: lazarusidestrconsts.lispkgmanginvalidpackagename 16708msgid "Invalid package name" 16709msgstr "El nom del paquet no és vàlid" 16710 16711#: lazarusidestrconsts.lispkgmanginvalidpackagename2 16712msgid "Invalid Package Name" 16713msgstr "El nom del paquet no és vàlid" 16714 16715#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage 16716#, object-pascal-format, fuzzy, badformat 16717#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" 16718msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" 16719msgstr "Carrega el paquet %s reemplaçarà el paquet %s%sdel fitxer %s.%sEl paquet antic està modificat.%s%sVoleu desar el paquet antic %s?" 16720 16721#: lazarusidestrconsts.lispkgmangpackage 16722#, object-pascal-format 16723msgid "Package: %s" 16724msgstr "Paquet: %s" 16725 16726#: lazarusidestrconsts.lispkgmangpackageconflicts 16727msgid "Package conflicts" 16728msgstr "Conflicte de paquets" 16729 16730#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage 16731#, fuzzy 16732#| msgid "Package is no designtime package" 16733msgid "Package is not a designtime package" 16734msgstr "El paquet no és un paquet de temps de disseny" 16735 16736#: lazarusidestrconsts.lispkgmangpackageisrequired 16737msgid "Package is required" 16738msgstr "Es requereix el paquet" 16739 16740#: lazarusidestrconsts.lispkgmangpackagemainsourcefile 16741msgid "package main source file" 16742msgstr "fitxer del codi font principal del paquet" 16743 16744#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists 16745msgid "Package name already exists" 16746msgstr "Ja existeix el nom del paquet" 16747 16748#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk 16749msgid "Packages must have the extension .lpk" 16750msgstr "Els paquets han de tenir l'extensió .lpk" 16751 16752#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst 16753msgid "Please compile the package first." 16754msgstr "" 16755 16756#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage 16757msgid "Please save the file before adding it to a package." 16758msgstr "Si us plau, deseu el fitxer abans d'afegir-lo a un paquet." 16759 16760#: lazarusidestrconsts.lispkgmangproject 16761#, object-pascal-format 16762msgid "Project: %s" 16763msgstr "Projecte: %s" 16764 16765#: lazarusidestrconsts.lispkgmangrebuildlazarus 16766msgid "Rebuild Lazarus?" 16767msgstr "Voleu tornar a muntar el Lazarus?" 16768 16769#: lazarusidestrconsts.lispkgmangrenamefilelowercase 16770msgid "Rename File lowercase?" 16771msgstr "" 16772 16773#: lazarusidestrconsts.lispkgmangreplaceexistingfile 16774#, object-pascal-format, fuzzy, badformat 16775#| msgid "Replace existing file %s%s%s?" 16776msgid "Replace existing file \"%s\"?" 16777msgstr "Voleu substituir el fitxer existent %s%s%s?" 16778 16779#: lazarusidestrconsts.lispkgmangreplacefile 16780msgid "Replace File" 16781msgstr "Substitueix el fitxer" 16782 16783#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound 16784msgid "One or more required packages were not found. See package graph for details." 16785msgstr "" 16786 16787#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage 16788#, object-pascal-format 16789msgid "" 16790"The package %s is already open in the IDE.\n" 16791"You cannot save a package with the same name." 16792msgstr "" 16793 16794#: lazarusidestrconsts.lispkgmangsavepackage 16795#, fuzzy 16796#| msgid "Save Package?" 16797msgid "Save package?" 16798msgstr "Voleu desar el paquet?" 16799 16800#: lazarusidestrconsts.lispkgmangsavepackagelpk 16801#, object-pascal-format 16802msgid "Save Package %s (*.lpk)" 16803msgstr "Desa el paquet %s (*.lpk)" 16804 16805#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto 16806#, object-pascal-format, fuzzy, badformat 16807#| msgid "Should the file be renamed lowercase to%s%s%s%s?" 16808msgid "Should the file be renamed lowercase to%s\"%s\"?" 16809msgstr "Voleu canviar a minúscules el nom del fitxer a%s%s%s%s?" 16810 16811#: lazarusidestrconsts.lispkgmangskipthispackage 16812msgid "Skip this package" 16813msgstr "" 16814 16815#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile 16816msgid "static packages config file" 16817msgstr "fitxer de configuració de paquets estàtics" 16818 16819#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable 16820#, object-pascal-format 16821msgid "The compiler file for package %s is not a valid executable:%s%s" 16822msgstr "El fitxer de compilador pel paquet %s no és un executable vàlid:%s%s" 16823 16824#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage 16825#, object-pascal-format, fuzzy, badformat 16826#| msgid "The file %s%s%s%sis already in the package %s." 16827msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" 16828msgid "The file \"%s\"%sis already in the package %s." 16829msgstr "El fitxer %s%s%s%sja és al paquet %s." 16830 16831#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage 16832#, object-pascal-format, fuzzy, badformat 16833#| msgid "The file %s%s%s is not a Lazarus package." 16834msgid "The file \"%s\" is not a Lazarus package." 16835msgstr "El fitxer %s%s%s no és un paquet Lazarus." 16836 16837#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage 16838#, object-pascal-format, fuzzy, badformat 16839#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" 16840msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" 16841msgstr "El nom de fitxer %s%s%s no correspon al nom del paquet %s%s%s en el fitxer. %sVoleu canviar nom del paquet a %s%s%s?" 16842 16843#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject 16844#, object-pascal-format, fuzzy, badformat 16845#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." 16846msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." 16847msgstr "El nom del fitxer %s%s%s forma part del projecte actual.%sProjectes i paquets no han de compartir fitxers." 16848 16849#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile 16850#, object-pascal-format, fuzzy, badformat 16851#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." 16852msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." 16853msgstr "El nom de fitxer %s%s%s està essent utilitzat pel%s paquet %s%s%s%s en el fitxer %s%s%s." 16854 16855#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound 16856#, object-pascal-format 16857msgid "The file \"%s\" of package %s was not found." 16858msgstr "" 16859 16860#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload 16861msgid "The following package failed to load:" 16862msgstr "Ha fallat la carrega del següent paquet:" 16863 16864#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload 16865msgid "The following packages failed to load:" 16866msgstr "Ha fallat la carrega dels següents paquets:" 16867 16868#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof 16869#, object-pascal-format, fuzzy, badformat 16870#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" 16871msgid "%sThe following units will be added to the uses section of%s%s:%s%s" 16872msgstr "%sLes següents unitats s'afegiran a la secció USES de%s%s:%s%s%s" 16873 16874#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati 16875#, object-pascal-format 16876msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?" 16877msgstr "" 16878 16879#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename 16880#, object-pascal-format, fuzzy, badformat 16881#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name." 16882msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." 16883msgstr "El nom de fitxer de paquet %s%s%s en %s%s%s no és un nom de paquet Lazarus vàlid." 16884 16885#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages 16886#, object-pascal-format, fuzzy 16887#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." 16888msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." 16889msgstr "El paquet %s és només un paquet de temps d'execució.%sAquests tipus de paquets no poden ser instal·lats a l'IDE." 16890 16891#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec 16892#, object-pascal-format 16893msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies." 16894msgstr "" 16895 16896#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound 16897#, object-pascal-format, fuzzy, badformat 16898#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?" 16899msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?" 16900msgstr "No s'ha pogut trobar el paquet marcat per instal·lar %s%s%s.%sVoleu eliminar la dependència de la llista de paquets de la instal·lació?" 16901 16902#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation 16903#, object-pascal-format, fuzzy 16904#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." 16905msgid "The package %s is required by %s which is marked for installation.%sSee package graph." 16906msgstr "El paquet %s el requereix %s, el qual està marcat per instal·lar.%sMireu la gràfica del paquet." 16907 16908#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean 16909#, object-pascal-format, fuzzy, badformat 16910#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" 16911msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" 16912msgstr "El nom de paquet %s%s%s no és un nom de paquet vàlid%sSi us plau, escolliu-ne un altre (p.ex. paquet1.lpk)" 16913 16914#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid 16915#, object-pascal-format, fuzzy, badformat 16916#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." 16917msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." 16918msgstr "El nom del paquet %s%s%s del%sfitxer %s%s%s no és vàlid." 16919 16920#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus 16921#, object-pascal-format, fuzzy, badformat 16922#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" 16923msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 16924msgstr "S'ha marcat el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La des-instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" 16925 16926#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus 16927#, object-pascal-format, fuzzy, badformat 16928#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" 16929msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 16930msgstr "S'ha marcat per instal·lar el paquet %s%s%s.%sActualment el Lazarus només en permet en paquets enllaçats estàticament. La instal·lació real necessita el remuntatge i reinici del Lazarus.%s%sVoleu remuntar el Lazarus ara?" 16931 16932#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound 16933#, object-pascal-format, fuzzy, badformat 16934#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." 16935msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." 16936msgstr "El projecte requereix el paquet %s%s%s.%sPerò no s'ha trobat. Mireu Projecte -> Inspector del Projecte." 16937 16938#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from 16939#, object-pascal-format, fuzzy, badformat 16940#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" 16941msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" 16942msgstr "Hi ha dues unitats amb el mateix nom:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s" 16943 16944#: lazarusidestrconsts.lispkgmangthereisacirculardependency 16945msgid "There is a circular dependency in the packages. See package graph." 16946msgstr "" 16947 16948#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage 16949#, object-pascal-format, fuzzy, badformat 16950#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" 16951msgid "There is a FPC unit with the same name as a package:%s\"%s\"" 16952msgstr "Hi ha una unitat FPC amb el mateix nom que un paquet:%s%s%s%s%s%s" 16953 16954#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom 16955#, object-pascal-format, fuzzy, badformat 16956#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" 16957msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" 16958msgstr "Hi ha una unitat FPC amb el mateix nom que:%s%s%s%s%s de %s%s%s" 16959 16960#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename 16961#, object-pascal-format, fuzzy, badformat 16962#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" 16963msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" 16964msgstr "Ja hi ha un altre paquet amb el nom %s%s%s.%sPaquet amb conficte: %s%s%s%sFitxer: %s%s%s" 16965 16966#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile 16967#, object-pascal-format, fuzzy, badformat 16968#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible." 16969msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." 16970msgstr "Ja hi ha un paquet %s%s%s carregat%s des del fitxer %s%s%s.%sMireu Components -> Gràfica dels paquets.%sNo es pot reemplaçar." 16971 16972#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages 16973msgid "There is an unsaved package in the required packages. See package graph." 16974msgstr "Hi ha un paquet no desat en els paquets requerits. Mireu la gràfica dels paquets." 16975 16976#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 16977#, object-pascal-format, fuzzy, badformat 16978#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" 16979msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" 16980msgstr "Hi ha una unitat amb el mateix nom que un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s" 16981 16982#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe 16983msgid "This is a virtual package. It has no source yet. Please save the package first." 16984msgstr "" 16985 16986#: lazarusidestrconsts.lispkgmangunabletocreatedirectory 16987msgid "Unable to create directory" 16988msgstr "No es pot crear el directori" 16989 16990#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage 16991#, object-pascal-format, fuzzy, badformat 16992#| msgid "Unable to create output directory %s%s%s%sfor package %s." 16993msgid "Unable to create output directory \"%s\"%sfor package %s." 16994msgstr "No es pot crear el directori de sortida %s%s%s%spel paquet %s." 16995 16996#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage 16997#, object-pascal-format, fuzzy, badformat 16998#| msgid "Unable to create package source directory %s%s%s%sfor package %s." 16999msgid "Unable to create package source directory \"%s\"%sfor package %s." 17000msgstr "No es pot crear el directori sortida font %s%s%s%s pel paquet %s." 17001 17002#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus 17003#, object-pascal-format, fuzzy, badformat 17004#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages." 17005msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." 17006msgstr "No es pot crear el directori destinació del Lazarus:%s%s%s%s.%sAquest directori el necessita el nou IDE Lazarus amb els vostres paquets personalitzats." 17007 17008#: lazarusidestrconsts.lispkgmangunabletodeletefile 17009#, object-pascal-format, fuzzy, badformat 17010#| msgid "Unable to delete file %s%s%s." 17011msgid "Unable to delete file \"%s\"." 17012msgstr "No es pot eliminar el fitxer %s%s%s." 17013 17014#: lazarusidestrconsts.lispkgmangunabletodeletefilename 17015msgid "Unable to delete file" 17016msgstr "No es pot eliminar el fitxer" 17017 17018#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage 17019#, object-pascal-format, fuzzy, badformat 17020#| msgid "Unable to delete old state file %s%s%s%sfor package %s." 17021msgid "Unable to delete old state file \"%s\"%sfor package %s." 17022msgstr "No es pot eliminar el fitxer antic %s%s%s%spel paquet %s." 17023 17024#: lazarusidestrconsts.lispkgmangunabletoloadpackage 17025msgid "Unable to load package" 17026msgstr "" 17027 17028#: lazarusidestrconsts.lispkgmangunabletoopenthepackage 17029#, object-pascal-format 17030msgid "Unable to open the package \"%s\".%sThis package was marked for installation." 17031msgstr "" 17032 17033#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror 17034#, object-pascal-format, fuzzy, badformat 17035#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" 17036msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s" 17037msgstr "No es pot llegir fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" 17038 17039#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror 17040#, object-pascal-format, fuzzy, badformat 17041#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" 17042msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" 17043msgstr "No es pot escriure el paquet %s%s%s%sal fitxer %s%s%s.%sError: %s" 17044 17045#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror 17046#, object-pascal-format, fuzzy, badformat 17047#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" 17048msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s" 17049msgstr "No es pot escriure el fitxer d'estat %s%s%s%sdel paquet %s.%sError: %s" 17050 17051#: lazarusidestrconsts.lispkgmanguninstallpackage 17052msgid "Uninstall package?" 17053msgstr "Voleu desinstal·lar el paquet?" 17054 17055#: lazarusidestrconsts.lispkgmanguninstallpackage2 17056#, object-pascal-format 17057msgid "Uninstall package %s?" 17058msgstr "Voleu desinstal·lar el paquet %s?" 17059 17060#: lazarusidestrconsts.lispkgmangunsavedpackage 17061msgid "Unsaved package" 17062msgstr "No s'ha desat el paquet" 17063 17064#: lazarusidestrconsts.lispkgmanguseunit 17065msgid "Use unit" 17066msgstr "Utilitza Unitat" 17067 17068#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject 17069#, object-pascal-format, fuzzy, badformat 17070#| msgid "Warning: The file %s%s%s%sbelongs to the current project." 17071msgid "Warning: The file \"%s\"%sbelongs to the current project." 17072msgstr "Avís: El fitxer %s%s%s%spertany al projecte actual." 17073 17074#: lazarusidestrconsts.lispkgmgrkeep 17075msgctxt "lazarusidestrconsts.lispkgmgrkeep" 17076msgid "keep" 17077msgstr "" 17078 17079#: lazarusidestrconsts.lispkgmgrnew 17080msgctxt "lazarusidestrconsts.lispkgmgrnew" 17081msgid "new" 17082msgstr "" 17083 17084#: lazarusidestrconsts.lispkgmgrremove 17085msgctxt "lazarusidestrconsts.lispkgmgrremove" 17086msgid "remove" 17087msgstr "" 17088 17089#: lazarusidestrconsts.lispkgselectapackage 17090msgid "Select a package" 17091msgstr "" 17092 17093#: lazarusidestrconsts.lispkgsinstalled 17094msgctxt "lazarusidestrconsts.lispkgsinstalled" 17095msgid "Installed" 17096msgstr "Instal·lat" 17097 17098#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit 17099#, fuzzy 17100#| msgid "Can not register components without unit" 17101msgid "Cannot register components without unit" 17102msgstr "No es poden registrar els components sense unitat" 17103 17104#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined 17105#, object-pascal-format, fuzzy, badformat 17106#| msgid "Component Class %s%s%s already defined" 17107msgid "Component Class \"%s\" already defined" 17108msgstr "La classe del component %s%s%s ja està definida" 17109 17110#: lazarusidestrconsts.lispkgsysfilename 17111#, object-pascal-format, fuzzy, badformat 17112#| msgid "%s%sFile Name: %s%s%s" 17113msgid "%s%sFile Name: \"%s\"" 17114msgstr "%s%sNom del fitxer: %s%s%s" 17115 17116#: lazarusidestrconsts.lispkgsysinvalidcomponentclass 17117msgid "Invalid component class" 17118msgstr "La classe del component no és vàlida" 17119 17120#: lazarusidestrconsts.lispkgsysinvalidunitname 17121#, object-pascal-format 17122msgid "Invalid Unitname: %s" 17123msgstr "El nom de la unitat no és vàlid: %s" 17124 17125#: lazarusidestrconsts.lispkgsyslpkfilename 17126#, object-pascal-format 17127msgid "%s%slpk file: \"%s\"" 17128msgstr "" 17129 17130#: lazarusidestrconsts.lispkgsyspackagefilenotfound 17131msgid "Package file not found" 17132msgstr "No s'ha trobat el fitxer del paquet" 17133 17134#: lazarusidestrconsts.lispkgsyspackageregistrationerror 17135msgid "Package registration error" 17136msgstr "" 17137 17138#: lazarusidestrconsts.lispkgsysregisterprocedureisnil 17139msgid "Register procedure is nil" 17140msgstr "El procediment del registre és NIL" 17141 17142#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering 17143#, fuzzy 17144#| msgid "RegisterUnit was called, but no package is registering." 17145msgid "RegisterUnit was called but no package is registering." 17146msgstr "S'ha cridat RegisterUnit, però no hi ha cap paquet registrant." 17147 17148#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound 17149#, object-pascal-format 17150msgid "%s%sThe lpk file was not found." 17151msgstr "" 17152 17153#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound 17154#, object-pascal-format 17155msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created." 17156msgstr "" 17157 17158#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents 17159msgid "This is the default package. Used only for components without a package. These components are outdated." 17160msgstr "Aquest és el paquet predeterminat. S'utilitza només per components sense paquet. Aquests components estan desfasats." 17161 17162#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound 17163msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this." 17164msgstr "" 17165 17166#: lazarusidestrconsts.lispkgsysunitname 17167#, object-pascal-format, fuzzy, badformat 17168#| msgid "%s%sUnit Name: %s%s%s" 17169msgid "%s%sUnit Name: \"%s\"" 17170msgstr "%s%sNom de la unitat: %s%s%s" 17171 17172#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn 17173#, object-pascal-format 17174msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit." 17175msgstr "" 17176 17177#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk 17178#, object-pascal-format 17179msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk" 17180msgid "Unit \"%s\" was removed from package (lpk)" 17181msgstr "" 17182 17183#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau 17184msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies." 17185msgstr "" 17186 17187#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin 17188#, object-pascal-format 17189msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s" 17190msgstr "" 17191 17192#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage 17193msgid "This file is not in any loaded package." 17194msgstr "Aquest fitxer no és cap paquet carregat." 17195 17196#: lazarusidestrconsts.lispkgtransitivity 17197msgid "Transitivity" 17198msgstr "" 17199 17200#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror 17201#, object-pascal-format 17202msgid "Unable to read package file \"%s\".%sError: %s" 17203msgstr "" 17204 17205#: lazarusidestrconsts.lisplay 17206msgid "Play" 17207msgstr "" 17208 17209#: lazarusidestrconsts.lispldglobal 17210msgctxt "lazarusidestrconsts.lispldglobal" 17211msgid "Global" 17212msgstr "" 17213 17214#: lazarusidestrconsts.lispldonline 17215msgid "Online" 17216msgstr "" 17217 17218#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted 17219msgid "Online packages cannot be deleted" 17220msgstr "" 17221 17222#: lazarusidestrconsts.lispldpackagelinks 17223msgid "Package Links" 17224msgstr "" 17225 17226#: lazarusidestrconsts.lispldshowgloballinksin 17227msgid "Show global links in " 17228msgstr "" 17229 17230#: lazarusidestrconsts.lispldshowonlinelinks 17231msgid "Show online links" 17232msgstr "" 17233 17234#: lazarusidestrconsts.lispldshowuserlinksin 17235msgid "Show user links in " 17236msgstr "" 17237 17238#: lazarusidestrconsts.lispldsomepackagescannotbedeleted 17239msgid "Some packages cannot be deleted" 17240msgstr "" 17241 17242#: lazarusidestrconsts.lisplduser 17243msgid "User" 17244msgstr "" 17245 17246#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow 17247msgid "Please fix the error shown in the message window which is normally below the source editor." 17248msgstr "" 17249 17250#: lazarusidestrconsts.lispleaseopenaunitbeforerun 17251msgid "Please open a unit before run." 17252msgstr "Si us plau, obriu una unitat abans d'executar." 17253 17254#: lazarusidestrconsts.lispleaseselectatleastonebuildmode 17255msgid "Please select at least one build mode." 17256msgstr "" 17257 17258#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod 17259msgid "Please select some code to extract a new procedure/method." 17260msgstr "Si us plau, seleccioneu el codi per extraure'n un nou procediment/mètode." 17261 17262#: lazarusidestrconsts.lisplistall 17263msgctxt "lazarusidestrconsts.lisplistall" 17264msgid "<All>" 17265msgstr "<Tot>" 17266 17267#: lazarusidestrconsts.lisplistchangefont 17268msgid "Change Font" 17269msgstr "Canvia Font" 17270 17271#: lazarusidestrconsts.lisplistcopymethodtoclipboard 17272msgid "Copy method name to the clipboard" 17273msgstr "" 17274 17275#: lazarusidestrconsts.lisplistfilterany 17276msgid "Filter by matching any part of method" 17277msgstr "Flitra fent coincidir qualsevol part del mètode" 17278 17279#: lazarusidestrconsts.lisplistfilterstart 17280msgid "Filter by matching with start of method" 17281msgstr "Filtra fent coincidir el principi del mètode" 17282 17283#: lazarusidestrconsts.lisplistjumptoselection 17284msgid "Jump To Selection" 17285msgstr "Ves a la sel·lecció" 17286 17287#: lazarusidestrconsts.lisplistnone 17288msgid "<None>" 17289msgstr "<Res>" 17290 17291#: lazarusidestrconsts.lisplistobjects 17292msgid "&Objects" 17293msgstr "&Objectes" 17294 17295#: lazarusidestrconsts.lisplistprocedurelist 17296msgid "Procedure List" 17297msgstr "" 17298 17299#: lazarusidestrconsts.lisplisttype 17300msgctxt "lazarusidestrconsts.lisplisttype" 17301msgid "Type" 17302msgstr "Tipus" 17303 17304#: lazarusidestrconsts.lispochoosepofiledirectory 17305msgid "Choose .po file directory" 17306msgstr "" 17307 17308#: lazarusidestrconsts.lispodonotsaveanysessioninfo 17309msgid "Do not save any session info" 17310msgstr "No desis cap informació de la sessió" 17311 17312#: lazarusidestrconsts.lispointer 17313msgid "Pointer" 17314msgstr "" 17315 17316#: lazarusidestrconsts.lisposaveinideconfigdirectory 17317msgid "Save in .lps file in IDE config directory" 17318msgstr "" 17319 17320#: lazarusidestrconsts.lisposaveinlpifil 17321msgid "Save in .lpi file" 17322msgstr "Desa en arxiu .lpi" 17323 17324#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory 17325msgid "Save in .lps file in project directory" 17326msgstr "" 17327 17328#: lazarusidestrconsts.lisposavesessioninformationin 17329msgid "Save session information in" 17330msgstr "" 17331 17332#: lazarusidestrconsts.lisposavesessioninformationinhint 17333msgid ".lpi is the project main info file, .lps is a separate file for session data only." 17334msgstr "" 17335 17336#: lazarusidestrconsts.lisposition 17337msgid "Position" 17338msgstr "" 17339 17340#: lazarusidestrconsts.lispositionoutsideofsource 17341#, object-pascal-format 17342msgid "%s (position outside of source)" 17343msgstr "" 17344 17345#: lazarusidestrconsts.lisppuinwrongdirectory 17346#, object-pascal-format 17347msgid "ppu in wrong directory=%s." 17348msgstr "" 17349 17350#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg 17351#, object-pascal-format 17352msgid "%s.ppu not found. Check your fpc.cfg." 17353msgstr "" 17354 17355#: lazarusidestrconsts.lisprecedingword 17356msgid "Preceding word" 17357msgstr "" 17358 17359#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig 17360msgid "primary config directory where Lazarus stores its config files. Default is " 17361msgstr "" 17362 17363#: lazarusidestrconsts.lisprimaryconfigpath 17364msgid "Primary config path" 17365msgstr "" 17366 17367#: lazarusidestrconsts.lisprior 17368#, object-pascal-format 17369msgid "prior %s" 17370msgstr "" 17371 17372#: lazarusidestrconsts.lispriority 17373msgctxt "lazarusidestrconsts.lispriority" 17374msgid "Priority" 17375msgstr "" 17376 17377#: lazarusidestrconsts.lisprivate 17378msgid "Private" 17379msgstr "" 17380 17381#: lazarusidestrconsts.lisprivatemethod 17382msgid "Private Method" 17383msgstr "Mètode privat" 17384 17385#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti 17386#, object-pascal-format 17387msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first." 17388msgstr "" 17389 17390#: lazarusidestrconsts.lisprocedure 17391msgctxt "lazarusidestrconsts.lisprocedure" 17392msgid "Procedure" 17393msgstr "Procediment" 17394 17395#: lazarusidestrconsts.lisprocedurewithinterface 17396msgid "Procedure with interface" 17397msgstr "Procediment amb interfície" 17398 17399#: lazarusidestrconsts.lisprogram 17400msgctxt "lazarusidestrconsts.lisprogram" 17401msgid "Program" 17402msgstr "programa" 17403 17404#: lazarusidestrconsts.lisprogramdetected 17405msgid "Program detected" 17406msgstr "S'ha detectat el programa" 17407 17408#: lazarusidestrconsts.lisprogramprogramdescriptor 17409msgid "A Free Pascal command line program with some useful settings added." 17410msgstr "" 17411 17412#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp 17413#, fuzzy 17414#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr" 17415msgid "Program source must have a Pascal extension like .pas, .pp or .lpr" 17416msgstr "El codi font del programa ha de tenir una extensió pascal com .pas, .pp o .lpr" 17417 17418#: lazarusidestrconsts.lisprojadddependencyalreadyexists 17419msgid "Dependency already exists" 17420msgstr "Ja existeix la dependència" 17421 17422#: lazarusidestrconsts.lisprojaddeditorfile 17423#, fuzzy 17424#| msgid "Add editor files" 17425msgid "Add Editor Files" 17426msgstr "Afegeix els fitxers de l'editor" 17427 17428#: lazarusidestrconsts.lisprojaddinvalidminmaxversion 17429msgid "Invalid Min-Max version" 17430msgstr "La versió min/max no és vàlida" 17431 17432#: lazarusidestrconsts.lisprojaddinvalidversion 17433msgid "Invalid version" 17434msgstr "la versió no és vàlida" 17435 17436#: lazarusidestrconsts.lisprojaddlocalpkg 17437#, object-pascal-format 17438msgid "Local (%s)" 17439msgstr "" 17440 17441#: lazarusidestrconsts.lisprojaddmaximumversionoptional 17442msgid "Maximum Version (optional):" 17443msgstr "Número de versió màxim (opcional):" 17444 17445#: lazarusidestrconsts.lisprojaddminimumversionoptional 17446msgid "Minimum Version (optional):" 17447msgstr "Número mínim de la versió (opcional):" 17448 17449#: lazarusidestrconsts.lisprojaddnewfpmakerequirement 17450msgid "New FPMake Requirement" 17451msgstr "" 17452 17453#: lazarusidestrconsts.lisprojaddnewrequirement 17454msgid "New Requirement" 17455msgstr "Nou requeriment" 17456 17457#: lazarusidestrconsts.lisprojaddonlinepkg 17458#, object-pascal-format 17459msgid "Online (%s)" 17460msgstr "" 17461 17462#: lazarusidestrconsts.lisprojaddpackagename 17463msgid "Package Name:" 17464msgstr "Nom del paquet:" 17465 17466#: lazarusidestrconsts.lisprojaddpackagenotfound 17467msgid "Package not found" 17468msgstr "No s'ha trobat el paquet" 17469 17470#: lazarusidestrconsts.lisprojaddpackagetype 17471msgid "Package Type:" 17472msgstr "" 17473 17474#: lazarusidestrconsts.lisprojaddthedependencywasnotfound 17475#, object-pascal-format, fuzzy, badformat 17476#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." 17477msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." 17478msgstr "No s'ha trobat la dependència %s%s%s.%sSi us plau, escolliu un paquet que existeixi" 17479 17480#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid 17481#, object-pascal-format, fuzzy, badformat 17482#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" 17483msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" 17484msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 17485msgstr "La versió màxima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" 17486 17487#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion 17488msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" 17489msgid "The Maximum Version is lower than the Minimim Version." 17490msgstr "La versió màxima és menor que la versió mínima" 17491 17492#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid 17493#, object-pascal-format, fuzzy, badformat 17494#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" 17495msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" 17496msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 17497msgstr "La versió mínima %s%s%s no és vàlida.%sSi us plau, utilitzeu el format major.menor.llançament.muntatje%sPer exemple: 1.0.20.10" 17498 17499#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency 17500#, object-pascal-format, fuzzy, badformat 17501#| msgid "The project has already a dependency for the package %s%s%s." 17502msgid "The project has already a dependency for the package \"%s\"." 17503msgstr "El projecte ja té una dependència pel paquet %s%s%s." 17504 17505#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject 17506#, object-pascal-format, fuzzy, badformat 17507#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." 17508msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." 17509msgstr "El nom d'unitat %s%s%s ja existeix en el projecte%sen el fitxer: %s%s%s." 17510 17511#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection 17512#, object-pascal-format, fuzzy, badformat 17513#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." 17514msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." 17515msgstr "El nom d'unitat %s%s%s ja existeix en la selecció%s en el fitxer: %s%s%s." 17516 17517#: lazarusidestrconsts.lisprojaddunitnamealreadyexists 17518msgid "Unit name already exists" 17519msgstr "Ja existeix el nom de la unitat" 17520 17521#: lazarusidestrconsts.lisproject 17522#, object-pascal-format 17523msgid "Project %s" 17524msgstr "" 17525 17526#: lazarusidestrconsts.lisproject2 17527msgid "Project: " 17528msgstr "" 17529 17530#: lazarusidestrconsts.lisproject3 17531msgid "project" 17532msgstr "" 17533 17534#: lazarusidestrconsts.lisprojectchanged 17535msgid "Project changed" 17536msgstr "El projecte ha canviat" 17537 17538#: lazarusidestrconsts.lisprojectchangedondisk 17539msgid "Project changed on disk" 17540msgstr "" 17541 17542#: lazarusidestrconsts.lisprojectcount 17543#, object-pascal-format 17544msgid "%d projects" 17545msgstr "" 17546 17547#: lazarusidestrconsts.lisprojectdirectory 17548msgctxt "lazarusidestrconsts.lisprojectdirectory" 17549msgid "Project directory" 17550msgstr "Directori del projecte" 17551 17552#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar 17553msgid "Title in taskbar shows also directory path of the project" 17554msgstr "" 17555 17556#: lazarusidestrconsts.lisprojectfilename 17557msgid "Project filename" 17558msgstr "Nom del fitxer del projecte" 17559 17560#: lazarusidestrconsts.lisprojectincpath 17561msgid "Project Include Path" 17562msgstr "Trajectòria dels inclosos del projecte" 17563 17564#: lazarusidestrconsts.lisprojectinfofiledetected 17565msgid "Project info file detected" 17566msgstr "S'ha detectat fitxer d'informacó del projecte" 17567 17568#: lazarusidestrconsts.lisprojectisrunnable 17569msgid "Project is runnable" 17570msgstr "El projecte és executable" 17571 17572#: lazarusidestrconsts.lisprojectisrunnablehint 17573msgid "Generates a binary executable which can be run." 17574msgstr "" 17575 17576#: lazarusidestrconsts.lisprojectmacro 17577msgctxt "lazarusidestrconsts.lisprojectmacro" 17578msgid "Project" 17579msgstr "" 17580 17581#: lazarusidestrconsts.lisprojectmacroproperties 17582msgid "Project macro properties" 17583msgstr "" 17584 17585#: lazarusidestrconsts.lisprojectnamespaces 17586msgid "Project Namespaces" 17587msgstr "" 17588 17589#: lazarusidestrconsts.lisprojectoption 17590msgid "Project Option" 17591msgstr "" 17592 17593#: lazarusidestrconsts.lisprojectoutdir 17594msgid "Project Output directory (e.g. the ppu directory)" 17595msgstr "" 17596 17597#: lazarusidestrconsts.lisprojectoutputdirectory 17598msgid "Project output directory" 17599msgstr "" 17600 17601#: lazarusidestrconsts.lisprojectpathhint 17602msgid "Directory where project's main file must be" 17603msgstr "" 17604 17605#: lazarusidestrconsts.lisprojectsession 17606msgid "Project Session" 17607msgstr "" 17608 17609#: lazarusidestrconsts.lisprojectsessionchanged 17610msgid "Project session changed" 17611msgstr "" 17612 17613#: lazarusidestrconsts.lisprojectsourcedirectories 17614msgid "Project source directories" 17615msgstr "" 17616 17617#: lazarusidestrconsts.lisprojectsraisedexceptionataddress 17618#, object-pascal-format 17619msgid "%0:s%0:s At address %1:x" 17620msgstr "" 17621 17622#: lazarusidestrconsts.lisprojectsraisedexceptionclasss 17623#, object-pascal-format 17624msgid "Project %s raised exception class '%s'." 17625msgstr "" 17626 17627#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess 17628#, object-pascal-format 17629msgid "Project %s raised exception class '%s' with message:%s%s" 17630msgstr "" 17631 17632#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress 17633#, object-pascal-format 17634msgid "%0:s%0:s In file '%1:s' at address %2:x" 17635msgstr "" 17636 17637#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline 17638#, object-pascal-format 17639msgid "%0:s%0:s In file '%1:s' at line %2:d" 17640msgstr "" 17641 17642#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc 17643#, object-pascal-format 17644msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" 17645msgstr "" 17646 17647#: lazarusidestrconsts.lisprojectsrcpath 17648msgid "Project Src Path" 17649msgstr "Trajectòria del codi font del projecte" 17650 17651#: lazarusidestrconsts.lisprojectunit 17652msgid "project unit" 17653msgstr "" 17654 17655#: lazarusidestrconsts.lisprojectunitpath 17656msgid "Project Unit Path" 17657msgstr "Trajectòria de les unitats del projecte" 17658 17659#: lazarusidestrconsts.lisprojectwizard 17660msgid "Project Wizard" 17661msgstr "" 17662 17663#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency 17664msgid "Confirm deleting dependency" 17665msgstr "Confirma l'eliminació de les dependències" 17666 17667#: lazarusidestrconsts.lisprojinspconfirmremovingfile 17668msgid "Confirm removing file" 17669msgstr "" 17670 17671#: lazarusidestrconsts.lisprojinspdeletedependencyfor 17672#, object-pascal-format 17673msgid "Delete dependency for %s?" 17674msgstr "Voleu eliminar la dependència per %s?" 17675 17676#: lazarusidestrconsts.lisprojinspprojectinspector 17677#, object-pascal-format 17678msgid "Project Inspector - %s" 17679msgstr "Inspector del projecte - %s" 17680 17681#: lazarusidestrconsts.lisprojinspremovedrequiredpackages 17682msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages" 17683msgid "Removed required packages" 17684msgstr "S'han eliminat els paquets requerits" 17685 17686#: lazarusidestrconsts.lisprojinspremovefilefromproject 17687#, object-pascal-format 17688msgid "Remove file %s from project?" 17689msgstr "Voleu eliminar el fitxer %s del projecte?" 17690 17691#: lazarusidestrconsts.lisprojinspremoveitemsf 17692#, object-pascal-format 17693msgid "Remove %s items from project?" 17694msgstr "" 17695 17696#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror 17697#, object-pascal-format 17698msgid "Unable to read state file %s of project %s%sError: %s" 17699msgstr "" 17700 17701#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror 17702#, object-pascal-format 17703msgid "Unable to write state file for project %s%sError: %s" 17704msgstr "" 17705 17706#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged 17707msgid "Always build (even if nothing changed)" 17708msgstr "Construeix sempre (inclús si res ha canviat)" 17709 17710#: lazarusidestrconsts.lisprojoptsalwaysbuildhint 17711msgid "May be needed if there is a bug in dependency check, normally not needed." 17712msgstr "" 17713 17714#: lazarusidestrconsts.lisprojoptserror 17715msgctxt "lazarusidestrconsts.lisprojoptserror" 17716msgid "Error" 17717msgstr "S'ha produït un error" 17718 17719#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist 17720#, object-pascal-format 17721msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." 17722msgstr "No es pot canviar la llista de les formes creades automàticament en el codi font del programa. %s Si us plau, corregiu primer els errors." 17723 17724#: lazarusidestrconsts.lisprojprojectsourcedirectorymark 17725msgid "Project Source Directory Mark" 17726msgstr "" 17727 17728#: lazarusidestrconsts.lispromptforvalue 17729msgid "Prompt for value" 17730msgstr "Demana el valor" 17731 17732#: lazarusidestrconsts.lisproperties 17733msgid "Properties (replace or remove)" 17734msgstr "" 17735 17736#: lazarusidestrconsts.lisproperty 17737#, object-pascal-format 17738msgid "%s property" 17739msgstr "" 17740 17741#: lazarusidestrconsts.lisprotected 17742msgid "Protected" 17743msgstr "" 17744 17745#: lazarusidestrconsts.lisprotectedmethod 17746msgid "Protected Method" 17747msgstr "Mètode protegit" 17748 17749#: lazarusidestrconsts.lispublicmethod 17750msgid "Public Method" 17751msgstr "Mètode públic" 17752 17753#: lazarusidestrconsts.lispublishedmethod 17754msgid "Published Method" 17755msgstr "Mètode publicat" 17756 17757#: lazarusidestrconsts.lispublishedto 17758#, object-pascal-format 17759msgid "Published to %s" 17760msgstr "" 17761 17762#: lazarusidestrconsts.lispublishmodulenote 17763msgid "Files belonging to project / package will be included automatically." 17764msgstr "" 17765 17766#: lazarusidestrconsts.lispublishprojdir 17767msgid "Publish project directory" 17768msgstr "Publica el directori del projecte" 17769 17770#: lazarusidestrconsts.lispublishproject 17771msgid "Publish Project" 17772msgstr "" 17773 17774#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory 17775msgid "Save .lrs files in the output directory" 17776msgstr "" 17777 17778#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint 17779msgid "The resource will be available for FPC." 17780msgstr "" 17781 17782#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas 17783#, fuzzy 17784#| msgid "A pascal unit must have the extension .pp or .pas" 17785msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" 17786msgid "A Pascal unit must have the extension .pp or .pas" 17787msgstr "Una unitat Pascal ha de tenir l'extensió .pp o .pas" 17788 17789#: lazarusidestrconsts.lispvueditvirtualunit 17790msgid "Edit virtual unit" 17791msgstr "" 17792 17793#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile 17794#, object-pascal-format 17795msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" 17796msgid "There is already an unit with this name.%sFile: %s" 17797msgstr "Ja existeix una unitat amb aquest nom.%sArxiu: %s" 17798 17799#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier 17800msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier" 17801msgid "The unitname is not a valid Pascal identifier." 17802msgstr "" 17803 17804#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses 17805msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses" 17806msgid "The unitname is used when the IDE extends uses clauses" 17807msgstr "" 17808 17809#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni 17810#, object-pascal-format 17811msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni" 17812msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" 17813msgstr "" 17814 17815#: lazarusidestrconsts.lispwconvertproject 17816msgid "Convert &Delphi Project" 17817msgstr "" 17818 17819#: lazarusidestrconsts.lispwnewproject 17820msgid "&New Project" 17821msgstr "" 17822 17823#: lazarusidestrconsts.lispwopenproject 17824msgid "&Open Project" 17825msgstr "" 17826 17827#: lazarusidestrconsts.lispwopenrecentproject 17828#, fuzzy 17829#| msgid "Open Recent Project" 17830msgctxt "lazarusidestrconsts.lispwopenrecentproject" 17831msgid "Open &Recent Project" 17832msgstr "Obre recent" 17833 17834#: lazarusidestrconsts.lispwviewexampleprojects 17835msgid "View &Example Projects" 17836msgstr "" 17837 17838#: lazarusidestrconsts.lisquickfixerror 17839msgid "QuickFix error" 17840msgstr "" 17841 17842#: lazarusidestrconsts.lisquickfixes 17843msgid "Quick fixes" 17844msgstr "" 17845 17846#: lazarusidestrconsts.lisquickfixremoveunit 17847msgid "Quick fix: Remove unit" 17848msgstr "" 17849 17850#: lazarusidestrconsts.lisquickfixsearchidentifier 17851msgid "Search identifier" 17852msgstr "" 17853 17854#: lazarusidestrconsts.lisquit 17855msgctxt "lazarusidestrconsts.lisquit" 17856msgid "Quit" 17857msgstr "" 17858 17859#: lazarusidestrconsts.lisquitlazarus 17860msgid "&Quit Lazarus" 17861msgstr "" 17862 17863#: lazarusidestrconsts.lisrange 17864#, fuzzy 17865msgctxt "lazarusidestrconsts.lisrange" 17866msgid "Range" 17867msgstr "Abast" 17868 17869#: lazarusidestrconsts.lisreaderror 17870msgid "Read Error" 17871msgstr "S'ha produït un error de lectura" 17872 17873#: lazarusidestrconsts.lisreallydelete 17874msgid "Really delete?" 17875msgstr "" 17876 17877#: lazarusidestrconsts.lisrecenttabs 17878msgid "Recent tabs" 17879msgstr "" 17880 17881#: lazarusidestrconsts.lisrecord 17882msgctxt "lazarusidestrconsts.lisrecord" 17883msgid "Record" 17884msgstr "" 17885 17886#: lazarusidestrconsts.lisrecordedmacros 17887msgid "Recorded" 17888msgstr "" 17889 17890#: lazarusidestrconsts.lisrecordstruct 17891msgid "Record/Structure" 17892msgstr "" 17893 17894#: lazarusidestrconsts.lisredo 17895msgctxt "lazarusidestrconsts.lisredo" 17896msgid "Redo" 17897msgstr "Torna a fer" 17898 17899#: lazarusidestrconsts.lisregisters 17900msgctxt "lazarusidestrconsts.lisregisters" 17901msgid "Registers" 17902msgstr "" 17903 17904#: lazarusidestrconsts.lisregularexpression 17905msgid "Regular expression" 17906msgstr "" 17907 17908#: lazarusidestrconsts.lisrelative 17909msgid "Relative" 17910msgstr "" 17911 17912#: lazarusidestrconsts.lisrelativepaths 17913msgid "Relative paths" 17914msgstr "" 17915 17916#: lazarusidestrconsts.lisremove 17917msgctxt "lazarusidestrconsts.lisremove" 17918msgid "Remove" 17919msgstr "" 17920 17921#: lazarusidestrconsts.lisremove2 17922msgid "Remove?" 17923msgstr "" 17924 17925#: lazarusidestrconsts.lisremoveallinvalidproperties 17926msgid "Remove all invalid properties" 17927msgstr "Elimina totes les propietats no vàlides" 17928 17929#: lazarusidestrconsts.lisremoveallmessagetypefilters 17930msgid "Remove all message type filters" 17931msgstr "" 17932 17933#: lazarusidestrconsts.lisremoveallunits 17934msgid "Remove all units" 17935msgstr "" 17936 17937#: lazarusidestrconsts.lisremovecompileroptionhidemessage 17938msgid "Remove Compiler Option Hide Message" 17939msgstr "" 17940 17941#: lazarusidestrconsts.lisremovedependenciesfrompackage 17942#, object-pascal-format 17943msgid "Remove %s dependencies from package \"%s\"?" 17944msgstr "" 17945 17946#: lazarusidestrconsts.lisremovedpropertys 17947#, object-pascal-format 17948msgid "Removed property \"%s\"." 17949msgstr "" 17950 17951#: lazarusidestrconsts.lisremovefilesfrompackage 17952#, object-pascal-format 17953msgid "Remove %s files from package \"%s\"?" 17954msgstr "" 17955 17956#: lazarusidestrconsts.lisremovefrominstalllist 17957msgid "Remove from install list" 17958msgstr "" 17959 17960#: lazarusidestrconsts.lisremovefromproject 17961#, fuzzy 17962#| msgid "Remove from project" 17963msgid "Remove from Project" 17964msgstr "Elimina del projecte" 17965 17966#: lazarusidestrconsts.lisremovefromsearchpath 17967msgid "Remove from search path" 17968msgstr "" 17969 17970#: lazarusidestrconsts.lisremoveincludepath 17971msgid "Remove include path?" 17972msgstr "" 17973 17974#: lazarusidestrconsts.lisremovelocalvariable 17975#, object-pascal-format 17976msgid "Remove local variable %s" 17977msgstr "" 17978 17979#: lazarusidestrconsts.lisremovelocalvariable3 17980#, object-pascal-format 17981msgid "Remove local variable \"%s\"" 17982msgstr "" 17983 17984#: lazarusidestrconsts.lisremovemessagetypefilter 17985msgid "Remove Message Type Filter" 17986msgstr "" 17987 17988#: lazarusidestrconsts.lisremovenonexistingfiles 17989msgid "Remove nonexistent files" 17990msgstr "" 17991 17992#: lazarusidestrconsts.lisremoveselectedunits 17993msgid "Remove selected units" 17994msgstr "" 17995 17996#: lazarusidestrconsts.lisremovethem 17997msgid "Remove them" 17998msgstr "" 17999 18000#: lazarusidestrconsts.lisremovethepathsfromothersources 18001msgid "Remove the paths from \"Other sources\"" 18002msgstr "" 18003 18004#: lazarusidestrconsts.lisremoveunitpath 18005msgid "Remove unit path?" 18006msgstr "" 18007 18008#: lazarusidestrconsts.lisremoveuses 18009#, object-pascal-format 18010msgid "Remove uses \"%s\"" 18011msgstr "" 18012 18013#: lazarusidestrconsts.lisrename 18014msgctxt "lazarusidestrconsts.lisrename" 18015msgid "Rename" 18016msgstr "Canvia el nom" 18017 18018#: lazarusidestrconsts.lisrename2 18019msgid "Rename ..." 18020msgstr "" 18021 18022#: lazarusidestrconsts.lisrenamefile 18023msgid "Rename file?" 18024msgstr "Voleu canviar el nom del fitxer?" 18025 18026#: lazarusidestrconsts.lisrenamefilefailed 18027msgid "Rename file failed" 18028msgstr "Ha fallat el canvi de nom del fitxer" 18029 18030#: lazarusidestrconsts.lisrenameshowresult 18031msgid "Show list of renamed Identifiers" 18032msgstr "" 18033 18034#: lazarusidestrconsts.lisrenameto 18035#, object-pascal-format 18036msgid "Rename to %s" 18037msgstr "" 18038 18039#: lazarusidestrconsts.lisrenametolowercase 18040msgid "Rename to lowercase" 18041msgstr "" 18042 18043#: lazarusidestrconsts.lisreopenproject 18044msgid "Reopen project" 18045msgstr "" 18046 18047#: lazarusidestrconsts.lisreopenwithanotherencoding 18048msgid "Reopen with another encoding" 18049msgstr "" 18050 18051#: lazarusidestrconsts.lisrepeat 18052msgctxt "lazarusidestrconsts.lisrepeat" 18053msgid "Repeat" 18054msgstr "" 18055 18056#: lazarusidestrconsts.lisrepeatcount 18057msgid "Repeat Count:" 18058msgstr "" 18059 18060#: lazarusidestrconsts.lisreplace 18061msgctxt "lazarusidestrconsts.lisreplace" 18062msgid "Replace" 18063msgstr "Substitueix" 18064 18065#: lazarusidestrconsts.lisreplacedpropertyswiths 18066#, object-pascal-format 18067msgid "Replaced property \"%s\" with \"%s\"." 18068msgstr "" 18069 18070#: lazarusidestrconsts.lisreplacedtypeswiths 18071#, object-pascal-format 18072msgid "Replaced type \"%s\" with \"%s\"." 18073msgstr "" 18074 18075#: lazarusidestrconsts.lisreplacement 18076msgid "Replacement" 18077msgstr "" 18078 18079#: lazarusidestrconsts.lisreplacementfuncs 18080msgid "Replacement functions" 18081msgstr "" 18082 18083#: lazarusidestrconsts.lisreplacements 18084msgid "Replacements" 18085msgstr "" 18086 18087#: lazarusidestrconsts.lisreplaceremoveunknown 18088msgid "Fix unknown properties and types" 18089msgstr "" 18090 18091#: lazarusidestrconsts.lisreplacewholeidentifier 18092msgid "Replace whole identifier" 18093msgstr "" 18094 18095#: lazarusidestrconsts.lisreplacingselectionfailed 18096msgid "Replacing selection failed." 18097msgstr "" 18098 18099#: lazarusidestrconsts.lisreportingbugurl 18100msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" 18101msgstr "" 18102 18103#: lazarusidestrconsts.lisrescan 18104msgid "Rescan" 18105msgstr "" 18106 18107#: lazarusidestrconsts.lisreset 18108msgctxt "lazarusidestrconsts.lisreset" 18109msgid "Reset" 18110msgstr "" 18111 18112#: lazarusidestrconsts.lisresetallfilefilterstodefaults 18113msgid "Reset all file filters to defaults?" 18114msgstr "" 18115 18116#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir 18117msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?" 18118msgstr "" 18119 18120#: lazarusidestrconsts.lisresourcenamemustbeunique 18121msgid "Resource name must be unique." 18122msgstr "" 18123 18124#: lazarusidestrconsts.lisresourcesaveerror 18125msgid "Resource save error" 18126msgstr "S'ha produït un error mentre es desava el recurs" 18127 18128#: lazarusidestrconsts.lisresourcetypeofnewfiles 18129msgid "Resource type of project" 18130msgstr "" 18131 18132#: lazarusidestrconsts.lisrestart 18133msgctxt "lazarusidestrconsts.lisrestart" 18134msgid "Restart" 18135msgstr "Reinicia" 18136 18137#: lazarusidestrconsts.lisresult2 18138msgid "Result:" 18139msgstr "" 18140 18141#: lazarusidestrconsts.lisreturnparameterindexedword 18142msgid "" 18143"Return parameter-indexed word from the current line preceding cursor position.\n" 18144"\n" 18145"Words in a line are numbered 1,2,3,... from left to right, but the last word\n" 18146"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" 18147"is always the current macro.\n" 18148"\n" 18149"Example line:\n" 18150"i 0 count-1 forb|\n" 18151"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" 18152"\n" 18153"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+" 18154msgstr "" 18155 18156#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria 18157msgid "" 18158"Return the list of all values of case variable in front of variable.\n" 18159"\n" 18160"Optional Parameters (comma separated):\n" 18161"WithoutExtraIndent // the case list will be generated without extra indentation" 18162msgstr "" 18163 18164#: lazarusidestrconsts.lisrevertfailed 18165msgid "Revert failed" 18166msgstr "Ha fallat la reversió" 18167 18168#: lazarusidestrconsts.lisrevision 18169msgid "Revision: " 18170msgstr "" 18171 18172#: lazarusidestrconsts.lisright 18173msgctxt "lazarusidestrconsts.lisright" 18174msgid "Right" 18175msgstr "Dreta" 18176 18177#: lazarusidestrconsts.lisrightanchoring 18178msgid "Right anchoring" 18179msgstr "" 18180 18181#: lazarusidestrconsts.lisrightborderspacespinedithint 18182msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." 18183msgstr "" 18184 18185#: lazarusidestrconsts.lisrightsiblingcomboboxhint 18186msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 18187msgstr "" 18188 18189#: lazarusidestrconsts.lisrightsides 18190msgid "Right sides" 18191msgstr "Costats drets" 18192 18193#: lazarusidestrconsts.lisrightspaceequally 18194msgid "Right space equally" 18195msgstr "Iguala l'espai dret" 18196 18197#: lazarusidestrconsts.lisroot 18198msgid "Root" 18199msgstr "" 18200 18201#: lazarusidestrconsts.lisrootdirectory 18202msgid "Root Directory" 18203msgstr "" 18204 18205#: lazarusidestrconsts.lisrun 18206msgctxt "lazarusidestrconsts.lisrun" 18207msgid "Run" 18208msgstr "Executa" 18209 18210#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations 18211msgid "\"Run and Design time\" packages have no limitations." 18212msgstr "" 18213 18214#: lazarusidestrconsts.lisrunbuttonhint 18215msgctxt "lazarusidestrconsts.lisrunbuttonhint" 18216msgid "Run" 18217msgstr "Executa" 18218 18219#: lazarusidestrconsts.lisrunning 18220#, object-pascal-format 18221msgid "%s (running ...)" 18222msgstr "" 18223 18224#: lazarusidestrconsts.lisrunparamsfilenotexecutable 18225msgid "File not executable" 18226msgstr "El fitxer no és executable" 18227 18228#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable 18229#, object-pascal-format, fuzzy, badformat 18230#| msgid "The host application %s%s%s is not executable." 18231msgid "The host application \"%s\" is not executable." 18232msgstr "L'aplicació amfitriona %s%s%s no és executable" 18233 18234#: lazarusidestrconsts.lisrunstage 18235msgctxt "lazarusidestrconsts.lisrunstage" 18236msgid "Run" 18237msgstr "Executa" 18238 18239#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide 18240msgid "Runtime only, cannot be installed in IDE" 18241msgstr "" 18242 18243#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei 18244msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly." 18245msgstr "" 18246 18247#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst 18248msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them." 18249msgstr "" 18250 18251#: lazarusidestrconsts.lisruntofailed 18252msgid "Run-to failed" 18253msgstr "Ha fallat executar a" 18254 18255#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden 18256msgid "Abstract Methods - not yet overridden" 18257msgstr "" 18258 18259#: lazarusidestrconsts.lissamabstractmethodsof 18260#, object-pascal-format 18261msgid "Abstract methods of %s" 18262msgstr "" 18263 18264#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration 18265msgid "Cursor is not in a class declaration" 18266msgstr "" 18267 18268#: lazarusidestrconsts.lissamideisbusy 18269msgid "IDE is busy" 18270msgstr "" 18271 18272#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods 18273#, object-pascal-format 18274msgid "%s is an abstract class, it has %s abstract methods." 18275msgstr "" 18276 18277#: lazarusidestrconsts.lissamnoabstractmethodsfound 18278msgid "No abstract methods found" 18279msgstr "" 18280 18281#: lazarusidestrconsts.lissamoverrideallselected 18282msgid "Override all selected" 18283msgstr "" 18284 18285#: lazarusidestrconsts.lissamoverridefirstselected 18286msgid "Override first selected" 18287msgstr "" 18288 18289#: lazarusidestrconsts.lissamselectnone 18290msgid "Select none" 18291msgstr "" 18292 18293#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf 18294#, object-pascal-format 18295msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" 18296msgstr "" 18297 18298#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride 18299msgid "There are no abstract methods left to override." 18300msgstr "" 18301 18302#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth 18303msgid "This method can not be overridden because it is defined in the current class" 18304msgstr "" 18305 18306#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus 18307msgid "Unable to show abstract methods of the current class, because" 18308msgstr "" 18309 18310#: lazarusidestrconsts.lissave 18311msgctxt "lazarusidestrconsts.lissave" 18312msgid "Save" 18313msgstr "" 18314 18315#: lazarusidestrconsts.lissaveall 18316msgctxt "lazarusidestrconsts.lissaveall" 18317msgid "Save All" 18318msgstr "Desa-ho Tot" 18319 18320#: lazarusidestrconsts.lissaveallchecked 18321msgid "Save All Checked" 18322msgstr "" 18323 18324#: lazarusidestrconsts.lissaveallmodified 18325#, fuzzy 18326#| msgid "save all modified files" 18327msgid "Save all modified files" 18328msgstr "desa tots els fitxers modificats" 18329 18330#: lazarusidestrconsts.lissavealloriginalmessagestofile 18331msgid "Save All/Original Messages to File ..." 18332msgstr "" 18333 18334#: lazarusidestrconsts.lissaveandexitdialog 18335msgid "Save and exit dialog" 18336msgstr "Diàleg desa i surt" 18337 18338#: lazarusidestrconsts.lissaveandrebuildide 18339msgid "Save and rebuild IDE" 18340msgstr "Desa i remunta l'IDE" 18341 18342#: lazarusidestrconsts.lissaveas 18343msgctxt "lazarusidestrconsts.lissaveas" 18344msgid "Save As" 18345msgstr "Anomena i desa" 18346 18347#: lazarusidestrconsts.lissavechangedfiles 18348msgid "Save changed files?" 18349msgstr "" 18350 18351#: lazarusidestrconsts.lissavechanges 18352msgid "Save changes?" 18353msgstr "Voleu desar els canvis?" 18354 18355#: lazarusidestrconsts.lissavechangestoproject 18356#, object-pascal-format 18357msgid "Save changes to project %s?" 18358msgstr "Voleu desar els canvis del projecte %s?" 18359 18360#: lazarusidestrconsts.lissavecurrenteditorfile 18361#, fuzzy 18362#| msgid "save current editor file" 18363msgid "Save current editor file" 18364msgstr "desa el fitxer editor actual" 18365 18366#: lazarusidestrconsts.lissavedwithidesettings 18367msgid "Saved with IDE settings" 18368msgstr "" 18369 18370#: lazarusidestrconsts.lissavedwithprojectsession 18371msgid "Saved with project session" 18372msgstr "" 18373 18374#: lazarusidestrconsts.lissavefileas 18375msgid "Save file as" 18376msgstr "" 18377 18378#: lazarusidestrconsts.lissavefilebeforeclosingform 18379#, object-pascal-format, fuzzy, badformat 18380#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?" 18381msgid "Save file \"%s\"%sbefore closing form \"%s\"?" 18382msgstr "Voleu desar el fitxer %s%s%s%sabans de tancar la forma %s%s%s?" 18383 18384#: lazarusidestrconsts.lissavemacroas 18385msgid "Save macro as" 18386msgstr "" 18387 18388#: lazarusidestrconsts.lissavemessages 18389msgid "Save messages" 18390msgstr "" 18391 18392#: lazarusidestrconsts.lissaveproject 18393#, object-pascal-format 18394msgid "Save project %s (*%s)" 18395msgstr "" 18396 18397#: lazarusidestrconsts.lissavesessionchangestoproject 18398#, object-pascal-format 18399msgid "Save session changes to project %s?" 18400msgstr "" 18401 18402#: lazarusidestrconsts.lissavesessionfoldstate 18403msgctxt "lazarusidestrconsts.lissavesessionfoldstate" 18404msgid "Save fold info" 18405msgstr "" 18406 18407#: lazarusidestrconsts.lissavesessionfoldstatehint 18408msgid "Code editor supports folding (temporarily hiding) blocks of code." 18409msgstr "" 18410 18411#: lazarusidestrconsts.lissavesessionjumphistory 18412msgctxt "lazarusidestrconsts.lissavesessionjumphistory" 18413msgid "Save jump history" 18414msgstr "" 18415 18416#: lazarusidestrconsts.lissavesessionjumphistoryhint 18417msgid "Ctrl-Click on an identifier in code editor is stored in jump history." 18418msgstr "" 18419 18420#: lazarusidestrconsts.lissavesettings 18421msgid "Save Settings" 18422msgstr "" 18423 18424#: lazarusidestrconsts.lissaveshownmessagestofile 18425msgid "Save Shown Messages to File ..." 18426msgstr "" 18427 18428#: lazarusidestrconsts.lissavespace 18429msgid "Save " 18430msgstr "Desa " 18431 18432#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn 18433#, object-pascal-format 18434msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s." 18435msgstr "" 18436 18437#: lazarusidestrconsts.lisscalingfactor 18438msgid "Scaling factor:" 18439msgstr "Factor d'escalat:" 18440 18441#: lazarusidestrconsts.lisscanfilesinparentdir 18442msgid "Scan files in parent directory" 18443msgstr "" 18444 18445#: lazarusidestrconsts.lisscanfilesinparentdirhint 18446msgid "Search for source files in sibling directories (parent directory and its children)" 18447msgstr "" 18448 18449#: lazarusidestrconsts.lisscanning 18450msgid "Scanning" 18451msgstr "" 18452 18453#: lazarusidestrconsts.lisscanning2 18454#, object-pascal-format 18455msgid "%s. Scanning ..." 18456msgstr "" 18457 18458#: lazarusidestrconsts.lisscanparentdir 18459msgid "Scanning parent directory" 18460msgstr "" 18461 18462#: lazarusidestrconsts.lissearchpaths2 18463msgid "Search paths" 18464msgstr "" 18465 18466#: lazarusidestrconsts.lissearchunit 18467#, object-pascal-format 18468msgid "Search Unit \"%s\"" 18469msgstr "" 18470 18471#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor 18472msgid "secondary config directory where Lazarus searches for config template files. Default is " 18473msgstr "" 18474 18475#: lazarusidestrconsts.lissecondaryconfigpath 18476msgid "Secondary config path" 18477msgstr "" 18478 18479#: lazarusidestrconsts.lissecondtest 18480msgid "&Second test" 18481msgstr "" 18482 18483#: lazarusidestrconsts.lisseemessages 18484msgid "See messages." 18485msgstr "Visualitza els missatges." 18486 18487#: lazarusidestrconsts.lisseeprojectprojectinspector 18488#, object-pascal-format 18489msgid "%sSee Project -> Project Inspector" 18490msgstr "%sMireu Projecte -> Inspector del Projecte" 18491 18492#: lazarusidestrconsts.lisselectahelpitem 18493msgid "Select a help item:" 18494msgstr "Selecciona un element de l'ajuda:" 18495 18496#: lazarusidestrconsts.lisselectanode 18497msgid "Select a node" 18498msgstr "Selecciona un node" 18499 18500#: lazarusidestrconsts.lisselectanotherlclwidgetset 18501msgid "Select another LCL widgetset (macro LCLWidgetType)" 18502msgstr "" 18503 18504#: lazarusidestrconsts.lisselectdfmfiles 18505msgid "Select Delphi form files (*.dfm)" 18506msgstr "Selecciona els fitxers de formes Delphi (*.dfm)" 18507 18508#: lazarusidestrconsts.lisselected 18509msgctxt "lazarusidestrconsts.lisselected" 18510msgid "Selected" 18511msgstr "" 18512 18513#: lazarusidestrconsts.lisselectedaddition 18514msgid "Selected addition:" 18515msgstr "" 18516 18517#: lazarusidestrconsts.lisselectedandchildcontrols 18518msgid "Selected and child controls" 18519msgstr "" 18520 18521#: lazarusidestrconsts.lisselectedbottomneighbour 18522msgid "(selected bottom neighbour)" 18523msgstr "" 18524 18525#: lazarusidestrconsts.lisselectedcommandsmapping 18526msgid "Selected Command's Mapping" 18527msgstr "" 18528 18529#: lazarusidestrconsts.lisselectedforinstallation 18530msgid "selected for installation" 18531msgstr "" 18532 18533#: lazarusidestrconsts.lisselectedforuninstallation 18534msgid "selected for uninstallation" 18535msgstr "" 18536 18537#: lazarusidestrconsts.lisselectedleftneighbour 18538msgid "(selected left neighbour)" 18539msgstr "" 18540 18541#: lazarusidestrconsts.lisselectedmessageinmessageswindow 18542msgid "Selected message in messages window:" 18543msgstr "" 18544 18545#: lazarusidestrconsts.lisselectedmodeswerecompiled 18546#, object-pascal-format 18547msgid "Selected %d modes were successfully compiled." 18548msgstr "" 18549 18550#: lazarusidestrconsts.lisselectedrightneighbour 18551msgid "(selected right neighbour)" 18552msgstr "" 18553 18554#: lazarusidestrconsts.lisselectedtopneighbour 18555msgid "(selected top neighbour)" 18556msgstr "" 18557 18558#: lazarusidestrconsts.lisselectfile 18559msgid "Select the file" 18560msgstr "" 18561 18562#: lazarusidestrconsts.lisselectfpcpath 18563msgid "Select the path where FPC is installed" 18564msgstr "" 18565 18566#: lazarusidestrconsts.lisselectfpcsourcedirectory 18567msgid "Select FPC source directory" 18568msgstr "" 18569 18570#: lazarusidestrconsts.lisselectframe 18571msgid "Select Frame" 18572msgstr "" 18573 18574#: lazarusidestrconsts.lisselectionexceedsstringconstant 18575msgid "Selection exceeds string constant" 18576msgstr "La selecció excedeix la constant de la cadena" 18577 18578#: lazarusidestrconsts.lisselectiontool 18579msgid "Selection tool" 18580msgstr "Eina de selecció" 18581 18582#: lazarusidestrconsts.lisselectlazarussourcedirectory 18583msgid "Select Lazarus source directory" 18584msgstr "" 18585 18586#: lazarusidestrconsts.lisselectpathto 18587#, object-pascal-format 18588msgid "Select path to %s" 18589msgstr "" 18590 18591#: lazarusidestrconsts.lisselecttargetdirectory 18592msgid "Select target directory" 18593msgstr "" 18594 18595#: lazarusidestrconsts.lissetallcolors 18596msgid "Set all colors:" 18597msgstr "" 18598 18599#: lazarusidestrconsts.lissetdefault 18600msgid "Set default" 18601msgstr "" 18602 18603#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang 18604msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." 18605msgstr "" 18606 18607#: lazarusidestrconsts.lissetupdefaultindentation 18608msgid "(Set up default indentation)" 18609msgstr "" 18610 18611#: lazarusidestrconsts.lisshort 18612msgid "Short:" 18613msgstr "" 18614 18615#: lazarusidestrconsts.lisshortnopath 18616msgid "Short, no path" 18617msgstr "" 18618 18619#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications 18620#, object-pascal-format 18621msgid "Should the component \"%s\" be auto created when the application starts?" 18622msgstr "" 18623 18624#: lazarusidestrconsts.lisshow 18625msgid "Show" 18626msgstr "" 18627 18628#: lazarusidestrconsts.lisshowabstractmethodsof 18629#, object-pascal-format 18630msgid "Show abstract methods of \"%s\"" 18631msgstr "" 18632 18633#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector 18634msgid "Show component tree" 18635msgstr "" 18636 18637#: lazarusidestrconsts.lisshowconsole 18638msgid "Show console" 18639msgstr "" 18640 18641#: lazarusidestrconsts.lisshowdeclarationhints 18642msgid "Show declaration hints" 18643msgstr "" 18644 18645#: lazarusidestrconsts.lisshowdifferencesbetweenmodes 18646msgid "Show differences between modes ..." 18647msgstr "" 18648 18649#: lazarusidestrconsts.lisshowemptyunitspackages 18650msgid "Show empty units/packages" 18651msgstr "" 18652 18653#: lazarusidestrconsts.lisshowfpcmessagelinescompiled 18654msgid "Show FPC message \"lines compiled\"" 18655msgstr "" 18656 18657#: lazarusidestrconsts.lisshowglyphsfor 18658msgid "Show Glyphs for" 18659msgstr "" 18660 18661#: lazarusidestrconsts.lisshowgutterinobjectinspector 18662msgid "Show gutter" 18663msgstr "" 18664 18665#: lazarusidestrconsts.lisshowhelp 18666msgid "Show help" 18667msgstr "" 18668 18669#: lazarusidestrconsts.lisshowhintsinobjectinspector 18670#, fuzzy 18671msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector" 18672msgid "Show hints" 18673msgstr "Mostra sugerències a l'inspector d'Objectes" 18674 18675#: lazarusidestrconsts.lisshowidentifiers 18676msgid "Show identifiers" 18677msgstr "" 18678 18679#: lazarusidestrconsts.lisshowinfoboxinobjectinspector 18680msgid "Show information box" 18681msgstr "" 18682 18683#: lazarusidestrconsts.lisshowmessagetypeid 18684msgid "Show Message Type ID" 18685msgstr "" 18686 18687#: lazarusidestrconsts.lisshowmultiplelines 18688msgid "Show multiple lines" 18689msgstr "" 18690 18691#: lazarusidestrconsts.lisshowonlymodified 18692msgid "Show only modified" 18693msgstr "" 18694 18695#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead 18696msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window." 18697msgstr "" 18698 18699#: lazarusidestrconsts.lisshowoutput 18700msgid "Show output" 18701msgstr "" 18702 18703#: lazarusidestrconsts.lisshowoverviewgutter 18704msgid "Show overview gutter" 18705msgstr "" 18706 18707#: lazarusidestrconsts.lisshowpackages 18708msgid "Show packages" 18709msgstr "" 18710 18711#: lazarusidestrconsts.lisshowpositionofsourceeditor 18712msgid "Show position of source editor" 18713msgstr "" 18714 18715#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector 18716msgid "Show property filter" 18717msgstr "" 18718 18719#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop 18720msgid "Show recently used identifiers at top" 18721msgstr "" 18722 18723#: lazarusidestrconsts.lisshowrelativepaths 18724msgid "Show relative paths" 18725msgstr "" 18726 18727#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy 18728msgid "Shows all controls in tree hierarchy." 18729msgstr "" 18730 18731#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty 18732msgid "A box at the bottom shows description for the selected property." 18733msgstr "" 18734 18735#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings 18736msgid "Show setup dialog for most important settings" 18737msgstr "" 18738 18739#: lazarusidestrconsts.lisshowspecialcharacters 18740msgid "Show special characters" 18741msgstr "" 18742 18743#: lazarusidestrconsts.lisshowstatusbarinobjectinspector 18744msgid "Show statusbar" 18745msgstr "" 18746 18747#: lazarusidestrconsts.lisshowunits 18748msgid "Show units" 18749msgstr "" 18750 18751#: lazarusidestrconsts.lisshowunitswithinitialization 18752msgid "Show units with initialization/finalization sections" 18753msgstr "" 18754 18755#: lazarusidestrconsts.lisshowunitswithinitializationhint 18756msgid "These units may initialize global data used by the program/application. Remove with care." 18757msgstr "" 18758 18759#: lazarusidestrconsts.lisshowunusedunits 18760msgid "Show unused units ..." 18761msgstr "" 18762 18763#: lazarusidestrconsts.lisshowvaluehintswhiledebugging 18764msgid "Show value hints while debugging" 18765msgstr "" 18766 18767#: lazarusidestrconsts.lisshowversionandexit 18768msgid "show version and exit" 18769msgstr "" 18770 18771#: lazarusidestrconsts.lisshrinktosmal 18772msgid "Shrink to smallest" 18773msgstr "" 18774 18775#: lazarusidestrconsts.lissibling 18776msgid "Sibling" 18777msgstr "" 18778 18779#: lazarusidestrconsts.lissimpleprogram 18780msgid "Simple Program" 18781msgstr "" 18782 18783#: lazarusidestrconsts.lissimpleprogramprogramdescriptor 18784msgid "A most simple Free Pascal command line program." 18785msgstr "" 18786 18787#: lazarusidestrconsts.lissimplesyntax 18788#, fuzzy 18789#| msgid "Simple Syntax" 18790msgid "Simple syntax" 18791msgstr "Sintaxi SImple" 18792 18793#: lazarusidestrconsts.lisskiperrors 18794msgid "Skip errors" 18795msgstr "" 18796 18797#: lazarusidestrconsts.lisskipfile 18798msgid "Skip file" 18799msgstr "" 18800 18801#: lazarusidestrconsts.lisskipfileandcontinueloading 18802msgid "Skip file and continue loading" 18803msgstr "" 18804 18805#: lazarusidestrconsts.lisskiploadinglastproject 18806msgid "Skip loading last project" 18807msgstr "" 18808 18809#: lazarusidestrconsts.lisskipthesewarnings 18810msgid "Skip these warnings" 18811msgstr "" 18812 18813#: lazarusidestrconsts.lisslowerbutmoreaccurate 18814msgid "Slower but more accurate." 18815msgstr "" 18816 18817#: lazarusidestrconsts.lissmallerratherthanfaster 18818msgid "Smaller rather than faster" 18819msgstr "" 18820 18821#: lazarusidestrconsts.lissmatches 18822msgid "Matches" 18823msgstr "" 18824 18825#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented 18826msgid "Sorry, this type is not yet implemented" 18827msgstr "Ho sento, aquest tipus encara no està implementat" 18828 18829#: lazarusidestrconsts.lissortforscope 18830msgid "Sort for scope" 18831msgstr "" 18832 18833#: lazarusidestrconsts.lissorting 18834msgid "Sorting" 18835msgstr "" 18836 18837#: lazarusidestrconsts.lissortselascending 18838msgid "Ascending" 18839msgstr "Ascendent" 18840 18841#: lazarusidestrconsts.lissortselcasesensitive 18842msgctxt "lazarusidestrconsts.lissortselcasesensitive" 18843msgid "&Case Sensitive" 18844msgstr "" 18845 18846#: lazarusidestrconsts.lissortseldescending 18847msgid "Descending" 18848msgstr "Descendent" 18849 18850#: lazarusidestrconsts.lissortseldomain 18851msgid "Domain" 18852msgstr "Domini" 18853 18854#: lazarusidestrconsts.lissortselignorespace 18855msgid "Ignore Space" 18856msgstr "Ignora l'espai" 18857 18858#: lazarusidestrconsts.lissortsellines 18859msgid "Lines" 18860msgstr "Línies" 18861 18862#: lazarusidestrconsts.lissortseloptions 18863msgctxt "lazarusidestrconsts.lissortseloptions" 18864msgid "Options" 18865msgstr "Opcions" 18866 18867#: lazarusidestrconsts.lissortselparagraphs 18868msgid "Paragraphs" 18869msgstr "Paràgrafs" 18870 18871#: lazarusidestrconsts.lissortselpreview 18872msgctxt "lazarusidestrconsts.lissortselpreview" 18873msgid "Preview" 18874msgstr "Visualització prèvia" 18875 18876#: lazarusidestrconsts.lissortselsort 18877msgid "Accept" 18878msgstr "Accepta" 18879 18880#: lazarusidestrconsts.lissortselsortselection 18881msgid "Sort selection" 18882msgstr "Ordena la selecció" 18883 18884#: lazarusidestrconsts.lissortselwords 18885msgctxt "lazarusidestrconsts.lissortselwords" 18886msgid "Words" 18887msgstr "Paraules" 18888 18889#: lazarusidestrconsts.lissortunicoderangelistalphabetically 18890msgid "Sort Unicode range list alphabetically" 18891msgstr "" 18892 18893#: lazarusidestrconsts.lissourceanddestinationaresame 18894#, object-pascal-format 18895msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory." 18896msgstr "" 18897 18898#: lazarusidestrconsts.lissourceanddestinationarethesame 18899#, object-pascal-format 18900msgid "Source and Destination are the same:%s%s" 18901msgstr "Font i destinació son el mateix:%s%s" 18902 18903#: lazarusidestrconsts.lissourcebreakpoint 18904msgid "&Source Breakpoint ..." 18905msgstr "" 18906 18907#: lazarusidestrconsts.lissourcedirectorydoesnotexist 18908#, object-pascal-format, fuzzy, badformat 18909#| msgid "Source directory %s%s%s does not exist." 18910msgid "Source directory \"%s\" does not exist." 18911msgstr "El directori font %s%s%s no existeix." 18912 18913#: lazarusidestrconsts.lissourceeditorwindowmanager 18914msgid "Source Editor Window Manager" 18915msgstr "" 18916 18917#: lazarusidestrconsts.lissourcemodified 18918msgid "Source modified" 18919msgstr "S'ha modificat el codi font" 18920 18921#: lazarusidestrconsts.lissourceofpagehaschangedsave 18922#, object-pascal-format, fuzzy, badformat 18923#| msgid "Source of page %s%s%s has changed. Save?" 18924msgid "Source of page \"%s\" has changed. Save?" 18925msgstr "El codi font de la pàgina %s%s%s ha canviat. Voleu desar-lo?" 18926 18927#: lazarusidestrconsts.lissourceofpagehaschangedsaveex 18928#, object-pascal-format 18929msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" 18930msgstr "" 18931 18932#: lazarusidestrconsts.lissourcepaths 18933msgid "Source paths" 18934msgstr "" 18935 18936#: lazarusidestrconsts.lisspaceequally 18937msgid "Space equally" 18938msgstr "Iguala els espais" 18939 18940#: lazarusidestrconsts.lissrcos 18941msgid "Src OS" 18942msgstr "" 18943 18944#: lazarusidestrconsts.lisssearching 18945msgid "Searching" 18946msgstr "Cercant" 18947 18948#: lazarusidestrconsts.lisssearchtext 18949msgid "Search text" 18950msgstr "Cerca text" 18951 18952#: lazarusidestrconsts.lisstartconversion 18953msgid "Start Conversion" 18954msgstr "" 18955 18956#: lazarusidestrconsts.lisstartide 18957msgid "Start IDE" 18958msgstr "" 18959 18960#: lazarusidestrconsts.lisstartwithanewproject 18961msgid "Start with a new project" 18962msgstr "Inicia amb un nou projecte" 18963 18964#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass 18965msgid "Statusbar shows the property's name and the class where it is published." 18966msgstr "" 18967 18968#: lazarusidestrconsts.lisstop 18969msgctxt "lazarusidestrconsts.lisstop" 18970msgid "Stop" 18971msgstr "Atura" 18972 18973#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject 18974msgid "Stop current debugging and rebuild project?" 18975msgstr "Detindre la sessió de depuració i reconstruïr el projecte?" 18976 18977#: lazarusidestrconsts.lisstopdebugging 18978msgid "Stop Debugging?" 18979msgstr "Voleu aturar la depuració?" 18980 18981#: lazarusidestrconsts.lisstopdebugging2 18982msgid "Stop debugging?" 18983msgstr "Dentindre la sessió de depuració?" 18984 18985#: lazarusidestrconsts.lisstoponexception 18986msgid "Stop on exception" 18987msgstr "" 18988 18989#: lazarusidestrconsts.lisstopthedebugging 18990msgid "Stop the debugging?" 18991msgstr "Voleu aturar la depuració?" 18992 18993#: lazarusidestrconsts.lisstorepathdelimitersandas 18994msgid "Store path delimiters \\ and / as" 18995msgstr "" 18996 18997#: lazarusidestrconsts.lisstrangelpifile 18998msgid "Strange lpi file" 18999msgstr "" 19000 19001#: lazarusidestrconsts.lisstreamingerror 19002msgid "Streaming error" 19003msgstr "S'ha produït un error d'afluent" 19004 19005#: lazarusidestrconsts.lisstring 19006msgid "String" 19007msgstr "" 19008 19009#: lazarusidestrconsts.lisstyle 19010msgctxt "lazarusidestrconsts.lisstyle" 19011msgid "Style" 19012msgstr "" 19013 19014#: lazarusidestrconsts.lissubprocedure 19015msgid "Sub Procedure" 19016msgstr "Subprocediment" 19017 19018#: lazarusidestrconsts.lissubprocedureonsamelevel 19019msgid "Sub Procedure on same level" 19020msgstr "Subprocediment en el mateix nivell" 19021 19022#: lazarusidestrconsts.lissuccess 19023msgid "Success" 19024msgstr "Correcte!" 19025 19026#: lazarusidestrconsts.lissuccessfullyexported 19027#, object-pascal-format 19028msgid "Successfully exported to \"%s\"." 19029msgstr "" 19030 19031#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes 19032#, object-pascal-format 19033msgid "Successfully exported %d BuildModes to \"%s\"." 19034msgstr "" 19035 19036#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions 19037#, object-pascal-format 19038msgid "Successfully exported compiler options to \"%s\"." 19039msgstr "" 19040 19041#: lazarusidestrconsts.lissuccessfullyimported 19042#, object-pascal-format 19043msgid "Successfully imported from \"%s\"." 19044msgstr "" 19045 19046#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes 19047#, object-pascal-format 19048msgid "Successfully imported %d BuildModes from \"%s\"." 19049msgstr "" 19050 19051#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions 19052#, object-pascal-format 19053msgid "Successfully imported compiler options from \"%s\"." 19054msgstr "" 19055 19056#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase 19057msgid "Suggest default name of new file in lowercase" 19058msgstr "" 19059 19060#: lazarusidestrconsts.lissuspiciousincludepath 19061msgid "Suspicious include path" 19062msgstr "" 19063 19064#: lazarusidestrconsts.lissuspiciousunitpath 19065msgid "Suspicious unit path" 19066msgstr "" 19067 19068#: lazarusidestrconsts.lissvuoinvalidvariablename 19069msgid "Invalid variable name" 19070msgstr "El nom de la variable no és vàlid" 19071 19072#: lazarusidestrconsts.lissvuoisnotavalididentifier 19073#, object-pascal-format, fuzzy, badformat 19074#| msgid "%s%s%s is not a valid identifier." 19075msgid "\"%s\" is not a valid identifier." 19076msgstr "%s%s%s no és un identificador vàlid" 19077 19078#: lazarusidestrconsts.lissvuooverridesystemvariable 19079msgid "Override system variable" 19080msgstr "Substitueix la variable del sistema" 19081 19082#: lazarusidestrconsts.lisswitchfiltersettings 19083msgid "Switch Filter Settings" 19084msgstr "" 19085 19086#: lazarusidestrconsts.lisswitchtofavoritestabafterasking 19087msgid "Switch to Favorites tab after asking for component name." 19088msgstr "" 19089 19090#: lazarusidestrconsts.lissyntaxmode 19091msgid "Syntax mode" 19092msgstr "" 19093 19094#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg 19095msgid "system.ppu not found. Check your fpc.cfg." 19096msgstr "" 19097 19098#: lazarusidestrconsts.listab 19099msgid "Tab" 19100msgstr "Tabulador" 19101 19102#: lazarusidestrconsts.listaborderconfirmsort 19103#, object-pascal-format 19104msgid "Sort tab orders of all child controls of \"%s\" by their positions?" 19105msgstr "" 19106 19107#: lazarusidestrconsts.listaborderdownhint 19108msgid "Move the selected control down in tab order" 19109msgstr "" 19110 19111#: lazarusidestrconsts.listaborderof 19112#, object-pascal-format 19113msgid "Tab Order of %s" 19114msgstr "" 19115 19116#: lazarusidestrconsts.listaborderrecursionhint 19117msgid "Calculate tab order recursively for child controls" 19118msgstr "" 19119 19120#: lazarusidestrconsts.listaborderrecursively 19121msgid "recursively" 19122msgstr "" 19123 19124#: lazarusidestrconsts.listabordersorthint 19125msgid "Calculate tab order for controls by their X- and Y- positions" 19126msgstr "" 19127 19128#: lazarusidestrconsts.listaborderuphint 19129msgid "Move the selected control up in tab order" 19130msgstr "" 19131 19132#: lazarusidestrconsts.listabsfor 19133#, object-pascal-format 19134msgid "Tabs for %s" 19135msgstr "" 19136 19137#: lazarusidestrconsts.listakesnapshot 19138msgid "Take a Snapshot" 19139msgstr "" 19140 19141#: lazarusidestrconsts.listarget 19142msgid "Target:" 19143msgstr "" 19144 19145#: lazarusidestrconsts.listarget2 19146#, object-pascal-format 19147msgid ", Target: %s" 19148msgstr "" 19149 19150#: lazarusidestrconsts.listargetcpu 19151msgid "Target CPU" 19152msgstr "CPU destinació" 19153 19154#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory 19155msgid "Target file name: (-o, empty = use unit output directory)" 19156msgstr "" 19157 19158#: lazarusidestrconsts.listargetfilenameo 19159msgid "Target file name (-o):" 19160msgstr "" 19161 19162#: lazarusidestrconsts.listargetfilenameofproject 19163msgid "Target filename of project" 19164msgstr "Nom del fitxer destinació del projecte" 19165 19166#: lazarusidestrconsts.listargetfilenameplusparams 19167msgid "Target filename + params" 19168msgstr "" 19169 19170#: lazarusidestrconsts.listargetisreadonly 19171msgid "Target is read only" 19172msgstr "" 19173 19174#: lazarusidestrconsts.listargetos 19175msgctxt "lazarusidestrconsts.listargetos" 19176msgid "Target OS" 19177msgstr "SO de destinació" 19178 19179#: lazarusidestrconsts.listemplateeditparamcell 19180msgid "Editable Cell" 19181msgstr "" 19182 19183#: lazarusidestrconsts.listemplateeditparamcellhelp 19184#, object-pascal-format 19185msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")." 19186msgstr "" 19187 19188#: lazarusidestrconsts.listemplatefile 19189msgid "Template file" 19190msgstr "" 19191 19192#: lazarusidestrconsts.listestdirectory 19193msgid "Test directory" 19194msgstr "Directori de proves" 19195 19196#: lazarusidestrconsts.listesturl 19197msgid "Test URL" 19198msgstr "" 19199 19200#: lazarusidestrconsts.listheapplicationbundlewascreatedfor 19201#, object-pascal-format 19202msgid "The Application Bundle was created for \"%s\"" 19203msgstr "" 19204 19205#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro 19206#, object-pascal-format, fuzzy, badformat 19207#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste." 19208msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." 19209msgstr "La classe %s%s%s és un TControl i no pot ser enganxat dins un no-control%sNo s'ha pogut enganxar." 19210 19211#: lazarusidestrconsts.listhecodetoolsfoundanerror 19212#, object-pascal-format 19213msgid "The Codetools found an error:%s%s" 19214msgstr "" 19215 19216#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect 19217#, object-pascal-format 19218msgid "The compiler file \"%s\" does not look correct:%s%s" 19219msgstr "" 19220 19221#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby 19222#, object-pascal-format 19223msgid "The component %s can not be deleted because it is not owned by %s." 19224msgstr "" 19225 19226#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror 19227#, object-pascal-format 19228msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" 19229msgstr "" 19230 19231#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated 19232#, object-pascal-format, fuzzy, badformat 19233#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" 19234msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" 19235msgstr "L'editor de component de classe %s%s%s%sinvocat amb el verb #%s %s%s%s%s ha generat l'error:%s%s%s%s" 19236 19237#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp 19238#, object-pascal-format 19239msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." 19240msgstr "" 19241 19242#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp 19243#, object-pascal-format 19244msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." 19245msgstr "" 19246 19247#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo 19248msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier." 19249msgstr "" 19250 19251#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted 19252msgid "The configuration will be downgraded/converted." 19253msgstr "" 19254 19255#: lazarusidestrconsts.listhecontainsanotexistingdirectory 19256#, object-pascal-format 19257msgid "The %s contains a nonexistent directory:%s%s" 19258msgstr "" 19259 19260#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch 19261#, object-pascal-format 19262msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." 19263msgstr "" 19264 19265#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome 19266msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." 19267msgstr "" 19268 19269#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro 19270#, object-pascal-format, fuzzy, badformat 19271#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options" 19272msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" 19273msgstr "El depurador %s%s%s%sno existeix o no es executable. %s%s%sMira Entorn -> Opcions del Depurador" 19274 19275#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive 19276#, object-pascal-format 19277msgid "The debugger executable typically has the name \"%s\". Please give the full file path." 19278msgstr "" 19279 19280#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject 19281msgid "The default mode must be stored in project, not in session." 19282msgstr "" 19283 19284#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist 19285#, object-pascal-format, fuzzy, badformat 19286#| msgid "The destination directory%s%s%s%s does not exist." 19287msgid "The destination directory%s\"%s\" does not exist." 19288msgstr "No existeix el directori de destinació%s%s%s%s." 19289 19290#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep 19291#, object-pascal-format 19292msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options." 19293msgstr "" 19294 19295#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere 19296#, object-pascal-format 19297msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" 19298msgstr "" 19299 19300#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi 19301#, object-pascal-format 19302msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" 19303msgstr "" 19304 19305#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit 19306#, object-pascal-format 19307msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" 19308msgstr "" 19309 19310#: lazarusidestrconsts.listhedirectoryisnotwritable 19311#, object-pascal-format 19312msgid "The directory \"%s\" is not writable." 19313msgstr "" 19314 19315#: lazarusidestrconsts.listhedirectorywasnotfound 19316#, object-pascal-format 19317msgid "The directory %s was not found." 19318msgstr "" 19319 19320#: lazarusidestrconsts.listhefile 19321#, object-pascal-format, fuzzy, badformat 19322#| msgid "The file %s%s%s" 19323msgid "The file \"%s\"" 19324msgstr "El fitxer %s%s%s" 19325 19326#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile 19327#, object-pascal-format 19328msgid "The file %s does not look like a lpi file." 19329msgstr "" 19330 19331#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio 19332msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." 19333msgstr "" 19334 19335#: lazarusidestrconsts.listhefileisasymlinkopeninstead 19336#, object-pascal-format 19337msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?" 19338msgstr "" 19339 19340#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi 19341#, object-pascal-format 19342msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" 19343msgstr "" 19344 19345#: lazarusidestrconsts.listhefilemaskisinvalid 19346#, object-pascal-format 19347msgid "The file mask \"%s\" is invalid." 19348msgstr "" 19349 19350#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression 19351#, object-pascal-format 19352msgid "The file mask \"%s\" is not a valid regular expression." 19353msgstr "" 19354 19355#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject 19356#, object-pascal-format, fuzzy, badformat 19357#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." 19358msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." 19359msgstr "El fitxer %s%s%s%ssembla ser un programa. voleu tancar el projecte actual i crear un nou projecte Lazarus per aquest programa?%s\"No\" carregarà el fitxer com un codi font normal." 19360 19361#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp 19362#, object-pascal-format 19363msgid "The file %s seems to be the program file of an existing Lazarus Project." 19364msgstr "" 19365 19366#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac 19367#, object-pascal-format 19368msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?" 19369msgstr "" 19370 19371#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself 19372#, object-pascal-format, fuzzy, badformat 19373#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" 19374msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" 19375msgstr "No s'ha trobat el fitxer %s%s%s%s.%sEl voleu localitzar manualment ?%s" 19376 19377#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject 19378#, object-pascal-format, fuzzy, badformat 19379#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." 19380msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." 19381msgstr "No s'ha trobat el fitxer %s%s%s%s.Ignora, carregarà el projecte.%sAvorta n'aturarà la càrrega." 19382 19383#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth 19384#, object-pascal-format 19385msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" 19386msgstr "" 19387 19388#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect 19389#, object-pascal-format 19390msgid "The FPC source directory \"%s\" does not look correct:%s%s" 19391msgstr "" 19392 19393#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename 19394#, object-pascal-format 19395msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." 19396msgstr "" 19397 19398#: lazarusidestrconsts.listheideisstillbuilding 19399msgid "The IDE is still building." 19400msgstr "" 19401 19402#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction 19403msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." 19404msgstr "" 19405 19406#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand 19407#, object-pascal-format 19408msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?" 19409msgstr "" 19410 19411#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists 19412#, object-pascal-format 19413msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." 19414msgstr "" 19415 19416#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta 19417#, object-pascal-format 19418msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" 19419msgstr "" 19420 19421#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth 19422#, object-pascal-format 19423msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." 19424msgstr "" 19425 19426#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect 19427#, object-pascal-format 19428msgid "The Lazarus directory \"%s\" does not look correct:%s%s" 19429msgstr "" 19430 19431#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis 19432#, fuzzy 19433#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." 19434msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually." 19435msgstr "El fitxer LFM (Lazarus Form) conté propietats no vàlides. Això vol dir, per exemple, que conté algunes propietats/classes les quals no existeixen en la LCL actual. La manera normal de corregir això és eliminar aquestes propietats de la LFM i corregir manualment el codi pascal." 19436 19437#: lazarusidestrconsts.listhemacrodoesnotbeginwith 19438#, object-pascal-format 19439msgid "The macro \"%s\" does not begin with \"%s\"." 19440msgstr "" 19441 19442#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename 19443#, object-pascal-format 19444msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." 19445msgstr "" 19446 19447#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd 19448#, object-pascal-format 19449msgid "The new include file is not yet in the include search path.%sAdd directory %s?" 19450msgstr "" 19451 19452#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory 19453#, object-pascal-format 19454msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" 19455msgstr "" 19456 19457#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded 19458msgid "The old configuration will be upgraded." 19459msgstr "" 19460 19461#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint 19462#, object-pascal-format 19463msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" 19464msgstr "" 19465 19466#: lazarusidestrconsts.listheoutputdirectoryismissing 19467#, object-pascal-format 19468msgid "The output directory \"%s\" is missing." 19469msgstr "" 19470 19471#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath 19472#, object-pascal-format 19473msgid "The output directory of %s is listed in the include search path of %s." 19474msgstr "" 19475 19476#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes 19477#, object-pascal-format 19478msgid "The output directory of %s is listed in the inherited include search path of %s." 19479msgstr "" 19480 19481#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear 19482#, object-pascal-format 19483msgid "The output directory of %s is listed in the inherited unit search path of %s." 19484msgstr "" 19485 19486#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof 19487#, object-pascal-format 19488msgid "The output directory of %s is listed in the unit search path of %s." 19489msgstr "" 19490 19491#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot 19492msgid " The output directory should be a separate directory and not contain any source files." 19493msgstr "" 19494 19495#: lazarusidestrconsts.listheownerclasshasthisname 19496msgid "The owner class has this name" 19497msgstr "" 19498 19499#: lazarusidestrconsts.listheownerhasthisname 19500msgid "The owner has this name" 19501msgstr "" 19502 19503#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi 19504#, object-pascal-format 19505msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." 19506msgstr "" 19507 19508#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr 19509#, object-pascal-format 19510msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." 19511msgstr "" 19512 19513#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname 19514msgid "The package already contains a unit with this name." 19515msgstr "" 19516 19517#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi 19518#, object-pascal-format 19519msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package." 19520msgstr "" 19521 19522#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth 19523#, object-pascal-format 19524msgid "The package %s can not be uninstalled because it is needed by the IDE itself." 19525msgstr "" 19526 19527#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi 19528#, object-pascal-format 19529msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." 19530msgstr "" 19531 19532#: lazarusidestrconsts.listhepackageisalreadyinthelist 19533#, object-pascal-format 19534msgid "The package %s is already in the list" 19535msgstr "" 19536 19537#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall 19538#, object-pascal-format 19539msgid "The package %s is not a design time package. It cannot be installed in the IDE." 19540msgstr "" 19541 19542#: lazarusidestrconsts.listhepathofmakeisnotcorrect 19543#, object-pascal-format 19544msgid "The path of \"make\" is not correct: \"%s\"" 19545msgstr "" 19546 19547#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla 19548#, object-pascal-format, fuzzy, badformat 19549#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s" 19550msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." 19551msgstr "No s'ha trobat el programa %sMake%s.%sEs necessita aquesta eina per muntar el Lazarus.%s" 19552 19553#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain 19554msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" 19555msgstr "" 19556 19557#: lazarusidestrconsts.listheprojectdoesnotusedwarf 19558#, object-pascal-format 19559msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf." 19560msgstr "" 19561 19562#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems 19563#, object-pascal-format 19564msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces." 19565msgstr "" 19566 19567#: lazarusidestrconsts.listheprojecthasnomainsourcefile 19568msgid "The project has no main source file." 19569msgstr "" 19570 19571#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource 19572#, object-pascal-format, fuzzy, badformat 19573#| msgid "The project info file %s%s%s%sis equal to the project main source file!" 19574msgid "The project info file \"%s\"%sis equal to the project main source file!" 19575msgstr "El fitxer d'informació del projecte %s%s%s%sés igual al fitxer principal del codi font del projecte!" 19576 19577#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk 19578#, object-pascal-format 19579msgid "The project information file \"%s\"%shas changed on disk." 19580msgstr "" 19581 19582#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest 19583#, object-pascal-format, fuzzy 19584#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" 19585msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" 19586msgstr "S'ha de desar el projecte abans de muntar de nou%sSi fiqueu el directori de les proves en les opcions de l'entorn,%spodeu crear projectes nous i muntar-los al mateix temps.%sVoleu desar el projecte?" 19587 19588#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast 19589msgid "The project uses FPC resources which require at least FPC 2.4" 19590msgstr "" 19591 19592#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar 19593#, object-pascal-format 19594msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." 19595msgstr "" 19596 19597#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe 19598#, object-pascal-format 19599msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable." 19600msgstr "" 19601 19602#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable 19603#, object-pascal-format 19604msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file." 19605msgstr "" 19606 19607#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon 19608#, object-pascal-format 19609msgid "%sThere are additional notes for this message on%s" 19610msgstr "" 19611 19612#: lazarusidestrconsts.listherearenoconflictingkeys 19613msgid "There are no conflicting keys." 19614msgstr "" 19615 19616#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename 19617#, object-pascal-format 19618msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" 19619msgstr "Hi ha altres fitxers en el directori amb el mateix nom,%sels quals no més son diferents en la capitalització:%s%s%sVoleu eliminar-los?" 19620 19621#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension 19622#, object-pascal-format 19623msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" 19624msgstr "" 19625 19626#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname 19627msgid "There is already a build mode with this name." 19628msgstr "" 19629 19630#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename 19631#, object-pascal-format 19632msgid "There is already a component class with the name %s." 19633msgstr "" 19634 19635#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname 19636msgid "There is already a component with this name" 19637msgstr "" 19638 19639#: lazarusidestrconsts.listhereisalreadyafilein 19640#, object-pascal-format 19641msgid "There is already a file%s%s%sin %s" 19642msgstr "" 19643 19644#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue 19645#, object-pascal-format 19646msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" 19647msgstr "" 19648 19649#: lazarusidestrconsts.listhereisalreadyaformwiththename 19650#, object-pascal-format, fuzzy, badformat 19651#| msgid "There is already a form with the name %s%s%s" 19652msgid "There is already a form with the name \"%s\"" 19653msgstr "Ja hi ha una forma amb el nom %s%s%s" 19654 19655#: lazarusidestrconsts.listhereisalreadyamacrowiththename 19656#, object-pascal-format 19657msgid "There is already a macro with the name \"%s\"." 19658msgstr "" 19659 19660#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename 19661#, object-pascal-format 19662msgid "There is already an IDE macro with the name \"%s\"" 19663msgstr "" 19664 19665#: lazarusidestrconsts.listhereisalreadyapackageinthelist 19666#, object-pascal-format 19667msgid "There is already a package %s in the list" 19668msgstr "" 19669 19670#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur 19671#, object-pascal-format 19672msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?" 19673msgstr "" 19674 19675#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus 19676#, object-pascal-format, fuzzy, badformat 19677#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." 19678msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." 19679msgstr "Ja hi ha una unitat amb el nom %s%s%s. Els identificadors pascal han de ser únics." 19680 19681#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose 19682#, object-pascal-format, fuzzy, badformat 19683#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" 19684msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" 19685msgstr "En el projecte hi ha una unitat amb el nom %s%s%s.%sSi us plau, escolliu un nom diferent." 19686 19687#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu 19688#, object-pascal-format 19689msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." 19690msgstr "" 19691 19692#: lazarusidestrconsts.listheremustbeatleastonebuildmode 19693msgid "There must be at least one build mode." 19694msgstr "" 19695 19696#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor 19697#, object-pascal-format 19698msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." 19699msgstr "" 19700 19701#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent 19702#, object-pascal-format 19703msgid "There was an error during writing the selected component %s:%s:%s%s" 19704msgstr "S'ha produït un error mentre s'escrivia el component seleccionat %s:%s:%s%s" 19705 19706#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe 19707#, object-pascal-format 19708msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" 19709msgstr "S'ha produït un error mentre es convertia l'afluent binari del component seleccionat %s:%s:%s%s" 19710 19711#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli 19712#, object-pascal-format 19713msgid "There was an error while copying the component stream to clipboard:%s%s" 19714msgstr "S'ha produït un error mentre es copiava l'afluent del component al porta-retalls:%s%s" 19715 19716#: lazarusidestrconsts.listherootcomponentcannotbedeleted 19717#, fuzzy 19718#| msgid "The root component can not be deleted." 19719msgid "The root component cannot be deleted." 19720msgstr "No es pot eliminar el component arrel." 19721 19722#: lazarusidestrconsts.listhesefileswillbedeleted 19723msgid "These files will be deleted" 19724msgstr "" 19725 19726#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject 19727msgid "These settings are stored with the project." 19728msgstr "" 19729 19730#: lazarusidestrconsts.listheseunitswerenotfound 19731msgid "These units were not found:" 19732msgstr "" 19733 19734#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro 19735#, object-pascal-format 19736msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." 19737msgstr "" 19738 19739#: lazarusidestrconsts.listhetargetdirectoryisafile 19740#, object-pascal-format 19741msgid "The target directory is a file:%s" 19742msgstr "" 19743 19744#: lazarusidestrconsts.listhetargetfilenameisadirectory 19745msgid "The target file name is a directory." 19746msgstr "" 19747 19748#: lazarusidestrconsts.listhetargetisnotwritable 19749#, object-pascal-format 19750msgid "The target %s is not writable." 19751msgstr "" 19752 19753#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt 19754#, object-pascal-format 19755msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" 19756msgstr "" 19757 19758#: lazarusidestrconsts.listheunitalreadyexists 19759#, object-pascal-format 19760msgid "The unit \"%s\" already exists." 19761msgstr "" 19762 19763#: lazarusidestrconsts.listheunitbelongstopackage 19764#, object-pascal-format 19765msgid "The unit belongs to package %s." 19766msgstr "" 19767 19768#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe 19769#, object-pascal-format 19770msgid "The unit %s exists twice in the unit path of the %s:" 19771msgstr "" 19772 19773#: lazarusidestrconsts.listheunithasthisname 19774msgid "The unit has this name" 19775msgstr "" 19776 19777#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler 19778#, object-pascal-format 19779msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" 19780msgstr "" 19781 19782#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd 19783#, object-pascal-format 19784msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." 19785msgstr "" 19786 19787#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic 19788#, object-pascal-format 19789msgid "The unit %s is used by other files.%sUpdate references automatically?" 19790msgstr "" 19791 19792#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus 19793#, object-pascal-format, fuzzy, badformat 19794#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." 19795msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." 19796msgstr "La unitat ja te el nom %s%s%s. Els identificadors Pascal ha de ser únics." 19797 19798#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac 19799#, object-pascal-format 19800msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" 19801msgstr "" 19802 19803#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki 19804#, object-pascal-format 19805msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." 19806msgstr "" 19807 19808#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename 19809#, object-pascal-format 19810msgid "This component already contains a class with the name %s." 19811msgstr "" 19812 19813#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor 19814msgid "This function needs an open .lfm file in the source editor." 19815msgstr "" 19816 19817#: lazarusidestrconsts.listhishelpmessage 19818msgid "this help message" 19819msgstr "aquest missatge d'ajuda" 19820 19821#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage 19822msgid "This is a test project for a design time package, testing it outside the IDE." 19823msgstr "" 19824 19825#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc 19826#, object-pascal-format, fuzzy 19827#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" 19828msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" 19829msgstr "Sembla un arxiu pascal.%sS'hi recomana utilitzar minúscules per evitar problemes diversos amb alguns sistemes d'arxius i diferents compiladors.%sCanviar-li el nom a minúscules?" 19830 19831#: lazarusidestrconsts.listhisprojecthasnomainsourcefile 19832msgid "This project has no main source file" 19833msgstr "" 19834 19835#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode 19836msgid "This project has only the default build mode." 19837msgstr "" 19838 19839#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis 19840#, object-pascal-format 19841msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." 19842msgstr "" 19843 19844#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode 19845#, object-pascal-format 19846msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." 19847msgstr "No s'ha pogut extraure aquesta declaració.%sSi us plau, seleccioneu codi per extreure'n un nou procediment/mètode." 19848 19849#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme 19850msgid "This will allow changing all build modes at once. Not implemented yet." 19851msgstr "" 19852 19853#: lazarusidestrconsts.listhiswillcreateacirculardependency 19854msgid "This will create a circular dependency." 19855msgstr "" 19856 19857#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed 19858#, object-pascal-format 19859msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" 19860msgstr "" 19861 19862#: lazarusidestrconsts.listhreads 19863msgctxt "lazarusidestrconsts.listhreads" 19864msgid "Threads" 19865msgstr "" 19866 19867#: lazarusidestrconsts.listhreadscurrent 19868msgctxt "lazarusidestrconsts.listhreadscurrent" 19869msgid "Current" 19870msgstr "" 19871 19872#: lazarusidestrconsts.listhreadsfunc 19873msgctxt "lazarusidestrconsts.listhreadsfunc" 19874msgid "Function" 19875msgstr "" 19876 19877#: lazarusidestrconsts.listhreadsgoto 19878msgid "Goto" 19879msgstr "" 19880 19881#: lazarusidestrconsts.listhreadsline 19882msgctxt "lazarusidestrconsts.listhreadsline" 19883msgid "Line" 19884msgstr "Línia" 19885 19886#: lazarusidestrconsts.listhreadsnotevaluated 19887msgid "Threads not evaluated" 19888msgstr "" 19889 19890#: lazarusidestrconsts.listhreadssrc 19891msgctxt "lazarusidestrconsts.listhreadssrc" 19892msgid "Source" 19893msgstr "" 19894 19895#: lazarusidestrconsts.listhreadsstate 19896msgctxt "lazarusidestrconsts.listhreadsstate" 19897msgid "State" 19898msgstr "Estat" 19899 19900#: lazarusidestrconsts.listitle 19901msgid "&Title" 19902msgstr "" 19903 19904#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus 19905msgid "Title in taskbar shows for example: project1.lpi - Lazarus" 19906msgstr "" 19907 19908#: lazarusidestrconsts.listitleleaveemptyfordefault 19909msgid "Title (leave empty for default)" 19910msgstr "" 19911 19912#: lazarusidestrconsts.listmfunctionappendpathdelimiter 19913msgid "Function: append path delimiter" 19914msgstr "Funció: afegir el delimitador de la trajectòria" 19915 19916#: lazarusidestrconsts.listmfunctionchomppathdelimiter 19917#, fuzzy 19918#| msgid "Function: chomp path delimiter" 19919msgid "Function: remove trailing path delimiter" 19920msgstr "Funció: eliminar el delimitador de la trajectòria" 19921 19922#: lazarusidestrconsts.listmfunctionextractfileextension 19923msgid "Function: extract file extension" 19924msgstr "Funció: extreure l'extensió del fitxer" 19925 19926#: lazarusidestrconsts.listmfunctionextractfilenameextension 19927msgid "Function: extract file name+extension" 19928msgstr "Funció: extreure nom i extensió del fitxer" 19929 19930#: lazarusidestrconsts.listmfunctionextractfilenameonly 19931msgid "Function: extract file name only" 19932msgstr "Funció: extreure només el nom del fitxer" 19933 19934#: lazarusidestrconsts.listmfunctionextractfilepath 19935msgid "Function: extract file path" 19936msgstr "Funció: extreure la trajectòria del fitxer" 19937 19938#: lazarusidestrconsts.listmunknownmacro 19939#, object-pascal-format 19940msgid "(unknown macro: %s)" 19941msgstr "(macroinstrucció desconeguda: %s)" 19942 19943#: lazarusidestrconsts.listofpcpath 19944msgid "Path:" 19945msgstr "Trajectòria:" 19946 19947#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa 19948msgid "Toggle showing filenames with full path or with relative path" 19949msgstr "" 19950 19951#: lazarusidestrconsts.listoolbarconfiguration 19952msgid "Toolbar Configuration" 19953msgstr "" 19954 19955#: lazarusidestrconsts.listoolbaroptions 19956msgid "Toolbar" 19957msgstr "" 19958 19959#: lazarusidestrconsts.listoolbaroptionshighlight 19960msgid "Highlight toolbars buttons" 19961msgstr "" 19962 19963#: lazarusidestrconsts.listoolbaroptionsraise 19964msgid "Raise toolbars" 19965msgstr "" 19966 19967#: lazarusidestrconsts.listoolhasnoexecutable 19968#, object-pascal-format 19969msgid "tool \"%s\" has no executable" 19970msgstr "" 19971 19972#: lazarusidestrconsts.listoolheaderfailed 19973msgid "Tool Header: Failed" 19974msgstr "" 19975 19976#: lazarusidestrconsts.listoolheaderrunning 19977msgid "Tool Header: Running" 19978msgstr "" 19979 19980#: lazarusidestrconsts.listoolheaderscrolledup 19981msgid "Tool Header: Scrolled up" 19982msgstr "" 19983 19984#: lazarusidestrconsts.listoolheadersuccess 19985msgid "Tool Header: Success" 19986msgstr "" 19987 19988#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo 19989#, object-pascal-format 19990msgid "tool stopped with exit code %s. Use context menu to get more information." 19991msgstr "" 19992 19993#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo 19994#, object-pascal-format 19995msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information." 19996msgstr "" 19997 19998#: lazarusidestrconsts.listop 19999msgctxt "lazarusidestrconsts.listop" 20000msgid "Top" 20001msgstr "" 20002 20003#: lazarusidestrconsts.listopanchoring 20004msgid "Top anchoring" 20005msgstr "" 20006 20007#: lazarusidestrconsts.listopborderspacespinedithint 20008msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." 20009msgstr "" 20010 20011#: lazarusidestrconsts.listopinfoview 20012msgid "Show Class/Procedure hint" 20013msgstr "" 20014 20015#: lazarusidestrconsts.listops 20016msgid "Tops" 20017msgstr "Límits superiors" 20018 20019#: lazarusidestrconsts.listopsiblingcomboboxhint 20020msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 20021msgstr "" 20022 20023#: lazarusidestrconsts.listopspaceequally 20024msgid "Top space equally" 20025msgstr "Iguala l'espai superior" 20026 20027#: lazarusidestrconsts.listotalpages 20028#, object-pascal-format 20029msgid "Total Pages: %s" 20030msgstr "" 20031 20032#: lazarusidestrconsts.listranslatetheenglishmessages 20033msgid "Translate the English Messages" 20034msgstr "" 20035 20036#: lazarusidestrconsts.listreeneedsrefresh 20037msgid "Tree needs refresh" 20038msgstr "" 20039 20040#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein 20041#, object-pascal-format 20042msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" 20043msgstr "" 20044 20045#: lazarusidestrconsts.listypes 20046msgid "Types (not removed if no replacement)" 20047msgstr "" 20048 20049#: lazarusidestrconsts.lisudadditionaldirectories 20050msgid "Additional directories:" 20051msgstr "" 20052 20053#: lazarusidestrconsts.lisudallpackageunits 20054msgid "All package units" 20055msgstr "" 20056 20057#: lazarusidestrconsts.lisudallsourceeditorunits 20058msgid "All source editor units" 20059msgstr "" 20060 20061#: lazarusidestrconsts.lisudallunits 20062msgid "All units" 20063msgstr "" 20064 20065#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit 20066msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well." 20067msgstr "" 20068 20069#: lazarusidestrconsts.lisudcollapseallnodes 20070msgid "Collapse all nodes" 20071msgstr "" 20072 20073#: lazarusidestrconsts.lisudexpandallnodes 20074msgid "Expand all nodes" 20075msgstr "" 20076 20077#: lazarusidestrconsts.lisudfile 20078#, object-pascal-format 20079msgid "File: %s" 20080msgstr "" 20081 20082#: lazarusidestrconsts.lisudfilter 20083msgid "(Filter)" 20084msgstr "" 20085 20086#: lazarusidestrconsts.lisudimplementationuses 20087#, object-pascal-format 20088msgid "Implementation Uses: %s" 20089msgstr "" 20090 20091#: lazarusidestrconsts.lisudimplementationuses2 20092#, object-pascal-format 20093msgid "implementation uses: %s" 20094msgstr "" 20095 20096#: lazarusidestrconsts.lisudinterfaceuses 20097#, object-pascal-format 20098msgid "Interface Uses: %s" 20099msgstr "" 20100 20101#: lazarusidestrconsts.lisudinterfaceuses2 20102#, object-pascal-format 20103msgid "interface uses: %s" 20104msgstr "" 20105 20106#: lazarusidestrconsts.lisudprojectsandpackages 20107msgid "Projects and packages" 20108msgstr "" 20109 20110#: lazarusidestrconsts.lisudscanning 20111msgid "Scanning ..." 20112msgstr "" 20113 20114#: lazarusidestrconsts.lisudscanningunits 20115#, object-pascal-format 20116msgid "Scanning: %s units ..." 20117msgstr "" 20118 20119#: lazarusidestrconsts.lisudsearch 20120msgid "(Search)" 20121msgstr "" 20122 20123#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase 20124msgid "Find next occurrence of this phrase" 20125msgstr "" 20126 20127#: lazarusidestrconsts.lisudsearchnextunitofthisphrase 20128msgid "Find next unit with this phrase" 20129msgstr "" 20130 20131#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase 20132msgid "Find previous occurrence of this phrase" 20133msgstr "" 20134 20135#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase 20136msgid "Find previous unit with this phrase" 20137msgstr "" 20138 20139#: lazarusidestrconsts.lisudselectedunits 20140msgid "Selected units" 20141msgstr "" 20142 20143#: lazarusidestrconsts.lisudshownodesfordirectories 20144msgid "Show nodes for directories" 20145msgstr "" 20146 20147#: lazarusidestrconsts.lisudshownodesforprojectandpackages 20148msgid "Show nodes for project and packages" 20149msgstr "" 20150 20151#: lazarusidestrconsts.lisudunits 20152msgid "Units" 20153msgstr "" 20154 20155#: lazarusidestrconsts.lisudunits2 20156#, object-pascal-format 20157msgid "Units: %s" 20158msgstr "" 20159 20160#: lazarusidestrconsts.lisudusedbyimplementations 20161#, object-pascal-format 20162msgid "Used by Implementations: %s" 20163msgstr "" 20164 20165#: lazarusidestrconsts.lisudusedbyimplementations2 20166#, object-pascal-format 20167msgid "used by implementations: %s" 20168msgstr "" 20169 20170#: lazarusidestrconsts.lisudusedbyinterfaces 20171#, object-pascal-format 20172msgid "Used by Interfaces: %s" 20173msgstr "" 20174 20175#: lazarusidestrconsts.lisudusedbyinterfaces2 20176#, object-pascal-format 20177msgid "used by interfaces: %s" 20178msgstr "" 20179 20180#: lazarusidestrconsts.lisuedonotsho 20181msgid "Do not show this message again." 20182msgstr "No mostres mes aquest missatge." 20183 20184#: lazarusidestrconsts.lisueerrorinregularexpression 20185msgid "Error in regular expression" 20186msgstr "Hi ha un error a l'expressió regular" 20187 20188#: lazarusidestrconsts.lisuefontwith 20189msgid "Font without UTF-8" 20190msgstr "Font sense UTF-8" 20191 20192#: lazarusidestrconsts.lisuegotoline 20193#, fuzzy 20194#| msgid "Goto line :" 20195msgid "Goto line:" 20196msgstr "Vés a la línia:" 20197 20198#: lazarusidestrconsts.lisuemodeseparator 20199msgid "/" 20200msgstr "" 20201 20202#: lazarusidestrconsts.lisuenotfound 20203msgid "Not found" 20204msgstr "No s'ha trobat" 20205 20206#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith 20207#, object-pascal-format, fuzzy, badformat 20208#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" 20209msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" 20210msgstr "Voleu substituir aquesta ocurrència de %s%s%s%s amb %s%s%s?" 20211 20212#: lazarusidestrconsts.lisuesearching 20213#, object-pascal-format 20214msgid "Searching: %s" 20215msgstr "Cercant: %s" 20216 20217#: lazarusidestrconsts.lisuesearchstringcontinuebeg 20218msgid "Continue search from the beginning?" 20219msgstr "" 20220 20221#: lazarusidestrconsts.lisuesearchstringcontinueend 20222msgid "Continue search from the end?" 20223msgstr "" 20224 20225#: lazarusidestrconsts.lisuesearchstringnotfound 20226#, object-pascal-format 20227msgid "Search string '%s' not found!" 20228msgstr "No s'ha trobat la cadena '%s'" 20229 20230#: lazarusidestrconsts.lisuethecurre 20231#, object-pascal-format, fuzzy 20232#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." 20233msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." 20234msgstr "La font de l'editor actual no soport UTF-8, però pareix que el teu sistema està utilitzant-la.%sAçò implica que els caràcters no ASCII probablement no s'hi voran corrèctament.%sPodries sel·leccionar un altra font a les opcions de l'editor." 20235 20236#: lazarusidestrconsts.lisuiclearincludedbyreference 20237msgid "Clear include cache" 20238msgstr "" 20239 20240#: lazarusidestrconsts.lisuidbytes 20241#, object-pascal-format 20242msgid "%s bytes" 20243msgstr "%s octets" 20244 20245#: lazarusidestrconsts.lisuidincludedby 20246msgid "Included by:" 20247msgstr "Inclòs per:" 20248 20249#: lazarusidestrconsts.lisuidinproject 20250#, fuzzy 20251#| msgid "in Project:" 20252msgid "In project:" 20253msgstr "en el projecte:" 20254 20255#: lazarusidestrconsts.lisuidlines 20256msgctxt "lazarusidestrconsts.lisuidlines" 20257msgid "Lines:" 20258msgstr "Línies:" 20259 20260#: lazarusidestrconsts.lisuidname 20261msgctxt "lazarusidestrconsts.lisuidname" 20262msgid "Name:" 20263msgstr "Nom:" 20264 20265#: lazarusidestrconsts.lisuidno 20266msgid "no" 20267msgstr "no" 20268 20269#: lazarusidestrconsts.lisuidsize 20270msgid "Size:" 20271msgstr "Tamany:" 20272 20273#: lazarusidestrconsts.lisuidtype 20274msgid "Type:" 20275msgstr "Tipus:" 20276 20277#: lazarusidestrconsts.lisuidyes 20278msgid "yes" 20279msgstr "sí" 20280 20281#: lazarusidestrconsts.lisuishowcodetoolsvalues 20282msgid "Show CodeTools Values" 20283msgstr "Mostra els valors" 20284 20285#: lazarusidestrconsts.lisunableconvertbinarystreamtotext 20286msgid "Unable convert binary stream to text" 20287msgstr "No es pot convertir afluent binari a text" 20288 20289#: lazarusidestrconsts.lisunablecopycomponentstoclipboard 20290msgid "Unable copy components to clipboard" 20291msgstr "No es pot copiar els components al porta-retalls" 20292 20293#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile 20294#, object-pascal-format, fuzzy, badformat 20295#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." 20296msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." 20297msgstr "No es pot afegir el comentari de capçalera del recurs al fitxer del recurs %s%s%s%s.%sProbable error de sintaxi." 20298 20299#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably 20300#, object-pascal-format, fuzzy, badformat 20301#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." 20302msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." 20303msgstr "No es pot afegir el recurs T%s:FORMDATA al fitxer de recurs %s%s%s%s.%sProbable error de sintaxi." 20304 20305#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread 20306#, object-pascal-format 20307msgid "Unable to add the dependency %s because the package %s has already a dependency %s" 20308msgstr "" 20309 20310#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea 20311#, object-pascal-format 20312msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s" 20313msgstr "" 20314 20315#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith 20316#, object-pascal-format, fuzzy 20317#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." 20318msgid "Unable to add %s to project because there is already a unit with the same name in the Project." 20319msgstr "No es pot afegir %s al projecte, ja hi ha una unitat amb el mateix nom al projecte." 20320 20321#: lazarusidestrconsts.lisunabletobackupfileto 20322#, object-pascal-format, fuzzy, badformat 20323#| msgid "Unable to backup file %s%s%s to %s%s%s!" 20324msgid "Unable to backup file \"%s\" to \"%s\"!" 20325msgstr "No es pot fer copia de seguretat del fitxer %s%s%s a %s%s%s!" 20326 20327#: lazarusidestrconsts.lisunabletochangeclassofto 20328#, object-pascal-format 20329msgid "%s%sUnable to change class of %s to %s" 20330msgstr "%s%sIncapaç canviar la classe de %s a %s" 20331 20332#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource 20333#, object-pascal-format 20334msgid "Unable to change project scaled in source.%s%s" 20335msgstr "" 20336 20337#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource 20338#, object-pascal-format 20339msgid "Unable to change project title in source.%s%s" 20340msgstr "" 20341 20342#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory 20343msgid "Unable to clean up destination directory" 20344msgstr "No es pot netejar el directori destinació" 20345 20346#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions 20347#, object-pascal-format, fuzzy, badformat 20348#| msgid "Unable to clean up %s%s%s.%sPlease check permissions." 20349msgid "Unable to clean up \"%s\".%sPlease check permissions." 20350msgstr "No es pot netejar %s%s%s.%sSi us plau, comproveu els permisos." 20351 20352#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat 20353#, object-pascal-format 20354msgid "Unable to convert component text into binary format:%s%s" 20355msgstr "No es pot convertir el component de text a format binari:%s%s" 20356 20357#: lazarusidestrconsts.lisunabletoconvertfileerror 20358#, object-pascal-format, fuzzy, badformat 20359#| msgid "Unable to convert file %s%s%s%sError: %s" 20360msgid "Unable to convert file \"%s\"%sError: %s" 20361msgstr "No es pot convetir el fitxer %s%s%s%sError: %s" 20362 20363#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream 20364#, object-pascal-format, fuzzy, badformat 20365#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" 20366msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" 20367msgstr "No es poden convertir dades de forma del fitxer %s%s%s%s%sa afluent binari. (%s)" 20368 20369#: lazarusidestrconsts.lisunabletoconverttoencoding 20370#, object-pascal-format 20371msgid "Unable to convert to encoding \"%s\"" 20372msgstr "" 20373 20374#: lazarusidestrconsts.lisunabletocopyfile 20375msgid "Unable to copy file" 20376msgstr "No es pot copiar el fitxer" 20377 20378#: lazarusidestrconsts.lisunabletocopyfileto 20379#, object-pascal-format, fuzzy, badformat 20380#| msgid "Unable to copy file %s%s%s%sto %s%s%s" 20381msgid "Unable to copy file \"%s\"%sto \"%s\"" 20382msgstr "No es pot copiar el fitxer %s%s%s%sa %s%s%s" 20383 20384#: lazarusidestrconsts.lisunabletocreatedirectory 20385#, object-pascal-format, fuzzy, badformat 20386#| msgid "Unable to create directory %s%s%s." 20387msgid "Unable to create directory \"%s\"." 20388msgstr "No es pot crear el directori %s%s%s" 20389 20390#: lazarusidestrconsts.lisunabletocreatefile 20391msgid "Unable to create file" 20392msgstr "No es pot crear el fitxer" 20393 20394#: lazarusidestrconsts.lisunabletocreatefile2 20395#, object-pascal-format, fuzzy, badformat 20396#| msgid "Unable to create file %s%s%s" 20397msgid "Unable to create file \"%s\"" 20398msgstr "No es pot crear el fitxer %s%s%s" 20399 20400#: lazarusidestrconsts.lisunabletocreatefile3 20401#, object-pascal-format 20402msgid "Unable to create file%s\"%s\"" 20403msgstr "" 20404 20405#: lazarusidestrconsts.lisunabletocreatelinkwithtarget 20406#, object-pascal-format 20407msgid "Unable to create link \"%s\" with target \"%s\"" 20408msgstr "" 20409 20410#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto 20411msgid "Unable to create new file because there is already a directory with this name." 20412msgstr "" 20413 20414#: lazarusidestrconsts.lisunabletocreatenewmethod 20415msgid "Unable to create new method." 20416msgstr "" 20417 20418#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer 20419msgid "Unable to create temporary lfm buffer." 20420msgstr "" 20421 20422#: lazarusidestrconsts.lisunabletodelete 20423msgid "Unable to delete" 20424msgstr "" 20425 20426#: lazarusidestrconsts.lisunabletodeleteambiguousfile 20427#, object-pascal-format 20428msgid "Unable to delete ambiguous file \"%s\"" 20429msgstr "" 20430 20431#: lazarusidestrconsts.lisunabletoexecute 20432#, object-pascal-format 20433msgid "unable to execute: %s" 20434msgstr "" 20435 20436#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe 20437msgid "Unable to find a ResourceString section in this or any of the used units." 20438msgstr "" 20439 20440#: lazarusidestrconsts.lisunabletofindavalidclassnamein 20441#, object-pascal-format, fuzzy, badformat 20442#| msgid "Unable to find a valid classname in %s%s%s" 20443msgid "Unable to find a valid classname in \"%s\"" 20444msgstr "No es pot trobar un nom de classe vàlid a %s%s%s" 20445 20446#: lazarusidestrconsts.lisunabletofindfile 20447#, object-pascal-format, fuzzy, badformat 20448#| msgid "Unable to find file %s%s%s." 20449msgid "Unable to find file \"%s\"." 20450msgstr "No es pot trobar el fitxer %s%s%s." 20451 20452#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption 20453#, object-pascal-format 20454msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" 20455msgstr "" 20456 20457#: lazarusidestrconsts.lisunabletofindinlfmstream 20458#, object-pascal-format 20459msgid "Unable to find %s in LFM Stream." 20460msgstr "" 20461 20462#: lazarusidestrconsts.lisunabletofindmethod 20463msgid "Unable to find method." 20464msgstr "" 20465 20466#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile 20467#, object-pascal-format 20468msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" 20469msgstr "" 20470 20471#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar 20472#, object-pascal-format 20473msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" 20474msgstr "" 20475 20476#: lazarusidestrconsts.lisunabletogathereditorchanges 20477msgid "Unable to gather editor changes." 20478msgstr "" 20479 20480#: lazarusidestrconsts.lisunabletogetsourcefordesigner 20481msgid "Unable to get source for designer." 20482msgstr "" 20483 20484#: lazarusidestrconsts.lisunabletoloadfile2 20485#, object-pascal-format 20486msgid "unable to load file %s: %s" 20487msgstr "" 20488 20489#: lazarusidestrconsts.lisunabletoloadpackage 20490#, object-pascal-format 20491msgid "Unable to load package \"%s\"" 20492msgstr "" 20493 20494#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits 20495#, object-pascal-format 20496msgid "Unable to load the component class \"%s\" because it depends on itself." 20497msgstr "" 20498 20499#: lazarusidestrconsts.lisunabletoopen 20500#, object-pascal-format 20501msgid "Unable to open \"%s\"" 20502msgstr "" 20503 20504#: lazarusidestrconsts.lisunabletoopenancestorcomponent 20505msgid "Unable to open ancestor component" 20506msgstr "" 20507 20508#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades 20509#, object-pascal-format 20510msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." 20511msgstr "" 20512 20513#: lazarusidestrconsts.lisunabletoread 20514#, object-pascal-format 20515msgid "Unable to read %s" 20516msgstr "" 20517 20518#: lazarusidestrconsts.lisunabletoreadfile 20519msgid "Unable to read file" 20520msgstr "No es pot llegir el fitxer" 20521 20522#: lazarusidestrconsts.lisunabletoreadfile2 20523#, object-pascal-format, fuzzy, badformat 20524#| msgid "Unable to read file %s%s%s!" 20525msgid "Unable to read file \"%s\"." 20526msgstr "No es pot llegir el fitxer %s%s%s!" 20527 20528#: lazarusidestrconsts.lisunabletoreadfileerror 20529#, object-pascal-format, fuzzy, badformat 20530#| msgid "Unable to read file %s%s%s%sError: %s" 20531msgid "Unable to read file \"%s\"%sError: %s" 20532msgstr "No es pot llegir el fitxer %s%s%s%sError: %s" 20533 20534#: lazarusidestrconsts.lisunabletoreadlpi 20535msgid "Unable to read lpi" 20536msgstr "" 20537 20538#: lazarusidestrconsts.lisunabletoreadprocessexitstatus 20539msgid "unable to read process ExitStatus" 20540msgstr "" 20541 20542#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile 20543#, object-pascal-format 20544msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile" 20545msgid "Unable to read the project info file%s\"%s\"." 20546msgstr "" 20547 20548#: lazarusidestrconsts.lisunabletoremoveoldbackupfile 20549#, object-pascal-format, fuzzy, badformat 20550#| msgid "Unable to remove old backup file %s%s%s!" 20551msgid "Unable to remove old backup file \"%s\"!" 20552msgstr "No es pot eliminar el fitxer de resguard antic %s%s%s!" 20553 20554#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource 20555#, object-pascal-format 20556msgid "Unable to remove project scaled from source.%s%s" 20557msgstr "" 20558 20559#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource 20560#, object-pascal-format 20561msgid "Unable to remove project title from source.%s%s" 20562msgstr "" 20563 20564#: lazarusidestrconsts.lisunabletorenameambiguousfileto 20565#, object-pascal-format 20566msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" 20567msgstr "" 20568 20569#: lazarusidestrconsts.lisunabletorenamefile 20570msgid "Unable to rename file" 20571msgstr "No es pot canviar el nom del fitxer" 20572 20573#: lazarusidestrconsts.lisunabletorenamefileto 20574#, object-pascal-format, fuzzy, badformat 20575#| msgid "Unable to rename file %s%s%s to %s%s%s!" 20576msgid "Unable to rename file \"%s\" to \"%s\"!" 20577msgstr "No es pot canviar el nom del fitxer %s%s%s a %s%s%s!" 20578 20579#: lazarusidestrconsts.lisunabletorenamefileto2 20580#, object-pascal-format, fuzzy, badformat 20581#| msgid "Unable to rename file %s%s%s%sto %s%s%s." 20582msgid "Unable to rename file \"%s\"%sto \"%s\"." 20583msgstr "No es pot canviar el nom del fitxer %s%s%s%sa %s%s%s." 20584 20585#: lazarusidestrconsts.lisunabletorenameforminsource 20586msgid "Unable to rename form in source." 20587msgstr "No es pot canviar el nom de la forma en el codi font" 20588 20589#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag 20590msgid "Unable to rename method. Please fix the error shown in the message window." 20591msgstr "No es pot canviar el nom del mètode. Si us plau, corregiu l'error de la finestra de missatges." 20592 20593#: lazarusidestrconsts.lisunabletorenamevariableinsource 20594msgid "Unable to rename variable in source." 20595msgstr "No es pot canviar el nom de la variable en el codi font." 20596 20597#: lazarusidestrconsts.lisunabletorun 20598msgid "Unable to run" 20599msgstr "" 20600 20601#: lazarusidestrconsts.lisunabletorun2 20602#, object-pascal-format 20603msgid "Unable to run \"%s\"" 20604msgstr "" 20605 20606#: lazarusidestrconsts.lisunabletosetanchorsidecontrol 20607msgid "Unable to set AnchorSide Control" 20608msgstr "" 20609 20610#: lazarusidestrconsts.lisunabletoshowmethod 20611msgid "Unable to show method." 20612msgstr "" 20613 20614#: lazarusidestrconsts.lisunabletostreamselectedcomponents 20615msgid "Unable to stream selected components" 20616msgstr "No es poden afluir els components seleccionats" 20617 20618#: lazarusidestrconsts.lisunabletostreamselectedcomponents2 20619msgid "Unable to stream selected components." 20620msgstr "" 20621 20622#: lazarusidestrconsts.lisunabletostreamt 20623#, object-pascal-format 20624msgid "Unable to stream %s:T%s." 20625msgstr "No es pot afluir %s:T%s." 20626 20627#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext 20628#, object-pascal-format 20629msgid "Unable to transform binary component stream of %s:T%s into text." 20630msgstr "No es pot transformar afluent de component binari de %s:T%s a text." 20631 20632#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource 20633msgid "Unable to update CreateForm statement in project source" 20634msgstr "No es pot actualitzar la declaració CreateForm en el codi font del projecte" 20635 20636#: lazarusidestrconsts.lisunabletowrite2 20637#, object-pascal-format 20638msgid "Unable to write \"%s\"" 20639msgstr "" 20640 20641#: lazarusidestrconsts.lisunabletowritefile 20642msgid "Unable to write file" 20643msgstr "No es pot escriure el fitxer" 20644 20645#: lazarusidestrconsts.lisunabletowritefile2 20646#, object-pascal-format 20647msgid "Unable to write file \"%s\"." 20648msgstr "" 20649 20650#: lazarusidestrconsts.lisunabletowritefileerror 20651#, object-pascal-format, fuzzy, badformat 20652#| msgid "Unable to write file %s%s%s%sError: %s" 20653msgid "Unable to write file \"%s\"%sError: %s" 20654msgstr "No es pot escriure el fitxer %s%s%s%sError: %s" 20655 20656#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror 20657#, object-pascal-format 20658msgid "Unable to write the project info file%s\"%s\".%sError: %s" 20659msgstr "" 20660 20661#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror 20662#, object-pascal-format 20663msgid "Unable to write the project session file%s\"%s\".%sError: %s" 20664msgstr "" 20665 20666#: lazarusidestrconsts.lisunabletowritetofile2 20667#, object-pascal-format 20668msgid "Unable to write to file \"%s\"." 20669msgstr "" 20670 20671#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror 20672#, object-pascal-format 20673msgid "Unable to write xml stream to %s%sError: %s" 20674msgstr "" 20675 20676#: lazarusidestrconsts.lisuncheckall 20677msgid "Uncheck All" 20678msgstr "" 20679 20680#: lazarusidestrconsts.lisundo 20681msgctxt "lazarusidestrconsts.lisundo" 20682msgid "Undo" 20683msgstr "" 20684 20685#: lazarusidestrconsts.lisuninstall 20686#, object-pascal-format 20687msgid "Uninstall %s" 20688msgstr "" 20689 20690#: lazarusidestrconsts.lisuninstallimpossible 20691msgid "Uninstall impossible" 20692msgstr "" 20693 20694#: lazarusidestrconsts.lisuninstallselection 20695msgid "Uninstall selection" 20696msgstr "Desinstal·la la selecció" 20697 20698#: lazarusidestrconsts.lisunit 20699#, fuzzy 20700msgctxt "lazarusidestrconsts.lisunit" 20701msgid "Unit" 20702msgstr "Unitat" 20703 20704#: lazarusidestrconsts.lisunithaschangedsave 20705#, object-pascal-format 20706msgid "Unit \"%s\" has changed. Save?" 20707msgstr "" 20708 20709#: lazarusidestrconsts.lisunitidentifierexists 20710msgid "Unit identifier exists" 20711msgstr "Ja existeix l'identificador de la unitat" 20712 20713#: lazarusidestrconsts.lisunitinpackage 20714#, object-pascal-format 20715msgid "%s unit %s in package %s" 20716msgstr "" 20717 20718#: lazarusidestrconsts.lisunitmustsavebeforeinherit 20719#, object-pascal-format 20720msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?" 20721msgstr "" 20722 20723#: lazarusidestrconsts.lisunitnamealreadyexistscap 20724msgid "Unitname already in project" 20725msgstr "El nom de la unitat ja és al projecte" 20726 20727#: lazarusidestrconsts.lisunitnamebeginswith 20728msgid "Unit name begins with ..." 20729msgstr "" 20730 20731#: lazarusidestrconsts.lisunitnamecontains 20732msgid "Unit name contains ..." 20733msgstr "" 20734 20735#: lazarusidestrconsts.lisunitnotfound 20736#, object-pascal-format 20737msgid "unit %s not found" 20738msgstr "" 20739 20740#: lazarusidestrconsts.lisunitnotfoundatnewposition 20741#, object-pascal-format 20742msgid "unit %s not found at new position \"%s\"" 20743msgstr "" 20744 20745#: lazarusidestrconsts.lisunitnotfoundinproject 20746#, object-pascal-format 20747msgid "A unit not found in project %s" 20748msgstr "" 20749 20750#: lazarusidestrconsts.lisunitoutputdirectory 20751msgid "Unit Output directory" 20752msgstr "Directori sortida de la unitat" 20753 20754#: lazarusidestrconsts.lisunitpath 20755msgid "unit path" 20756msgstr "trajectòria de les unitats" 20757 20758#: lazarusidestrconsts.lisunitpaths 20759msgid "Unit paths" 20760msgstr "" 20761 20762#: lazarusidestrconsts.lisunitrequirespackage 20763#, object-pascal-format 20764msgid "unit %s requires package %s" 20765msgstr "" 20766 20767#: lazarusidestrconsts.lisunitsnotfoundinproject 20768#, object-pascal-format 20769msgid "Units not found in project %s" 20770msgstr "" 20771 20772#: lazarusidestrconsts.lisunsigned 20773msgid "Unsigned" 20774msgstr "" 20775 20776#: lazarusidestrconsts.lisunusedunitsof 20777#, object-pascal-format 20778msgid "Unused units of %s" 20779msgstr "" 20780 20781#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor 20782msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." 20783msgstr "" 20784 20785#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa 20786msgid "Unusual pas2js compiler file name. Usually it starts with pas2js." 20787msgstr "" 20788 20789#: lazarusidestrconsts.lisup 20790msgctxt "lazarusidestrconsts.lisup" 20791msgid "Up" 20792msgstr "Amunt" 20793 20794#: lazarusidestrconsts.lisupdateapplicationcreateform 20795msgid "Update Application.CreateForm statements in main unit" 20796msgstr "" 20797 20798#: lazarusidestrconsts.lisupdateapplicationscaledstatement 20799msgid "Update Application.Scaled statement in main unit" 20800msgstr "" 20801 20802#: lazarusidestrconsts.lisupdateapplicationtitlestatement 20803msgid "Update Application.Title statement in main unit" 20804msgstr "" 20805 20806#: lazarusidestrconsts.lisupdateinfo 20807msgid "Update info" 20808msgstr "" 20809 20810#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha 20811msgid "Update other procedure signatures when only letter case has changed" 20812msgstr "" 20813 20814#: lazarusidestrconsts.lisupdatereferences 20815msgid "Update references?" 20816msgstr "" 20817 20818#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage 20819#, object-pascal-format 20820msgid "Updating PO files failed for package %s" 20821msgstr "" 20822 20823#: lazarusidestrconsts.lisupgrade 20824msgid "Upgrade" 20825msgstr "" 20826 20827#: lazarusidestrconsts.lisupgradeconfiguration 20828msgid "Upgrade configuration" 20829msgstr "" 20830 20831#: lazarusidestrconsts.lisuppercasestring 20832msgid "uppercase string" 20833msgstr "" 20834 20835#: lazarusidestrconsts.lisuppercasestringgivenasparameter 20836msgid "Uppercase string given as parameter." 20837msgstr "" 20838 20839#: lazarusidestrconsts.lisurlonwikithebaseurlis 20840#, object-pascal-format 20841msgid "URL on wiki (the base url is %s)" 20842msgstr "" 20843 20844#: lazarusidestrconsts.lisusagemessagehoption 20845msgid "Usage message (-h option)" 20846msgstr "" 20847 20848#: lazarusidestrconsts.lisuse 20849msgid "Use" 20850msgstr "" 20851 20852#: lazarusidestrconsts.lisuseansistrings 20853#, fuzzy 20854msgctxt "lazarusidestrconsts.lisuseansistrings" 20855msgid "Use Ansistrings" 20856msgstr "Utilitza Ansi Strings" 20857 20858#: lazarusidestrconsts.lisusecheckboxforbooleanvalues 20859msgid "Use CheckBox for Boolean values" 20860msgstr "" 20861 20862#: lazarusidestrconsts.lisusecommentsincustomoptions 20863msgid "Use comments in custom options" 20864msgstr "" 20865 20866#: lazarusidestrconsts.lisusedby 20867#, object-pascal-format 20868msgid " used by %s" 20869msgstr "" 20870 20871#: lazarusidestrconsts.lisusedesigntimepackages 20872msgid "Use design time packages" 20873msgstr "" 20874 20875#: lazarusidestrconsts.lisusedforautocreatedforms 20876msgid "Used for auto-created forms." 20877msgstr "" 20878 20879#: lazarusidestrconsts.lisusefilterforextrafiles 20880msgid "Use filter to include extra files" 20881msgstr "" 20882 20883#: lazarusidestrconsts.lisuseidentifier 20884msgid "Use identifier" 20885msgstr "" 20886 20887#: lazarusidestrconsts.lisuseidentifierinat 20888#, object-pascal-format 20889msgid "Use identifier %s in %s at %s" 20890msgstr "" 20891 20892#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox 20893msgid "Launching application" 20894msgstr "" 20895 20896#: lazarusidestrconsts.lisusepackageinpackage 20897#, object-pascal-format 20898msgid "Use package %s in package %s" 20899msgstr "" 20900 20901#: lazarusidestrconsts.lisusepackageinpackage2 20902msgid "Use package in package" 20903msgstr "" 20904 20905#: lazarusidestrconsts.lisusepackageinproject 20906#, object-pascal-format 20907msgid "Use package %s in project" 20908msgstr "" 20909 20910#: lazarusidestrconsts.lisusepackageinproject2 20911msgid "Use package in project" 20912msgstr "" 20913 20914#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd 20915#, object-pascal-format 20916msgid "Add to list \"%s\"" 20917msgstr "" 20918 20919#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup 20920msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup" 20921msgid "User defined text markup" 20922msgstr "" 20923 20924#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove 20925#, object-pascal-format 20926msgid "Remove from list \"%s\"" 20927msgstr "" 20928 20929#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle 20930#, object-pascal-format 20931msgid "Toggle on list \"%s\"" 20932msgstr "" 20933 20934#: lazarusidestrconsts.lisusershomedirectory 20935msgid "User's home directory" 20936msgstr "" 20937 20938#: lazarusidestrconsts.lisuseunit 20939msgctxt "lazarusidestrconsts.lisuseunit" 20940msgid "Add Unit to Uses Section" 20941msgstr "" 20942 20943#: lazarusidestrconsts.lisuseunitinunit 20944#, object-pascal-format 20945msgid "Use unit %s in unit %s" 20946msgstr "" 20947 20948#: lazarusidestrconsts.lisutf8withbom 20949msgid "UTF-8 with BOM" 20950msgstr "" 20951 20952#: lazarusidestrconsts.lisvalue 20953msgctxt "lazarusidestrconsts.lisvalue" 20954msgid "Value" 20955msgstr "Valor" 20956 20957#: lazarusidestrconsts.lisvalue2 20958#, object-pascal-format 20959msgid "Value%s" 20960msgstr "" 20961 20962#: lazarusidestrconsts.lisvalue3 20963msgid "Value: " 20964msgstr "" 20965 20966#: lazarusidestrconsts.lisvalues 20967msgid "Values" 20968msgstr "" 20969 20970#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault 20971msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector." 20972msgstr "" 20973 20974#: lazarusidestrconsts.lisvariable 20975msgctxt "lazarusidestrconsts.lisvariable" 20976msgid "Variable" 20977msgstr "Variable" 20978 20979#: lazarusidestrconsts.lisverbose 20980msgctxt "lazarusidestrconsts.lisverbose" 20981msgid "Verbose" 20982msgstr "" 20983 20984#: lazarusidestrconsts.lisverifymethodcalls 20985msgid "Verify method calls" 20986msgstr "" 20987 20988#: lazarusidestrconsts.lisversion 20989msgid "Version" 20990msgstr "Versió" 20991 20992#: lazarusidestrconsts.lisversionmismatch 20993msgid "Version mismatch" 20994msgstr "" 20995 20996#: lazarusidestrconsts.lisvertical 20997msgid "Vertical" 20998msgstr "Vertical" 20999 21000#: lazarusidestrconsts.lisvertoclipboard 21001msgid "Copy version information to clipboard" 21002msgstr "" 21003 21004#: lazarusidestrconsts.lisveryverbose 21005msgid "Very Verbose" 21006msgstr "" 21007 21008#: lazarusidestrconsts.lisviewbreakpointproperties 21009msgctxt "lazarusidestrconsts.lisviewbreakpointproperties" 21010msgid "Breakpoint Properties ..." 21011msgstr "" 21012 21013#: lazarusidestrconsts.lisviewsource 21014msgid "View Source" 21015msgstr "" 21016 21017#: lazarusidestrconsts.lisviewsourcedisass 21018msgctxt "lazarusidestrconsts.lisviewsourcedisass" 21019msgid "View Assembler" 21020msgstr "" 21021 21022#: lazarusidestrconsts.lisviewsourcelfm 21023msgid "View Source (.lfm)" 21024msgstr "Vore font (.lfm)" 21025 21026#: lazarusidestrconsts.liswarning 21027msgid "Warning: " 21028msgstr "" 21029 21030#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis 21031#, object-pascal-format 21032msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\"" 21033msgstr "" 21034 21035#: lazarusidestrconsts.liswarnings 21036#, object-pascal-format 21037msgid ", Warnings: %s" 21038msgstr "" 21039 21040#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas 21041#, object-pascal-format 21042msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." 21043msgstr "" 21044 21045#: lazarusidestrconsts.liswatch 21046msgid "&Watch" 21047msgstr "" 21048 21049#: lazarusidestrconsts.liswatchdata 21050msgid "Watch:" 21051msgstr "" 21052 21053#: lazarusidestrconsts.liswatchkind 21054msgid "Watch action" 21055msgstr "" 21056 21057#: lazarusidestrconsts.liswatchkindread 21058msgid "Read" 21059msgstr "" 21060 21061#: lazarusidestrconsts.liswatchkindreadwrite 21062msgid "Read/Write" 21063msgstr "" 21064 21065#: lazarusidestrconsts.liswatchkindwrite 21066msgid "Write" 21067msgstr "" 21068 21069#: lazarusidestrconsts.liswatchpoint 21070msgid "&Data/Watch Breakpoint ..." 21071msgstr "" 21072 21073#: lazarusidestrconsts.liswatchpointbreakpoint 21074msgid "&Data/watch Breakpoint ..." 21075msgstr "" 21076 21077#: lazarusidestrconsts.liswatchpropert 21078msgid "Watch Properties" 21079msgstr "" 21080 21081#: lazarusidestrconsts.liswatchscope 21082msgid "Watch scope" 21083msgstr "" 21084 21085#: lazarusidestrconsts.liswatchscopeglobal 21086msgctxt "lazarusidestrconsts.liswatchscopeglobal" 21087msgid "Global" 21088msgstr "" 21089 21090#: lazarusidestrconsts.liswatchscopelocal 21091msgid "Declaration" 21092msgstr "" 21093 21094#: lazarusidestrconsts.liswatchtowatchpoint 21095msgid "Create &Data/Watch Breakpoint ..." 21096msgstr "" 21097 21098#: lazarusidestrconsts.liswelcometolazaruside 21099#, object-pascal-format 21100msgid "Welcome to Lazarus IDE %s" 21101msgstr "" 21102 21103#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve 21104#, object-pascal-format 21105msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" 21106msgstr "" 21107 21108#: lazarusidestrconsts.liswhatneedsbuilding 21109msgid "What needs building" 21110msgstr "" 21111 21112#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences 21113msgid "When a unit is renamed, update references" 21114msgstr "" 21115 21116#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew 21117msgid "When enabled the current options are saved to the template which is used when creating new projects" 21118msgstr "" 21119 21120#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed 21121msgid "When there is only one possible completion item use it immediately, without showing the completion box" 21122msgstr "" 21123 21124#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein 21125msgid "When the source editor cursor moves, show the current node in the code explorer" 21126msgstr "" 21127 21128#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform 21129msgid "Window menu shows designed form's name instead of caption" 21130msgstr "" 21131 21132#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint 21133msgid "Useful especially if the caption is left empty." 21134msgstr "" 21135 21136#: lazarusidestrconsts.liswindowstaysontop 21137msgid "Window stays on top" 21138msgstr "" 21139 21140#: lazarusidestrconsts.liswithincludes2 21141msgid ", with includes " 21142msgstr "" 21143 21144#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw 21145msgid "Without a proper compiler the code browsing and compiling will be disappointing." 21146msgstr "" 21147 21148#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing 21149msgid "Without a proper debugger, debugging will be disappointing." 21150msgstr "" 21151 21152#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn 21153msgid "Without a proper Lazarus directory you will get a lot of warnings." 21154msgstr "" 21155 21156#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis 21157msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." 21158msgstr "" 21159 21160#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio 21161msgid "Without the proper FPC sources code browsing and completion will be very limited." 21162msgstr "" 21163 21164#: lazarusidestrconsts.liswithrequiredpackages 21165msgid "With required packages" 21166msgstr "" 21167 21168#: lazarusidestrconsts.liswldeleteall 21169msgid "De&lete All" 21170msgstr "Esborra-ho tot" 21171 21172#: lazarusidestrconsts.liswldisableall 21173msgid "D&isable All" 21174msgstr "" 21175 21176#: lazarusidestrconsts.liswlenableall 21177msgid "E&nable All" 21178msgstr "" 21179 21180#: lazarusidestrconsts.liswlexpression 21181msgid "Expression" 21182msgstr "Expresió" 21183 21184#: lazarusidestrconsts.liswlinspectpane 21185msgid "Inspect pane" 21186msgstr "" 21187 21188#: lazarusidestrconsts.liswlproperties 21189msgid "&Properties" 21190msgstr "&Propietats" 21191 21192#: lazarusidestrconsts.liswlwatchlist 21193#, fuzzy 21194msgctxt "lazarusidestrconsts.liswlwatchlist" 21195msgid "Watches" 21196msgstr "Controls" 21197 21198#: lazarusidestrconsts.liswordatcursorincurrenteditor 21199msgid "Word at cursor in current editor" 21200msgstr "Paraula del cursor en l'editor actual" 21201 21202#: lazarusidestrconsts.lisworkingdirectoryforbuilding 21203msgid "Working directory for building" 21204msgstr "" 21205 21206#: lazarusidestrconsts.lisworkingdirectoryforrun 21207msgid "Working directory for run" 21208msgstr "" 21209 21210#: lazarusidestrconsts.liswriteerror 21211msgid "Write Error" 21212msgstr "S'ha produït un error d'escriptura" 21213 21214#: lazarusidestrconsts.liswriteerrorfile 21215#, object-pascal-format 21216msgid "Write error: %s%sFile: %s%s%s" 21217msgstr "" 21218 21219#: lazarusidestrconsts.liswritepackageinfofailed 21220msgid "Writing the package info file failed." 21221msgstr "" 21222 21223#: lazarusidestrconsts.liswriteprojectinfofailed 21224msgid "Writing the project info file failed." 21225msgstr "" 21226 21227#: lazarusidestrconsts.liswrongversionin 21228#, object-pascal-format 21229msgid "wrong version in %s: %s" 21230msgstr "" 21231 21232#: lazarusidestrconsts.lisxmlerror 21233msgid "XML Error" 21234msgstr "" 21235 21236#: lazarusidestrconsts.lisxmlparsererrorinfileerror 21237#, object-pascal-format 21238msgid "XML parser error in file %s%sError: %s" 21239msgstr "" 21240 21241#: lazarusidestrconsts.lisyes 21242msgid "Yes" 21243msgstr "" 21244 21245#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed 21246msgid "You can disable this for individual forms via the package editor" 21247msgstr "" 21248 21249#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu 21250msgid "You can disable this for individual forms via the popup menu in the project inspector" 21251msgstr "" 21252 21253#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor 21254msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" 21255msgstr "" 21256 21257#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling 21258#, fuzzy 21259#| msgid "You can not build lazarus while debugging or compiling." 21260msgid "You cannot build Lazarus while debugging or compiling." 21261msgstr "No podeu muntar el lazarus mentre s'està depurant o compilant." 21262 21263#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling 21264msgid "You cannot change the build mode while compiling." 21265msgstr "" 21266 21267#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter 21268msgid "You can select items by simply pressing underscored letters" 21269msgstr "" 21270 21271#: lazarusidestrconsts.lis_all_ 21272#, fuzzy 21273msgctxt "lazarusidestrconsts.lis_all_" 21274msgid "<All>" 21275msgstr "<Tot>" 21276 21277#: lazarusidestrconsts.locwndsrceditor 21278msgctxt "lazarusidestrconsts.locwndsrceditor" 21279msgid "Source Editor" 21280msgstr "Editor del codi font" 21281 21282#: lazarusidestrconsts.lrsplddeleteselected 21283msgid "Delete selected" 21284msgstr "" 21285 21286#: lazarusidestrconsts.lrspldinvalid 21287msgid "invalid" 21288msgstr "" 21289 21290#: lazarusidestrconsts.lrspldlpkfileinvalid 21291#, object-pascal-format 21292msgid "lpk file invalid (%s)" 21293msgstr "" 21294 21295#: lazarusidestrconsts.lrspldlpkfilevalid 21296#, object-pascal-format 21297msgid "lpk file valid (%s)" 21298msgstr "" 21299 21300#: lazarusidestrconsts.lrspldunabletodeletefile 21301#, object-pascal-format 21302msgid "Unable to delete file \"%s\"" 21303msgstr "" 21304 21305#: lazarusidestrconsts.lrspldvalid 21306msgid "valid" 21307msgstr "" 21308 21309#: lazarusidestrconsts.lrsrescanlplfiles 21310msgid "Rescan lpl files" 21311msgstr "" 21312 21313#: lazarusidestrconsts.lvlgraphaddhorizontalspacing 21314msgid "Add horizontal spacing between columns" 21315msgstr "" 21316 21317#: lazarusidestrconsts.lvlgraphaddverticalspacingar 21318msgid "Add vertical spacing around nodes" 21319msgstr "" 21320 21321#: lazarusidestrconsts.lvlgraphextraspacing 21322msgid "Extra spacing (x/y)" 21323msgstr "" 21324 21325#: lazarusidestrconsts.lvlgraphnamesabovenode 21326msgid "Names above node" 21327msgstr "" 21328 21329#: lazarusidestrconsts.lvlgraphoptabsolutelimi 21330msgid "Absolute limit for height of levels" 21331msgstr "" 21332 21333#: lazarusidestrconsts.lvlgraphoptcrossings 21334msgid "Crossings" 21335msgstr "" 21336 21337#: lazarusidestrconsts.lvlgraphoptedgelen 21338msgid "Edge len" 21339msgstr "" 21340 21341#: lazarusidestrconsts.lvlgraphoptedges 21342msgid "Edges" 21343msgstr "" 21344 21345#: lazarusidestrconsts.lvlgraphoptinfo 21346msgid "Info" 21347msgstr "" 21348 21349#: lazarusidestrconsts.lvlgraphoptlevels 21350msgctxt "lazarusidestrconsts.lvlgraphoptlevels" 21351msgid "Levels" 21352msgstr "" 21353 21354#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl 21355msgid "Limit height of Levels" 21356msgstr "" 21357 21358#: lazarusidestrconsts.lvlgraphoptlimitrelativ 21359#, object-pascal-format 21360msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))" 21361msgstr "" 21362 21363#: lazarusidestrconsts.lvlgraphoptsplitpoints 21364msgid "Splitpoints" 21365msgstr "" 21366 21367#: lazarusidestrconsts.lvlgraphreducebackedges 21368msgid "Reduce backedges" 21369msgstr "" 21370 21371#: lazarusidestrconsts.lvlgraphshapecalculatelay 21372msgid "Calculate layout from high-edge" 21373msgstr "" 21374 21375#: lazarusidestrconsts.lvlgraphshapecurved 21376msgid "Curved" 21377msgstr "" 21378 21379#: lazarusidestrconsts.lvlgraphshapeedgesshape 21380msgid "Edges shape" 21381msgstr "" 21382 21383#: lazarusidestrconsts.lvlgraphshapeedgessplitmo 21384msgid "Edges split mode" 21385msgstr "" 21386 21387#: lazarusidestrconsts.lvlgraphshapeminimizeedge 21388msgid "Minimize edges len" 21389msgstr "" 21390 21391#: lazarusidestrconsts.lvlgraphshapenodes 21392msgid "Nodes" 21393msgstr "" 21394 21395#: lazarusidestrconsts.lvlgraphshapestraight 21396msgid "Straight" 21397msgstr "" 21398 21399#: lazarusidestrconsts.lvlgraphsplitmergeathighe 21400msgid "Merge at highest" 21401msgstr "" 21402 21403#: lazarusidestrconsts.lvlgraphsplitmergeatsourc 21404msgid "Merge at source" 21405msgstr "" 21406 21407#: lazarusidestrconsts.lvlgraphsplitmergeattarge 21408msgid "Merge at target" 21409msgstr "" 21410 21411#: lazarusidestrconsts.lvlgraphsplitnone 21412#, fuzzy 21413msgctxt "lazarusidestrconsts.lvlgraphsplitnone" 21414msgid "None" 21415msgstr "Cap" 21416 21417#: lazarusidestrconsts.lvlgraphsplitseparate 21418msgid "Separate" 21419msgstr "" 21420 21421#: lazarusidestrconsts.lvlgraphstraightengraph 21422msgid "Straighten graph" 21423msgstr "" 21424 21425#: lazarusidestrconsts.podaddpackageunittousessection 21426msgid "Add package unit to uses section" 21427msgstr "" 21428 21429#: lazarusidestrconsts.regdlgbinary 21430msgctxt "lazarusidestrconsts.regdlgbinary" 21431msgid "Binary" 21432msgstr "Binari" 21433 21434#: lazarusidestrconsts.regdlgdecimal 21435msgctxt "lazarusidestrconsts.regdlgdecimal" 21436msgid "Decimal" 21437msgstr "" 21438 21439#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters 21440msgid "Display type for selected Registers" 21441msgstr "" 21442 21443#: lazarusidestrconsts.regdlgformat 21444msgid "Format" 21445msgstr "" 21446 21447#: lazarusidestrconsts.regdlghex 21448msgid "Hex" 21449msgstr "" 21450 21451#: lazarusidestrconsts.regdlgoctal 21452msgid "Octal" 21453msgstr "" 21454 21455#: lazarusidestrconsts.regdlgraw 21456msgid "Raw" 21457msgstr "" 21458 21459#: lazarusidestrconsts.rsaddinverse 21460msgid "Add Inverse" 21461msgstr "" 21462 21463#: lazarusidestrconsts.rsaddnewterm 21464msgid "Add new term" 21465msgstr "" 21466 21467#: lazarusidestrconsts.rsattachto 21468msgid "Attach to" 21469msgstr "" 21470 21471#: lazarusidestrconsts.rsattributes 21472msgid "Attributes" 21473msgstr "" 21474 21475#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber 21476msgid "Automatically increase build number" 21477msgstr "" 21478 21479#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint 21480msgid "Increased every time the project is compiled." 21481msgstr "" 21482 21483#: lazarusidestrconsts.rsbuild 21484msgid "&Build:" 21485msgstr "" 21486 21487#: lazarusidestrconsts.rscharacterset 21488msgid "Character set:" 21489msgstr "" 21490 21491#: lazarusidestrconsts.rscloseall 21492msgid "Close all pages" 21493msgstr "" 21494 21495#: lazarusidestrconsts.rsclosecurrentpage 21496msgid "Close current page" 21497msgstr "" 21498 21499#: lazarusidestrconsts.rscloseleft 21500msgid "Close page(s) on the left" 21501msgstr "" 21502 21503#: lazarusidestrconsts.rscloseothers 21504msgid "Close other page(s)" 21505msgstr "" 21506 21507#: lazarusidestrconsts.rscloseright 21508msgid "Close page(s) on the right" 21509msgstr "" 21510 21511#: lazarusidestrconsts.rsconditionaldefines 21512msgid "Conditional defines" 21513msgstr "" 21514 21515#: lazarusidestrconsts.rscreatenewdefine 21516msgid "Create new define" 21517msgstr "" 21518 21519#: lazarusidestrconsts.rsenablei18n 21520msgid "Enable i18n" 21521msgstr "" 21522 21523#: lazarusidestrconsts.rsenterpid 21524msgid "Enter PID" 21525msgstr "" 21526 21527#: lazarusidestrconsts.rsfilterthelistwithstring 21528msgid "Filter the lines in list with a string" 21529msgstr "" 21530 21531#: lazarusidestrconsts.rsfoundbutnotlistedhere 21532msgid "Found but not listed here: " 21533msgstr "" 21534 21535#: lazarusidestrconsts.rsi18nexcluded 21536msgid "Excluded" 21537msgstr "" 21538 21539#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild 21540msgid "Force update PO files on next build" 21541msgstr "" 21542 21543#: lazarusidestrconsts.rsi18nidentifiers 21544msgid "Identifiers:" 21545msgstr "" 21546 21547#: lazarusidestrconsts.rsi18noptions 21548msgid "i18n Options" 21549msgstr "" 21550 21551#: lazarusidestrconsts.rsi18noriginals 21552msgid "Originals:" 21553msgstr "" 21554 21555#: lazarusidestrconsts.rsincludeversioninfohint 21556msgid "Version info is stored if the executable format supports it." 21557msgstr "" 21558 21559#: lazarusidestrconsts.rsincludeversioninfoinexecutable 21560msgid "Include version info in executable" 21561msgstr "" 21562 21563#: lazarusidestrconsts.rslanguageafrikaans 21564msgid "Afrikaans" 21565msgstr "" 21566 21567#: lazarusidestrconsts.rslanguagearabic 21568msgid "Arabic" 21569msgstr "Aràbic" 21570 21571#: lazarusidestrconsts.rslanguageautomatic 21572#, fuzzy 21573#| msgid "Automatic (or english)" 21574msgid "Automatic (or English)" 21575msgstr "Automàtic (o Anglès)" 21576 21577#: lazarusidestrconsts.rslanguagecatalan 21578msgid "Catalan" 21579msgstr "Català" 21580 21581#: lazarusidestrconsts.rslanguagechinese 21582msgid "Chinese" 21583msgstr "Chinés" 21584 21585#: lazarusidestrconsts.rslanguageczech 21586msgid "Czech" 21587msgstr "" 21588 21589#: lazarusidestrconsts.rslanguagedutch 21590msgid "Dutch" 21591msgstr "Holandés" 21592 21593#: lazarusidestrconsts.rslanguageenglish 21594msgid "English" 21595msgstr "Anglès" 21596 21597#: lazarusidestrconsts.rslanguagefinnish 21598msgid "Finnish" 21599msgstr "Finlandès" 21600 21601#: lazarusidestrconsts.rslanguagefrench 21602msgid "French" 21603msgstr "Francès" 21604 21605#: lazarusidestrconsts.rslanguagegerman 21606msgid "German" 21607msgstr "Alemany" 21608 21609#: lazarusidestrconsts.rslanguagehebrew 21610msgid "Hebrew" 21611msgstr "Hebreu" 21612 21613#: lazarusidestrconsts.rslanguagehungarian 21614msgid "Hungarian" 21615msgstr "" 21616 21617#: lazarusidestrconsts.rslanguageindonesian 21618msgid "Indonesian" 21619msgstr "Indonés" 21620 21621#: lazarusidestrconsts.rslanguageitalian 21622msgid "Italian" 21623msgstr "Italià" 21624 21625#: lazarusidestrconsts.rslanguagejapanese 21626msgid "Japanese" 21627msgstr "Japonés" 21628 21629#: lazarusidestrconsts.rslanguagelithuanian 21630msgid "Lithuanian" 21631msgstr "" 21632 21633#: lazarusidestrconsts.rslanguageoptions 21634msgid "Language options" 21635msgstr "" 21636 21637#: lazarusidestrconsts.rslanguagepolish 21638msgid "Polish" 21639msgstr "Polonès" 21640 21641#: lazarusidestrconsts.rslanguageportuguese 21642msgid "Portuguese" 21643msgstr "" 21644 21645#: lazarusidestrconsts.rslanguageportuguesebr 21646msgid "Brazilian Portuguese" 21647msgstr "" 21648 21649#: lazarusidestrconsts.rslanguagerussian 21650msgid "Russian" 21651msgstr "Rus" 21652 21653#: lazarusidestrconsts.rslanguageselection 21654msgid "Language selection:" 21655msgstr "" 21656 21657#: lazarusidestrconsts.rslanguageslovak 21658msgid "Slovak" 21659msgstr "" 21660 21661#: lazarusidestrconsts.rslanguagespanish 21662msgid "Spanish" 21663msgstr "Espanyol" 21664 21665#: lazarusidestrconsts.rslanguageturkish 21666msgid "Turkish" 21667msgstr "" 21668 21669#: lazarusidestrconsts.rslanguageukrainian 21670msgid "Ukrainian" 21671msgstr "Ucrainés" 21672 21673#: lazarusidestrconsts.rsmajorversion 21674msgid "&Major version:" 21675msgstr "" 21676 21677#: lazarusidestrconsts.rsminorversion 21678msgid "Mi&nor version:" 21679msgstr "" 21680 21681#: lazarusidestrconsts.rsnewsearchwithsamecriteria 21682msgid "New search with same criteria" 21683msgstr "" 21684 21685#: lazarusidestrconsts.rsotherinfo 21686msgid "Other info" 21687msgstr "" 21688 21689#: lazarusidestrconsts.rspooutputdirectory 21690msgid "PO Output Directory:" 21691msgstr "" 21692 21693#: lazarusidestrconsts.rsrefreshthesearch 21694msgid "Refresh the search" 21695msgstr "" 21696 21697#: lazarusidestrconsts.rsresource 21698msgid "Resource" 21699msgstr "" 21700 21701#: lazarusidestrconsts.rsresourceclear 21702msgid "Delete all resources?" 21703msgstr "" 21704 21705#: lazarusidestrconsts.rsresourcefilename 21706msgid "File name" 21707msgstr "" 21708 21709#: lazarusidestrconsts.rsresourcetype 21710msgctxt "lazarusidestrconsts.rsresourcetype" 21711msgid "Type" 21712msgstr "Tipus" 21713 21714#: lazarusidestrconsts.rsrevision 21715msgid "&Revision:" 21716msgstr "" 21717 21718#: lazarusidestrconsts.rsselectaninheritedentry 21719msgid "Select an inherited entry" 21720msgstr "" 21721 21722#: lazarusidestrconsts.rsversionnumbering 21723msgid "Version numbering" 21724msgstr "" 21725 21726#: lazarusidestrconsts.showoptions 21727msgid "Show options" 21728msgstr "" 21729 21730#: lazarusidestrconsts.srkmcarhelpmenu 21731msgid "Help menu commands" 21732msgstr "Ordres del menú de l'ajuda" 21733 21734#: lazarusidestrconsts.srkmcatcmdcmd 21735msgid "Command commands" 21736msgstr "Ordres de les instruccions" 21737 21738#: lazarusidestrconsts.srkmcatcodetools 21739msgid "CodeTools commands" 21740msgstr "Ordres de les eines del codi" 21741 21742#: lazarusidestrconsts.srkmcatcolselection 21743msgid "Text column selection commands" 21744msgstr "" 21745 21746#: lazarusidestrconsts.srkmcatcursormoving 21747msgid "Cursor moving commands" 21748msgstr "Ordres de moviment del cursor" 21749 21750#: lazarusidestrconsts.srkmcatediting 21751msgid "Text editing commands" 21752msgstr "Ordres d'edició del text" 21753 21754#: lazarusidestrconsts.srkmcatfilemenu 21755msgid "File menu commands" 21756msgstr "Ordres de menús dels fitxers" 21757 21758#: lazarusidestrconsts.srkmcatfold 21759msgid "Text folding commands" 21760msgstr "" 21761 21762#: lazarusidestrconsts.srkmcatmacrorecording 21763msgctxt "lazarusidestrconsts.srkmcatmacrorecording" 21764msgid "Macros" 21765msgstr "Macroinstruccions" 21766 21767#: lazarusidestrconsts.srkmcatmarker 21768#, fuzzy 21769#| msgid "Text marker commands" 21770msgid "Text bookmark commands" 21771msgstr "Ordres de marcadors del text" 21772 21773#: lazarusidestrconsts.srkmcatmulticaret 21774msgid "Multi caret commands" 21775msgstr "" 21776 21777#: lazarusidestrconsts.srkmcatpackagemenu 21778msgid "Package menu commands" 21779msgstr "" 21780 21781#: lazarusidestrconsts.srkmcatprojectmenu 21782msgid "Project menu commands" 21783msgstr "Ordres del menú del projecte" 21784 21785#: lazarusidestrconsts.srkmcatrunmenu 21786msgid "Run menu commands" 21787msgstr "Ordres del menú d'execució" 21788 21789#: lazarusidestrconsts.srkmcatsearchreplace 21790msgid "Text search and replace commands" 21791msgstr "Ordres de recerca i reemplaçament del text" 21792 21793#: lazarusidestrconsts.srkmcatselection 21794msgid "Text selection commands" 21795msgstr "Ordres de selecció del text" 21796 21797#: lazarusidestrconsts.srkmcatsrcnotebook 21798msgid "Source Notebook commands" 21799msgstr "Ordres del llibre del codi font" 21800 21801#: lazarusidestrconsts.srkmcatsyncroedit 21802msgid "Syncron Editing" 21803msgstr "" 21804 21805#: lazarusidestrconsts.srkmcatsyncroeditoff 21806msgid "Syncron Editing (not in Cell)" 21807msgstr "" 21808 21809#: lazarusidestrconsts.srkmcatsyncroeditsel 21810msgid "Syncron Editing (while selecting)" 21811msgstr "" 21812 21813#: lazarusidestrconsts.srkmcattemplateedit 21814msgid "Template Editing" 21815msgstr "" 21816 21817#: lazarusidestrconsts.srkmcattemplateeditoff 21818msgid "Template Editing (not in Cell)" 21819msgstr "" 21820 21821#: lazarusidestrconsts.srkmcattoolmenu 21822msgid "Tools menu commands" 21823msgstr "Ordres del menú de les eines" 21824 21825#: lazarusidestrconsts.srkmcatviewmenu 21826msgid "View menu commands" 21827msgstr "Mostra les ordres del menú" 21828 21829#: lazarusidestrconsts.srkmcommand 21830msgctxt "lazarusidestrconsts.srkmcommand" 21831msgid "Command:" 21832msgstr "Ordre:" 21833 21834#: lazarusidestrconsts.srkmconflic 21835msgid "Conflict " 21836msgstr "Conflicte" 21837 21838#: lazarusidestrconsts.srkmecabortbuild 21839msgid "abort build" 21840msgstr "avorta el muntatje" 21841 21842#: lazarusidestrconsts.srkmecabstractmethods 21843msgid "Abstract Methods ..." 21844msgstr "" 21845 21846#: lazarusidestrconsts.srkmecaddbpaddress 21847msgid "add address breakpoint" 21848msgstr "" 21849 21850#: lazarusidestrconsts.srkmecaddbpsource 21851msgid "add source breakpoint" 21852msgstr "" 21853 21854#: lazarusidestrconsts.srkmecaddbpwatchpoint 21855msgid "add data/watchpoint" 21856msgstr "" 21857 21858#: lazarusidestrconsts.srkmecaddjumppoint 21859#, fuzzy 21860#| msgid "Add jump point" 21861msgid "Add Jump Point" 21862msgstr "Afegeix un punt de salt" 21863 21864#: lazarusidestrconsts.srkmecaddwatch 21865msgid "add watch" 21866msgstr "afegeix un control" 21867 21868#: lazarusidestrconsts.srkmecattach 21869msgid "Attach to program" 21870msgstr "" 21871 21872#: lazarusidestrconsts.srkmecautocompletion 21873msgid "Code template completion" 21874msgstr "Completa la plantilla del codi" 21875 21876#: lazarusidestrconsts.srkmecblockcopy 21877msgid "Copy Block" 21878msgstr "" 21879 21880#: lazarusidestrconsts.srkmecblockdelete 21881msgid "Delete Block" 21882msgstr "" 21883 21884#: lazarusidestrconsts.srkmecblockgotobegin 21885msgid "Goto Block begin" 21886msgstr "" 21887 21888#: lazarusidestrconsts.srkmecblockgotoend 21889msgid "Goto Block end" 21890msgstr "" 21891 21892#: lazarusidestrconsts.srkmecblockhide 21893msgid "Hide Block" 21894msgstr "" 21895 21896#: lazarusidestrconsts.srkmecblockindent 21897msgid "Indent block" 21898msgstr "Sagna el bloc" 21899 21900#: lazarusidestrconsts.srkmecblockmove 21901msgid "Move Block" 21902msgstr "" 21903 21904#: lazarusidestrconsts.srkmecblocksetbegin 21905msgid "Set block begin" 21906msgstr "" 21907 21908#: lazarusidestrconsts.srkmecblocksetend 21909msgid "Set block end" 21910msgstr "" 21911 21912#: lazarusidestrconsts.srkmecblockshow 21913msgid "Show Block" 21914msgstr "" 21915 21916#: lazarusidestrconsts.srkmecblocktogglehide 21917msgid "Toggle block" 21918msgstr "" 21919 21920#: lazarusidestrconsts.srkmecblockunindent 21921msgid "Unindent block" 21922msgstr "Dessagna el bloc" 21923 21924#: lazarusidestrconsts.srkmecbuild 21925msgid "build program/project" 21926msgstr "munta el programa/projecte" 21927 21928#: lazarusidestrconsts.srkmecbuildfile 21929msgid "build file" 21930msgstr "munta el fitxer" 21931 21932#: lazarusidestrconsts.srkmecbuildlazarus 21933#, fuzzy 21934#| msgid "Build lazarus" 21935msgid "Build Lazarus" 21936msgstr "Munta el Lazarus" 21937 21938#: lazarusidestrconsts.srkmecbuildmanymodes 21939msgid "build many modes" 21940msgstr "" 21941 21942#: lazarusidestrconsts.srkmecchar 21943msgid "Char" 21944msgstr "Caràcter" 21945 21946#: lazarusidestrconsts.srkmeccleanupandbuild 21947msgid "clean up and build" 21948msgstr "" 21949 21950#: lazarusidestrconsts.srkmecclearall 21951msgid "Delete whole text" 21952msgstr "Elimina tot el text" 21953 21954#: lazarusidestrconsts.srkmecclearallbookmark 21955msgid "Clear all Bookmarks" 21956msgstr "" 21957 21958#: lazarusidestrconsts.srkmecclearbookmarkforfile 21959msgid "Clear Bookmarks for current file" 21960msgstr "" 21961 21962#: lazarusidestrconsts.srkmeccolseldown 21963msgid "Column Select Down" 21964msgstr "" 21965 21966#: lazarusidestrconsts.srkmeccolseleditorbottom 21967msgid "Column Select to absolute end" 21968msgstr "" 21969 21970#: lazarusidestrconsts.srkmeccolseleditortop 21971msgid "Column Select to absolute beginning" 21972msgstr "" 21973 21974#: lazarusidestrconsts.srkmeccolselleft 21975msgid "Column Select Left" 21976msgstr "" 21977 21978#: lazarusidestrconsts.srkmeccolsellineend 21979msgid "Column Select Line End" 21980msgstr "" 21981 21982#: lazarusidestrconsts.srkmeccolsellinestart 21983msgid "Column Select Line Start" 21984msgstr "" 21985 21986#: lazarusidestrconsts.srkmeccolsellinetextstart 21987msgid "Column Select to text start in line" 21988msgstr "" 21989 21990#: lazarusidestrconsts.srkmeccolselpagebottom 21991msgid "Column Select Page Bottom" 21992msgstr "" 21993 21994#: lazarusidestrconsts.srkmeccolselpagedown 21995msgid "Column Select Page Down" 21996msgstr "" 21997 21998#: lazarusidestrconsts.srkmeccolselpagetop 21999msgid "Column Select Page Top" 22000msgstr "" 22001 22002#: lazarusidestrconsts.srkmeccolselpageup 22003msgid "Column Select Page Up" 22004msgstr "" 22005 22006#: lazarusidestrconsts.srkmeccolselright 22007msgid "Column Select Right" 22008msgstr "" 22009 22010#: lazarusidestrconsts.srkmeccolselup 22011msgid "Column Select Up" 22012msgstr "" 22013 22014#: lazarusidestrconsts.srkmeccolselwordleft 22015msgid "Column Select Word Left" 22016msgstr "" 22017 22018#: lazarusidestrconsts.srkmeccolselwordright 22019msgid "Column Select Word Right" 22020msgstr "" 22021 22022#: lazarusidestrconsts.srkmeccolumnselect 22023msgid "Column selection mode" 22024msgstr "Mode de selecció de columna" 22025 22026#: lazarusidestrconsts.srkmeccompile 22027msgid "compile program/project" 22028msgstr "" 22029 22030#: lazarusidestrconsts.srkmecconfigbuildfile 22031msgid "config build file" 22032msgstr "fitxer de configuració del muntatje" 22033 22034#: lazarusidestrconsts.srkmeccopy 22035#, fuzzy 22036#| msgid "Copy selection to clipboard" 22037msgctxt "lazarusidestrconsts.srkmeccopy" 22038msgid "Copy" 22039msgstr "Copia la selecció al porta-retalls" 22040 22041#: lazarusidestrconsts.srkmeccopyadd 22042msgid "Copy (Add to Clipboard)" 22043msgstr "" 22044 22045#: lazarusidestrconsts.srkmeccopyaddcurrentline 22046msgid "Copy current line (Add to Clipboard)" 22047msgstr "" 22048 22049#: lazarusidestrconsts.srkmeccopycurrentline 22050msgid "Copy current line" 22051msgstr "" 22052 22053#: lazarusidestrconsts.srkmeccopyeditornewwindow 22054msgid "Copy editor to new window" 22055msgstr "" 22056 22057#: lazarusidestrconsts.srkmeccopyeditornextwindow 22058msgid "Copy editor to next free window" 22059msgstr "" 22060 22061#: lazarusidestrconsts.srkmeccopyeditorprevwindow 22062msgid "Copy editor to prior free window" 22063msgstr "" 22064 22065#: lazarusidestrconsts.srkmeccut 22066#, fuzzy 22067#| msgid "Cut selection to clipboard" 22068msgctxt "lazarusidestrconsts.srkmeccut" 22069msgid "Cut" 22070msgstr "Retalla la selecció al porta-retalls" 22071 22072#: lazarusidestrconsts.srkmeccutadd 22073msgid "Cut (Add to Clipboard)" 22074msgstr "" 22075 22076#: lazarusidestrconsts.srkmeccutaddcurrentline 22077msgid "Cut current line (Add to Clipboard)" 22078msgstr "" 22079 22080#: lazarusidestrconsts.srkmeccutcurrentline 22081msgid "Cut current line" 22082msgstr "" 22083 22084#: lazarusidestrconsts.srkmecdeletebol 22085msgid "Delete to beginning of line" 22086msgstr "Elimina fins al començament de la línia" 22087 22088#: lazarusidestrconsts.srkmecdeletechar 22089msgid "Delete char at cursor" 22090msgstr "Elimina el caràcter al cursor" 22091 22092#: lazarusidestrconsts.srkmecdeleteeol 22093msgid "Delete to end of line" 22094msgstr "Elimina fins al final de la línia" 22095 22096#: lazarusidestrconsts.srkmecdeletelastchar 22097msgid "Delete Last Char" 22098msgstr "Elimina l'últim caràcter" 22099 22100#: lazarusidestrconsts.srkmecdeletelastword 22101msgid "Delete to start of word" 22102msgstr "Elimina fins el principi de la paraula" 22103 22104#: lazarusidestrconsts.srkmecdeleteline 22105msgid "Delete current line" 22106msgstr "Elimina la línia actual" 22107 22108#: lazarusidestrconsts.srkmecdeleteword 22109msgid "Delete to end of word" 22110msgstr "Elimina fins al final de la paraula" 22111 22112#: lazarusidestrconsts.srkmecdetach 22113msgid "Detach from program" 22114msgstr "" 22115 22116#: lazarusidestrconsts.srkmecdiff 22117msgctxt "lazarusidestrconsts.srkmecdiff" 22118msgid "Diff" 22119msgstr "Mostra les diferències" 22120 22121#: lazarusidestrconsts.srkmecdown 22122msgid "Move cursor down" 22123msgstr "" 22124 22125#: lazarusidestrconsts.srkmecduplicateline 22126msgid "Duplicate line (or lines in selection)" 22127msgstr "" 22128 22129#: lazarusidestrconsts.srkmecduplicateselection 22130msgid "Duplicate selection" 22131msgstr "" 22132 22133#: lazarusidestrconsts.srkmeceditorbottom 22134msgid "Move cursor to absolute end" 22135msgstr "Mou el cursor al final de tot" 22136 22137#: lazarusidestrconsts.srkmeceditortop 22138msgid "Move cursor to absolute beginning" 22139msgstr "Mou el cursor al principi de tot" 22140 22141#: lazarusidestrconsts.srkmecemptymethods 22142msgid "Empty Methods ..." 22143msgstr "" 22144 22145#: lazarusidestrconsts.srkmecenvironmentoptions 22146msgid "IDE options" 22147msgstr "" 22148 22149#: lazarusidestrconsts.srkmecevaluate 22150msgid "evaluate/modify" 22151msgstr "avalua/modifica" 22152 22153#: lazarusidestrconsts.srkmecextractproc 22154#, fuzzy 22155#| msgid "Extract procedure" 22156msgctxt "lazarusidestrconsts.srkmecextractproc" 22157msgid "Extract Procedure" 22158msgstr "Extrau el procediment" 22159 22160#: lazarusidestrconsts.srkmecexttool 22161#, object-pascal-format 22162msgid "External tool %d" 22163msgstr "Eina externa %d" 22164 22165#: lazarusidestrconsts.srkmecexttoolsettings 22166msgid "External tools settings" 22167msgstr "Paràmetres de les eines externes" 22168 22169#: lazarusidestrconsts.srkmecfind 22170#, fuzzy 22171#| msgid "Find text" 22172msgid "Find Text" 22173msgstr "Cerca el text" 22174 22175#: lazarusidestrconsts.srkmecfindblockotherend 22176msgid "Find block other end" 22177msgstr "Cerca l'altre cap del bloc" 22178 22179#: lazarusidestrconsts.srkmecfindblockstart 22180msgid "Find block start" 22181msgstr "Cerca l'inici del bloc" 22182 22183#: lazarusidestrconsts.srkmecfinddeclaration 22184#, fuzzy 22185#| msgid "Find declaration" 22186msgid "Find Declaration" 22187msgstr "Cerca la declaració" 22188 22189#: lazarusidestrconsts.srkmecfindidentifierrefs 22190#, fuzzy 22191#| msgid "Find identifier references" 22192msgid "Find Identifier References" 22193msgstr "Cerca les referències de l'identificador" 22194 22195#: lazarusidestrconsts.srkmecfindinfiles 22196#, fuzzy 22197#| msgid "Find in files" 22198msgid "Find in Files" 22199msgstr "Cerca en els fitxers" 22200 22201#: lazarusidestrconsts.srkmecfindnext 22202#, fuzzy 22203#| msgid "Find next" 22204msgctxt "lazarusidestrconsts.srkmecfindnext" 22205msgid "Find Next" 22206msgstr "Cerca el següent" 22207 22208#: lazarusidestrconsts.srkmecfindnextwordoccurrence 22209#, fuzzy 22210#| msgid "Find next word occurrence" 22211msgid "Find Next Word Occurrence" 22212msgstr "Cerca següent ocurrència de la paraula" 22213 22214#: lazarusidestrconsts.srkmecfindoverloads 22215msgid "Find Overloads" 22216msgstr "" 22217 22218#: lazarusidestrconsts.srkmecfindoverloadscapt 22219msgid "Find Overloads ..." 22220msgstr "" 22221 22222#: lazarusidestrconsts.srkmecfindprevious 22223#, fuzzy 22224#| msgid "Find previous" 22225msgid "Find Previous" 22226msgstr "Cerca l'anterior" 22227 22228#: lazarusidestrconsts.srkmecfindprevwordoccurrence 22229#, fuzzy 22230#| msgid "Find previous word occurrence" 22231msgid "Find Previous Word Occurrence" 22232msgstr "Cerca ocurrència prèvia de la paraula" 22233 22234#: lazarusidestrconsts.srkmecfindproceduredefinition 22235#, fuzzy 22236#| msgid "Find procedure definiton" 22237msgid "Find Procedure Definiton" 22238msgstr "Cerca la definició del procediment" 22239 22240#: lazarusidestrconsts.srkmecfindproceduremethod 22241#, fuzzy 22242#| msgid "Find procedure method" 22243msgid "Find Procedure Method" 22244msgstr "Cerca el mètode del procediment" 22245 22246#: lazarusidestrconsts.srkmecfoldcurrent 22247msgid "Fold at Cursor" 22248msgstr "" 22249 22250#: lazarusidestrconsts.srkmecfoldlevel 22251#, object-pascal-format 22252msgid "Fold to Level %d" 22253msgstr "" 22254 22255#: lazarusidestrconsts.srkmecgotoeditor 22256#, object-pascal-format 22257msgid "Go to editor %d" 22258msgstr "Vés a l'editor %d" 22259 22260#: lazarusidestrconsts.srkmecgotoincludedirective 22261#, fuzzy 22262#| msgid "Go to to include directive of current include file" 22263msgid "Go to include directive of current include file" 22264msgstr "Vés a la directiva include del fitxer inclòs actual" 22265 22266#: lazarusidestrconsts.srkmecgotolinenumber 22267#, fuzzy 22268#| msgid "Go to line number" 22269msgid "Go to Line Number" 22270msgstr "Vés a la línia número" 22271 22272#: lazarusidestrconsts.srkmecgotomarker 22273#, object-pascal-format, fuzzy 22274#| msgid "Go to Marker %d" 22275msgid "Go to bookmark %d" 22276msgstr "Vés al marcador %d" 22277 22278#: lazarusidestrconsts.srkmecgotoxy 22279msgid "Goto XY" 22280msgstr "Vés a XY" 22281 22282#: lazarusidestrconsts.srkmecguessmisplacedifdef 22283#, fuzzy 22284#| msgid "Guess misplaced $IFDEF" 22285msgid "Guess Misplaced $IFDEF" 22286msgstr "Suposa $IFDEF inexistent" 22287 22288#: lazarusidestrconsts.srkmechalfwordleft 22289msgid "Move cursor part-word left (e.g. CamelCase)" 22290msgstr "" 22291 22292#: lazarusidestrconsts.srkmechalfwordright 22293msgid "Move cursor part-word right (e.g. CamelCase)" 22294msgstr "" 22295 22296#: lazarusidestrconsts.srkmecimestr 22297msgid "Ime Str" 22298msgstr "Ime Str" 22299 22300#: lazarusidestrconsts.srkmecinsertchangelogentry 22301msgid "Insert ChangeLog entry" 22302msgstr "Insereix entrada de registres de canvis" 22303 22304#: lazarusidestrconsts.srkmecinsertcharacter 22305msgid "Insert from Charactermap" 22306msgstr "Insereix desde el mapa de caràcters" 22307 22308#: lazarusidestrconsts.srkmecinsertcvsauthor 22309msgid "Insert CVS keyword Author" 22310msgstr "Insereix paraula clau CVS Author" 22311 22312#: lazarusidestrconsts.srkmecinsertcvsdate 22313msgid "Insert CVS keyword Date" 22314msgstr "Insereix paraula clau CVS Date" 22315 22316#: lazarusidestrconsts.srkmecinsertcvsheader 22317msgid "Insert CVS keyword Header" 22318msgstr "Insereix paraula clau CVS Header" 22319 22320#: lazarusidestrconsts.srkmecinsertcvsid 22321msgid "Insert CVS keyword ID" 22322msgstr "Insereix paraula clau CVS ID" 22323 22324#: lazarusidestrconsts.srkmecinsertcvslog 22325msgid "Insert CVS keyword Log" 22326msgstr "Insereix paraula clau CVS Log" 22327 22328#: lazarusidestrconsts.srkmecinsertcvsname 22329msgid "Insert CVS keyword Name" 22330msgstr "Insereix paraula clau CVS Name" 22331 22332#: lazarusidestrconsts.srkmecinsertcvsrevision 22333msgid "Insert CVS keyword Revision" 22334msgstr "Insereix paraula clau CVS Revision" 22335 22336#: lazarusidestrconsts.srkmecinsertcvssource 22337msgid "Insert CVS keyword Source" 22338msgstr "Insereix paraula clau CVS Source" 22339 22340#: lazarusidestrconsts.srkmecinsertdatetime 22341msgid "Insert current date and time" 22342msgstr "Insereix data i hora actuals" 22343 22344#: lazarusidestrconsts.srkmecinsertfilename 22345msgid "Insert Full Filename" 22346msgstr "" 22347 22348#: lazarusidestrconsts.srkmecinsertgplnotice 22349msgid "Insert GPL notice" 22350msgstr "Insereix comentari GPL" 22351 22352#: lazarusidestrconsts.srkmecinsertgplnoticetranslated 22353msgid "Insert GPL notice (translated)" 22354msgstr "" 22355 22356#: lazarusidestrconsts.srkmecinsertguid 22357msgid "Insert a GUID" 22358msgstr "" 22359 22360#: lazarusidestrconsts.srkmecinsertlgplnotice 22361msgid "Insert LGPL notice" 22362msgstr "Insereix comentari LGPL" 22363 22364#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated 22365msgid "Insert LGPL notice (translated)" 22366msgstr "" 22367 22368#: lazarusidestrconsts.srkmecinsertline 22369msgid "Break line, leave cursor" 22370msgstr "Interromp la línia, deixa el cursor" 22371 22372#: lazarusidestrconsts.srkmecinsertmitnotice 22373msgid "Insert MIT notice" 22374msgstr "" 22375 22376#: lazarusidestrconsts.srkmecinsertmitnoticetranslated 22377msgid "Insert MIT notice (translated)" 22378msgstr "" 22379 22380#: lazarusidestrconsts.srkmecinsertmode 22381msgid "Insert Mode" 22382msgstr "Mode inserir" 22383 22384#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice 22385msgid "Insert modified LGPL notice" 22386msgstr "" 22387 22388#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated 22389msgid "Insert modified LGPL notice (translated)" 22390msgstr "" 22391 22392#: lazarusidestrconsts.srkmecinsertusername 22393msgid "Insert current username" 22394msgstr "Insereix nom d'usuari actual" 22395 22396#: lazarusidestrconsts.srkmecinspect 22397msgid "inspect" 22398msgstr "inspeccionar" 22399 22400#: lazarusidestrconsts.srkmecinvertassignment 22401#, fuzzy 22402#| msgid "Invert assignment" 22403msgctxt "lazarusidestrconsts.srkmecinvertassignment" 22404msgid "Invert Assignment" 22405msgstr "Inverteix l'assignació" 22406 22407#: lazarusidestrconsts.srkmeckeymapleft 22408#, fuzzy 22409msgctxt "lazarusidestrconsts.srkmeckeymapleft" 22410msgid "Left" 22411msgstr "Esquerra" 22412 22413#: lazarusidestrconsts.srkmeckeymapright 22414#, fuzzy 22415msgctxt "lazarusidestrconsts.srkmeckeymapright" 22416msgid "Right" 22417msgstr "Dreta" 22418 22419#: lazarusidestrconsts.srkmecleft 22420msgid "Move cursor left" 22421msgstr "" 22422 22423#: lazarusidestrconsts.srkmeclinebreak 22424msgid "Break line and move cursor" 22425msgstr "Interromp la línia i mou el cursor" 22426 22427#: lazarusidestrconsts.srkmeclineend 22428msgid "Move cursor to line end" 22429msgstr "Mou el cursor al final de la línia" 22430 22431#: lazarusidestrconsts.srkmeclineselect 22432msgid "Line selection mode" 22433msgstr "Mode de selecció de línia" 22434 22435#: lazarusidestrconsts.srkmeclinestart 22436msgid "Move cursor to line start" 22437msgstr "Mou el cursor al principi de la línia" 22438 22439#: lazarusidestrconsts.srkmeclinetextstart 22440msgid "Move cursor to text start in line" 22441msgstr "" 22442 22443#: lazarusidestrconsts.srkmeclockeditor 22444msgid "Lock Editor" 22445msgstr "" 22446 22447#: lazarusidestrconsts.srkmecmakeresourcestring 22448#, fuzzy 22449#| msgid "Make resource string" 22450msgid "Make Resource String" 22451msgstr "Fes cadena del recurs" 22452 22453#: lazarusidestrconsts.srkmecmatchbracket 22454msgid "Go to matching bracket" 22455msgstr "Vés al claudàtor coincident" 22456 22457#: lazarusidestrconsts.srkmecmoveeditorleft 22458msgid "Move editor left" 22459msgstr "Mou l'editor a l'esquerra" 22460 22461#: lazarusidestrconsts.srkmecmoveeditorleftmost 22462msgid "Move editor leftmost" 22463msgstr "" 22464 22465#: lazarusidestrconsts.srkmecmoveeditornewwindow 22466msgid "Move editor to new window" 22467msgstr "" 22468 22469#: lazarusidestrconsts.srkmecmoveeditornextwindow 22470msgid "Move editor to next free window" 22471msgstr "" 22472 22473#: lazarusidestrconsts.srkmecmoveeditorprevwindow 22474msgid "Move editor to prior free window" 22475msgstr "" 22476 22477#: lazarusidestrconsts.srkmecmoveeditorright 22478msgid "Move editor right" 22479msgstr "Mou l'editor a la dreta" 22480 22481#: lazarusidestrconsts.srkmecmoveeditorrightmost 22482msgid "Move editor rightmost" 22483msgstr "" 22484 22485#: lazarusidestrconsts.srkmecmovelinedown 22486msgid "Move line down" 22487msgstr "" 22488 22489#: lazarusidestrconsts.srkmecmovelineup 22490msgid "Move line up" 22491msgstr "" 22492 22493#: lazarusidestrconsts.srkmecmoveselectdown 22494msgid "Move selection down" 22495msgstr "" 22496 22497#: lazarusidestrconsts.srkmecmoveselectleft 22498msgid "Move selection left" 22499msgstr "" 22500 22501#: lazarusidestrconsts.srkmecmoveselectright 22502msgid "Move selection right" 22503msgstr "" 22504 22505#: lazarusidestrconsts.srkmecmoveselectup 22506msgid "Move selection up" 22507msgstr "" 22508 22509#: lazarusidestrconsts.srkmecmultipaste 22510msgctxt "lazarusidestrconsts.srkmecmultipaste" 22511msgid "MultiPaste" 22512msgstr "" 22513 22514#: lazarusidestrconsts.srkmecnextbookmark 22515msgid "Next Bookmark" 22516msgstr "Següent Marcador" 22517 22518#: lazarusidestrconsts.srkmecnexteditor 22519msgid "Go to next editor" 22520msgstr "Vés al següent editor" 22521 22522#: lazarusidestrconsts.srkmecnexteditorinhistory 22523msgid "Go to next editor in history" 22524msgstr "" 22525 22526#: lazarusidestrconsts.srkmecnextsharededitor 22527msgid "Go to next editor with same Source" 22528msgstr "" 22529 22530#: lazarusidestrconsts.srkmecnextwindow 22531msgid "Go to next window" 22532msgstr "" 22533 22534#: lazarusidestrconsts.srkmecnormalselect 22535msgid "Normal selection mode" 22536msgstr "Mode de selecció normal" 22537 22538#: lazarusidestrconsts.srkmecopenfileatcursor 22539#, fuzzy 22540#| msgid "Open file at cursor" 22541msgid "Open File at Cursor" 22542msgstr "Obre el fitxer al cursor" 22543 22544#: lazarusidestrconsts.srkmecoverwritemode 22545msgid "Overwrite Mode" 22546msgstr "Mode substituir" 22547 22548#: lazarusidestrconsts.srkmecpagebottom 22549msgid "Move cursor to bottom of page" 22550msgstr "Mou el cursor al final de la pàgina" 22551 22552#: lazarusidestrconsts.srkmecpagedown 22553msgid "Move cursor down one page" 22554msgstr "Mou el cursor una pàgina avall" 22555 22556#: lazarusidestrconsts.srkmecpageleft 22557msgid "Move cursor left one page" 22558msgstr "Mou el cursor una pàgina a l'esquerra" 22559 22560#: lazarusidestrconsts.srkmecpageright 22561msgid "Move cursor right one page" 22562msgstr "Mou el cursor una pàgina a la dreta" 22563 22564#: lazarusidestrconsts.srkmecpagetop 22565msgid "Move cursor to top of page" 22566msgstr "Mou el cursor a l'inici de la pàgina" 22567 22568#: lazarusidestrconsts.srkmecpageup 22569msgid "Move cursor up one page" 22570msgstr "Mou el cursor una pàgina amunt" 22571 22572#: lazarusidestrconsts.srkmecpaste 22573#, fuzzy 22574#| msgid "Paste clipboard to current position" 22575msgctxt "lazarusidestrconsts.srkmecpaste" 22576msgid "Paste" 22577msgstr "Enganxa el porta-retalls a la posició actual" 22578 22579#: lazarusidestrconsts.srkmecpasteascolumns 22580msgid "Paste (as Columns)" 22581msgstr "" 22582 22583#: lazarusidestrconsts.srkmecpause 22584msgid "pause program" 22585msgstr "pausa el programa" 22586 22587#: lazarusidestrconsts.srkmecpluginmulticaretclearall 22588msgid "Clear all extra carets" 22589msgstr "" 22590 22591#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove 22592msgid "Cursor keys clear all extra carets" 22593msgstr "" 22594 22595#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall 22596msgid "Cursor keys move all extra carets" 22597msgstr "" 22598 22599#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret 22600msgid "Add extra caret" 22601msgstr "" 22602 22603#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret 22604msgid "Toggle extra caret" 22605msgstr "" 22606 22607#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret 22608msgid "Remove extra caret" 22609msgstr "" 22610 22611#: lazarusidestrconsts.srkmecprevbookmark 22612msgid "Previous Bookmark" 22613msgstr "Marcador Previ" 22614 22615#: lazarusidestrconsts.srkmecpreveditor 22616msgid "Go to prior editor" 22617msgstr "Vés a l'editor anterior" 22618 22619#: lazarusidestrconsts.srkmecpreveditorinhistory 22620msgid "Go to previous editor in history" 22621msgstr "" 22622 22623#: lazarusidestrconsts.srkmecprevsharededitor 22624msgid "Go to prior editor with same Source" 22625msgstr "" 22626 22627#: lazarusidestrconsts.srkmecprevwindow 22628msgid "Go to prior window" 22629msgstr "" 22630 22631#: lazarusidestrconsts.srkmecquickcompile 22632msgid "quick compile, no linking" 22633msgstr "Compila ràpidament, no enllaçes" 22634 22635#: lazarusidestrconsts.srkmecremovebreakpoint 22636#, fuzzy 22637#| msgid "remove break point" 22638msgid "remove breakpoint" 22639msgstr "elimina el punt de ruptura" 22640 22641#: lazarusidestrconsts.srkmecremoveemptymethods 22642msgid "Remove Empty Methods" 22643msgstr "" 22644 22645#: lazarusidestrconsts.srkmecremoveunusedunits 22646msgid "Remove Unused Units" 22647msgstr "" 22648 22649#: lazarusidestrconsts.srkmecrenameidentifier 22650#, fuzzy 22651#| msgid "Rename identifier" 22652msgid "Rename Identifier" 22653msgstr "Canvia el nom de l'identificador" 22654 22655#: lazarusidestrconsts.srkmecreplace 22656#, fuzzy 22657#| msgid "Replace text" 22658msgid "Replace Text" 22659msgstr "Substitueix el text" 22660 22661#: lazarusidestrconsts.srkmecreportingbug 22662msgctxt "lazarusidestrconsts.srkmecreportingbug" 22663msgid "Reporting a bug" 22664msgstr "" 22665 22666#: lazarusidestrconsts.srkmecresetdebugger 22667msgid "reset debugger" 22668msgstr "reinicia el depurador" 22669 22670#: lazarusidestrconsts.srkmecright 22671msgid "Move cursor right" 22672msgstr "" 22673 22674#: lazarusidestrconsts.srkmecrun 22675msgid "run program" 22676msgstr "executa el programa" 22677 22678#: lazarusidestrconsts.srkmecrunfile 22679msgid "run file" 22680msgstr "executa el fitxer" 22681 22682#: lazarusidestrconsts.srkmecrunparameters 22683msgid "run parameters" 22684msgstr "executa els paràmetres" 22685 22686#: lazarusidestrconsts.srkmecrunwithoutdebugging 22687msgid "run without debugging" 22688msgstr "" 22689 22690#: lazarusidestrconsts.srkmecscrolldown 22691msgid "Scroll down one line" 22692msgstr "Desplaça una línia avall" 22693 22694#: lazarusidestrconsts.srkmecscrollleft 22695msgid "Scroll left one char" 22696msgstr "Desplaça un caràcter a l'esquerra" 22697 22698#: lazarusidestrconsts.srkmecscrollright 22699msgid "Scroll right one char" 22700msgstr "Desplaça un caràcter a la dreta" 22701 22702#: lazarusidestrconsts.srkmecscrollup 22703msgid "Scroll up one line" 22704msgstr "Desplaça una línia amunt" 22705 22706#: lazarusidestrconsts.srkmecseldown 22707msgid "Select Down" 22708msgstr "Selecciona avall" 22709 22710#: lazarusidestrconsts.srkmecselectall 22711msgctxt "lazarusidestrconsts.srkmecselectall" 22712msgid "Select All" 22713msgstr "Selecciona-ho tot" 22714 22715#: lazarusidestrconsts.srkmecselectiontabs2spaces 22716msgid "Convert tabs to spaces in selection" 22717msgstr "Converteix els tabuladors en espais en la selecció" 22718 22719#: lazarusidestrconsts.srkmecseleditorbottom 22720msgid "Select to absolute end" 22721msgstr "Selecciona fins al final" 22722 22723#: lazarusidestrconsts.srkmecseleditortop 22724msgid "Select to absolute beginning" 22725msgstr "Selecciona fins al començament" 22726 22727#: lazarusidestrconsts.srkmecselgotoxy 22728msgid "Select Goto XY" 22729msgstr "Selecciona anar a XY" 22730 22731#: lazarusidestrconsts.srkmecselhalfwordleft 22732msgid "Select part-word left (e.g. CamelCase)" 22733msgstr "" 22734 22735#: lazarusidestrconsts.srkmecselhalfwordright 22736msgid "Select part-word right (e.g. CamelCase)" 22737msgstr "" 22738 22739#: lazarusidestrconsts.srkmecselleft 22740#, fuzzy 22741#| msgid "SelLeft" 22742msgid "Select Left" 22743msgstr "Alinea a l'esquerra" 22744 22745#: lazarusidestrconsts.srkmecsellineend 22746msgctxt "lazarusidestrconsts.srkmecsellineend" 22747msgid "Select Line End" 22748msgstr "Selecciona al final de la línia" 22749 22750#: lazarusidestrconsts.srkmecsellinestart 22751msgctxt "lazarusidestrconsts.srkmecsellinestart" 22752msgid "Select Line Start" 22753msgstr "Selecciona al començament de la línia" 22754 22755#: lazarusidestrconsts.srkmecsellinetextstart 22756msgid "Select to text start in line" 22757msgstr "" 22758 22759#: lazarusidestrconsts.srkmecselpagebottom 22760msgctxt "lazarusidestrconsts.srkmecselpagebottom" 22761msgid "Select Page Bottom" 22762msgstr "Selecciona la pàgina inferior" 22763 22764#: lazarusidestrconsts.srkmecselpagedown 22765msgid "Select Page Down" 22766msgstr "Selecciona la pàgina de sota" 22767 22768#: lazarusidestrconsts.srkmecselpageleft 22769msgid "Select Page Left" 22770msgstr "Selecciona la pàgina de l'esquerra" 22771 22772#: lazarusidestrconsts.srkmecselpageright 22773msgid "Select Page Right" 22774msgstr "Selecciona la pàgina de la dreta" 22775 22776#: lazarusidestrconsts.srkmecselpagetop 22777msgctxt "lazarusidestrconsts.srkmecselpagetop" 22778msgid "Select Page Top" 22779msgstr "Selecciona la pàgina superior" 22780 22781#: lazarusidestrconsts.srkmecselpageup 22782msgid "Select Page Up" 22783msgstr "Selecciona la pàgina d'amunt" 22784 22785#: lazarusidestrconsts.srkmecselright 22786#, fuzzy 22787#| msgid "SelRight" 22788msgid "Select Right" 22789msgstr "Alinea a la dreta" 22790 22791#: lazarusidestrconsts.srkmecselsmartwordleft 22792msgid "Smart select word left (start/end of word)" 22793msgstr "" 22794 22795#: lazarusidestrconsts.srkmecselsmartwordright 22796msgid "Smart select word right (start/end of word)" 22797msgstr "" 22798 22799#: lazarusidestrconsts.srkmecselsticky 22800msgid "Start sticky selecting" 22801msgstr "" 22802 22803#: lazarusidestrconsts.srkmecselstickycol 22804msgid "Start sticky selecting (Columns)" 22805msgstr "" 22806 22807#: lazarusidestrconsts.srkmecselstickyline 22808msgid "Start sticky selecting (Line)" 22809msgstr "" 22810 22811#: lazarusidestrconsts.srkmecselstickystop 22812msgid "Stop sticky selecting" 22813msgstr "" 22814 22815#: lazarusidestrconsts.srkmecselup 22816msgid "Select Up" 22817msgstr "Selecciona amunt" 22818 22819#: lazarusidestrconsts.srkmecselwordendleft 22820msgid "Select word-end left" 22821msgstr "" 22822 22823#: lazarusidestrconsts.srkmecselwordendright 22824msgid "Select word-end right" 22825msgstr "" 22826 22827#: lazarusidestrconsts.srkmecselwordleft 22828msgctxt "lazarusidestrconsts.srkmecselwordleft" 22829msgid "Select Word Left" 22830msgstr "Selecciona una paraula a l'esquerra" 22831 22832#: lazarusidestrconsts.srkmecselwordright 22833msgctxt "lazarusidestrconsts.srkmecselwordright" 22834msgid "Select Word Right" 22835msgstr "Selecciona una paraula a la dreta" 22836 22837#: lazarusidestrconsts.srkmecsetfreebookmark 22838msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" 22839msgid "Set a free Bookmark" 22840msgstr "" 22841 22842#: lazarusidestrconsts.srkmecsetmarker 22843#, object-pascal-format, fuzzy 22844#| msgid "Set Marker %d" 22845msgid "Set bookmark %d" 22846msgstr "Posiciona el marcador %d" 22847 22848#: lazarusidestrconsts.srkmecshifttab 22849msgid "Shift Tab" 22850msgstr "Shift Tab" 22851 22852#: lazarusidestrconsts.srkmecshowabstractmethods 22853msgid "Show Abstract Methods" 22854msgstr "" 22855 22856#: lazarusidestrconsts.srkmecshowcodecontext 22857msgid "Show Code Context" 22858msgstr "" 22859 22860#: lazarusidestrconsts.srkmecshowexecutionpoint 22861msgid "show execution point" 22862msgstr "" 22863 22864#: lazarusidestrconsts.srkmecsmartwordleft 22865msgid "Smart move cursor left (start/end of word)" 22866msgstr "" 22867 22868#: lazarusidestrconsts.srkmecsmartwordright 22869msgid "Smart move cursor right (start/end of word)" 22870msgstr "" 22871 22872#: lazarusidestrconsts.srkmecstopprogram 22873msgid "stop program" 22874msgstr "atura el programa" 22875 22876#: lazarusidestrconsts.srkmecsynmacroplay 22877msgid "Play Macro" 22878msgstr "" 22879 22880#: lazarusidestrconsts.srkmecsynmacrorecord 22881msgid "Record Macro" 22882msgstr "" 22883 22884#: lazarusidestrconsts.srkmecsynpsyncroedcellend 22885msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" 22886msgid "Goto last pos in cell" 22887msgstr "" 22888 22889#: lazarusidestrconsts.srkmecsynpsyncroedcellhome 22890msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" 22891msgid "Goto first pos in cell" 22892msgstr "" 22893 22894#: lazarusidestrconsts.srkmecsynpsyncroedcellselect 22895msgid "Select Cell" 22896msgstr "" 22897 22898#: lazarusidestrconsts.srkmecsynpsyncroedescape 22899msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" 22900msgid "Escape" 22901msgstr "" 22902 22903#: lazarusidestrconsts.srkmecsynpsyncroednextcell 22904msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" 22905msgid "Next Cell" 22906msgstr "" 22907 22908#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel 22909msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" 22910msgid "Next Cell (all selected)" 22911msgstr "" 22912 22913#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell 22914msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell" 22915msgid "Next Cell (firsts only)" 22916msgstr "" 22917 22918#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel 22919msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel" 22920msgid "Next Cell (all selected / firsts only)" 22921msgstr "" 22922 22923#: lazarusidestrconsts.srkmecsynpsyncroedprevcell 22924msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" 22925msgid "Previous Cell" 22926msgstr "" 22927 22928#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel 22929msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" 22930msgid "Previous Cell (all selected)" 22931msgstr "" 22932 22933#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell 22934msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell" 22935msgid "Previous Cell (firsts only)" 22936msgstr "" 22937 22938#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel 22939msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel" 22940msgid "Previous Cell (all selected / firsts only)" 22941msgstr "" 22942 22943#: lazarusidestrconsts.srkmecsynpsyncroedstart 22944msgid "Start Syncro edit" 22945msgstr "" 22946 22947#: lazarusidestrconsts.srkmecsynptmpledcellend 22948msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" 22949msgid "Goto last pos in cell" 22950msgstr "" 22951 22952#: lazarusidestrconsts.srkmecsynptmpledcellhome 22953msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" 22954msgid "Goto first pos in cell" 22955msgstr "" 22956 22957#: lazarusidestrconsts.srkmecsynptmpledcellselect 22958msgid "Select cell" 22959msgstr "" 22960 22961#: lazarusidestrconsts.srkmecsynptmpledescape 22962msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" 22963msgid "Escape" 22964msgstr "" 22965 22966#: lazarusidestrconsts.srkmecsynptmpledfinish 22967msgid "Finish" 22968msgstr "" 22969 22970#: lazarusidestrconsts.srkmecsynptmplednextcell 22971msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" 22972msgid "Next Cell" 22973msgstr "" 22974 22975#: lazarusidestrconsts.srkmecsynptmplednextcellrotate 22976msgid "Next Cell (rotate)" 22977msgstr "" 22978 22979#: lazarusidestrconsts.srkmecsynptmplednextcellsel 22980msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" 22981msgid "Next Cell (all selected)" 22982msgstr "" 22983 22984#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate 22985msgid "Next Cell (rotate / all selected)" 22986msgstr "" 22987 22988#: lazarusidestrconsts.srkmecsynptmplednextfirstcell 22989msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell" 22990msgid "Next Cell (firsts only)" 22991msgstr "" 22992 22993#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate 22994msgid "Next Cell (rotate / firsts only)" 22995msgstr "" 22996 22997#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel 22998msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel" 22999msgid "Next Cell (all selected / firsts only)" 23000msgstr "" 23001 23002#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate 23003msgid "Next Cell (rotate / all selected / firsts only)" 23004msgstr "" 23005 23006#: lazarusidestrconsts.srkmecsynptmpledprevcell 23007msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" 23008msgid "Previous Cell" 23009msgstr "" 23010 23011#: lazarusidestrconsts.srkmecsynptmpledprevcellsel 23012msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" 23013msgid "Previous Cell (all selected)" 23014msgstr "" 23015 23016#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell 23017msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell" 23018msgid "Previous Cell (firsts only)" 23019msgstr "" 23020 23021#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel 23022msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel" 23023msgid "Previous Cell (all selected / firsts only)" 23024msgstr "" 23025 23026#: lazarusidestrconsts.srkmecsyntaxcheck 23027#, fuzzy 23028#| msgid "Syntax check" 23029msgid "Syntax Check" 23030msgstr "Comprova la sintaxi" 23031 23032#: lazarusidestrconsts.srkmectoggleassembler 23033msgid "View assembler" 23034msgstr "" 23035 23036#: lazarusidestrconsts.srkmectogglebreakpoint 23037msgid "toggle breakpoint" 23038msgstr "" 23039 23040#: lazarusidestrconsts.srkmectogglebreakpointenabled 23041msgid "enable/disable breakpoint" 23042msgstr "" 23043 23044#: lazarusidestrconsts.srkmectogglebreakpoints 23045msgid "View breakpoints" 23046msgstr "Mostra els punts de ruptura" 23047 23048#: lazarusidestrconsts.srkmectogglecallstack 23049msgid "View call stack" 23050msgstr "Mostra la pila de les crides" 23051 23052#: lazarusidestrconsts.srkmectogglecodebrowser 23053msgid "View code browser" 23054msgstr "" 23055 23056#: lazarusidestrconsts.srkmectogglecodeexpl 23057msgid "View Code Explorer" 23058msgstr "Mostra l'explorador del codi" 23059 23060#: lazarusidestrconsts.srkmectogglecomppalette 23061msgid "View component palette" 23062msgstr "Vore paleta de components" 23063 23064#: lazarusidestrconsts.srkmectoggledebuggerout 23065msgid "View debugger output" 23066msgstr "Mostra la sortida del depurador" 23067 23068#: lazarusidestrconsts.srkmectoggleformunit 23069msgid "Switch between form and unit" 23070msgstr "Commutar entre forma i unitat" 23071 23072#: lazarusidestrconsts.srkmectogglefpdoceditor 23073msgid "View Documentation Editor" 23074msgstr "" 23075 23076#: lazarusidestrconsts.srkmectoggleidespeedbtns 23077msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" 23078msgid "View IDE speed buttons" 23079msgstr "" 23080 23081#: lazarusidestrconsts.srkmectogglelocals 23082msgid "View local variables" 23083msgstr "Mostra les variables locals" 23084 23085#: lazarusidestrconsts.srkmectogglemarker 23086#, object-pascal-format 23087msgid "Toggle bookmark %d" 23088msgstr "" 23089 23090#: lazarusidestrconsts.srkmectogglemarkupword 23091msgid "Toggle Current-Word highlight" 23092msgstr "" 23093 23094#: lazarusidestrconsts.srkmectogglemessages 23095msgid "View messages" 23096msgstr "Mostra els missatges" 23097 23098#: lazarusidestrconsts.srkmectogglemode 23099msgid "Toggle Mode" 23100msgstr "Canvia el mode" 23101 23102#: lazarusidestrconsts.srkmectoggleobjectinsp 23103msgid "View Object Inspector" 23104msgstr "Mostra l'inspector dels objectes" 23105 23106#: lazarusidestrconsts.srkmectoggleregisters 23107msgid "View registers" 23108msgstr "" 23109 23110#: lazarusidestrconsts.srkmectogglerestrictionbrowser 23111msgid "View restriction browser" 23112msgstr "" 23113 23114#: lazarusidestrconsts.srkmectogglesearchresults 23115msgid "View Search Results" 23116msgstr "Mostra els resultats de recerca" 23117 23118#: lazarusidestrconsts.srkmectogglesourceeditor 23119msgid "View Source Editor" 23120msgstr "Mostra l'editor del codi font" 23121 23122#: lazarusidestrconsts.srkmectogglewatches 23123msgid "View watches" 23124msgstr "Mostra els controls" 23125 23126#: lazarusidestrconsts.srkmecunfoldall 23127msgctxt "lazarusidestrconsts.srkmecunfoldall" 23128msgid "Unfold all" 23129msgstr "" 23130 23131#: lazarusidestrconsts.srkmecunfoldcurrent 23132msgid "Unfold at Cursor" 23133msgstr "" 23134 23135#: lazarusidestrconsts.srkmecunknown 23136msgid "unknown editor command" 23137msgstr "ordre de l'editor desconeguda" 23138 23139#: lazarusidestrconsts.srkmecunusedunits 23140msgid "Unused Units ..." 23141msgstr "" 23142 23143#: lazarusidestrconsts.srkmecup 23144msgid "Move cursor up" 23145msgstr "" 23146 23147#: lazarusidestrconsts.srkmecviewanchoreditor 23148msgid "View anchor editor" 23149msgstr "Mostra l'editor de les àncores" 23150 23151#: lazarusidestrconsts.srkmecviewcomponents 23152msgid "View components" 23153msgstr "" 23154 23155#: lazarusidestrconsts.srkmecvieweditormacros 23156msgid "View editor macros" 23157msgstr "" 23158 23159#: lazarusidestrconsts.srkmecviewforms 23160msgid "View forms" 23161msgstr "Mostra les formes" 23162 23163#: lazarusidestrconsts.srkmecviewhistory 23164msgctxt "lazarusidestrconsts.srkmecviewhistory" 23165msgid "View History" 23166msgstr "" 23167 23168#: lazarusidestrconsts.srkmecviewpseudoterminal 23169msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal" 23170msgid "View console in/output" 23171msgstr "" 23172 23173#: lazarusidestrconsts.srkmecviewtaborder 23174msgid "View Tab Order" 23175msgstr "" 23176 23177#: lazarusidestrconsts.srkmecviewthreads 23178msgctxt "lazarusidestrconsts.srkmecviewthreads" 23179msgid "View Threads" 23180msgstr "" 23181 23182#: lazarusidestrconsts.srkmecviewunitdependencies 23183msgid "View unit dependencies" 23184msgstr "Mostra les dependències de les unitats" 23185 23186#: lazarusidestrconsts.srkmecviewunitinfo 23187msgid "View unit information" 23188msgstr "Mostra l'informació de la unitat" 23189 23190#: lazarusidestrconsts.srkmecviewunits 23191msgid "View units" 23192msgstr "Mostra les unitats" 23193 23194#: lazarusidestrconsts.srkmecwordcompletion 23195#, fuzzy 23196#| msgid "Word completion" 23197msgid "Word Completion" 23198msgstr "Completa la paraula" 23199 23200#: lazarusidestrconsts.srkmecwordendleft 23201msgid "Move cursor word-end left" 23202msgstr "" 23203 23204#: lazarusidestrconsts.srkmecwordendright 23205msgid "Move cursor word-end right" 23206msgstr "" 23207 23208#: lazarusidestrconsts.srkmecwordleft 23209msgid "Move cursor word left" 23210msgstr "Mou el cursor una paraula a l'esquerra" 23211 23212#: lazarusidestrconsts.srkmecwordright 23213msgid "Move cursor word right" 23214msgstr "Mou el cursor una paraula a la dreta" 23215 23216#: lazarusidestrconsts.srkmeczoomin 23217msgid "Zoom in" 23218msgstr "" 23219 23220#: lazarusidestrconsts.srkmeczoomout 23221msgid "Zoom out" 23222msgstr "" 23223 23224#: lazarusidestrconsts.srkmeditforcmd 23225msgid "Edit keys of command" 23226msgstr "" 23227 23228#: lazarusidestrconsts.synfcontinuewithnextmouseupaction 23229msgid "Continue with next mouse up action" 23230msgstr "" 23231 23232#: lazarusidestrconsts.synffoldcomments 23233msgid "Fold comments" 23234msgstr "" 23235 23236#: lazarusidestrconsts.synffoldcommentsinselection 23237msgid "Fold comments in selection" 23238msgstr "" 23239 23240#: lazarusidestrconsts.synffoldinactiveifdef 23241msgid "Fold inactive Ifdef" 23242msgstr "" 23243 23244#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate 23245msgid "Fold inactive Ifdef (exclude mixed state)" 23246msgstr "" 23247 23248#: lazarusidestrconsts.synffoldinactiveifdefinselection 23249msgid "Fold inactive Ifdef in selection" 23250msgstr "" 23251 23252#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate 23253msgid "Fold inactive Ifdef in selection (exclude mixed state)" 23254msgstr "" 23255 23256#: lazarusidestrconsts.synfhidecomments 23257msgid "Hide comments" 23258msgstr "" 23259 23260#: lazarusidestrconsts.synfhidecommentsinselection 23261msgid "Hide comments in selection" 23262msgstr "" 23263 23264#: lazarusidestrconsts.synfmatchactionbuttonofmousedown 23265msgid "Match action button of mouse down" 23266msgstr "" 23267 23268#: lazarusidestrconsts.synfmatchactionlineofmousedown 23269msgid "Match action line of mouse down" 23270msgstr "" 23271 23272#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown 23273msgid "Match action modifiers of mouse down" 23274msgstr "" 23275 23276#: lazarusidestrconsts.synfmatchactionposofmousedown 23277msgid "Match action pos of mouse down" 23278msgstr "" 23279 23280#: lazarusidestrconsts.synfsearchallactionofmousedown 23281msgid "Search all action of mouse down" 23282msgstr "" 23283 23284#: lazarusidestrconsts.synfunfoldactiveifdef 23285msgid "Unfold active Ifdef" 23286msgstr "" 23287 23288#: lazarusidestrconsts.synfunfoldactiveifdefinselection 23289msgid "Unfold active Ifdef in selection" 23290msgstr "" 23291 23292#: lazarusidestrconsts.synfunfoldall 23293msgctxt "lazarusidestrconsts.synfunfoldall" 23294msgid "Unfold all" 23295msgstr "" 23296 23297#: lazarusidestrconsts.synfunfoldallifdef 23298msgid "Unfold all Ifdef" 23299msgstr "" 23300 23301#: lazarusidestrconsts.synfunfoldallifdefinselection 23302msgid "Unfold all Ifdef in selection" 23303msgstr "" 23304 23305#: lazarusidestrconsts.synfunfoldallinselection 23306msgid "Unfold all in selection" 23307msgstr "" 23308 23309#: lazarusidestrconsts.synfunfoldcomments 23310msgid "Unfold comments" 23311msgstr "" 23312 23313#: lazarusidestrconsts.synfunfoldcommentsinselection 23314msgid "Unfold comments in selection" 23315msgstr "" 23316 23317#: lazarusidestrconsts.synfunfoldinactiveifdef 23318msgid "Unfold inactive Ifdef" 23319msgstr "" 23320 23321#: lazarusidestrconsts.synfunfoldinactiveifdefinselection 23322msgid "Unfold inactive Ifdef in selection" 23323msgstr "" 23324 23325#: lazarusidestrconsts.uefilerocap 23326msgid "File is readonly" 23327msgstr "El fitxer és només de lectura" 23328 23329#: lazarusidestrconsts.uefilerotext1 23330msgid "The file \"" 23331msgstr "El fitxer \"" 23332 23333#: lazarusidestrconsts.uefilerotext2 23334msgid "\" is not writable." 23335msgstr "\" no es pot escriure" 23336 23337#: lazarusidestrconsts.uelocked 23338msgid "Locked" 23339msgstr "" 23340 23341#: lazarusidestrconsts.uemacrorecording 23342msgid "Recording" 23343msgstr "" 23344 23345#: lazarusidestrconsts.uemacrorecordingpaused 23346msgid "Rec-pause" 23347msgstr "" 23348 23349#: lazarusidestrconsts.uemaddwatchatcursor 23350msgid "Add &Watch At Cursor" 23351msgstr "Afegeix &Control al cursor" 23352 23353#: lazarusidestrconsts.uemaddwatchpointatcursor 23354msgid "Add Watch&Point At Cursor" 23355msgstr "" 23356 23357#: lazarusidestrconsts.uembookmarknset 23358#, object-pascal-format 23359msgid "Bookmark &%s: %s" 23360msgstr "" 23361 23362#: lazarusidestrconsts.uembookmarknunset 23363#, object-pascal-format 23364msgid "Bookmark &%s" 23365msgstr "" 23366 23367#: lazarusidestrconsts.uembookmarknunsetdisabled 23368#, object-pascal-format 23369msgid "Bookmark %s" 23370msgstr "" 23371 23372#: lazarusidestrconsts.uemcloseotherpages 23373msgid "Close All &Other Pages" 23374msgstr "" 23375 23376#: lazarusidestrconsts.uemcloseotherpagesplain 23377msgid "Close All Other Pages" 23378msgstr "" 23379 23380#: lazarusidestrconsts.uemcloseotherpagesright 23381msgid "Close Pages on the &Right" 23382msgstr "" 23383 23384#: lazarusidestrconsts.uemcloseotherpagesrightplain 23385msgid "Close Pages on the Right" 23386msgstr "" 23387 23388#: lazarusidestrconsts.uemclosepage 23389msgid "&Close Page" 23390msgstr "Tan&ca la pàgina" 23391 23392#: lazarusidestrconsts.uemcopyfilename 23393msgid "Copy Filename" 23394msgstr "" 23395 23396#: lazarusidestrconsts.uemcopytonewwindow 23397msgid "Clone to New Window" 23398msgstr "" 23399 23400#: lazarusidestrconsts.uemcopytootherwindow 23401msgid "Clone to Other Window" 23402msgstr "" 23403 23404#: lazarusidestrconsts.uemcopytootherwindownew 23405msgctxt "lazarusidestrconsts.uemcopytootherwindownew" 23406msgid "New Window" 23407msgstr "" 23408 23409#: lazarusidestrconsts.uemdebugword 23410msgctxt "lazarusidestrconsts.uemdebugword" 23411msgid "Debug" 23412msgstr "Depuració" 23413 23414#: lazarusidestrconsts.uemencoding 23415msgid "Encoding" 23416msgstr "" 23417 23418#: lazarusidestrconsts.uemevaluatemodify 23419msgid "&Evaluate/Modify ..." 23420msgstr "" 23421 23422#: lazarusidestrconsts.uemfinddeclaration 23423msgid "&Find Declaration" 23424msgstr "&Cerca la declaració" 23425 23426#: lazarusidestrconsts.uemfindinotherwindow 23427msgid "Find in other Window" 23428msgstr "" 23429 23430#: lazarusidestrconsts.uemgotobookmark 23431msgid "&Goto Bookmark" 23432msgstr "&Vés al marcador" 23433 23434#: lazarusidestrconsts.uemgotobookmarks 23435msgid "Goto Bookmark ..." 23436msgstr "" 23437 23438#: lazarusidestrconsts.uemhighlighter 23439msgid "Highlighter" 23440msgstr "" 23441 23442#: lazarusidestrconsts.ueminspect 23443#, fuzzy 23444msgctxt "lazarusidestrconsts.ueminspect" 23445msgid "&Inspect ..." 23446msgstr "Inspecciona ..." 23447 23448#: lazarusidestrconsts.ueminvertassignment 23449#, fuzzy 23450msgctxt "lazarusidestrconsts.ueminvertassignment" 23451msgid "Invert Assignment" 23452msgstr "Inverteix l'assignació" 23453 23454#: lazarusidestrconsts.uemlineending 23455msgid "Line Ending" 23456msgstr "" 23457 23458#: lazarusidestrconsts.uemlockpage 23459msgid "&Lock Page" 23460msgstr "" 23461 23462#: lazarusidestrconsts.uemmovepageleft 23463msgid "Move Page Left" 23464msgstr "" 23465 23466#: lazarusidestrconsts.uemmovepageleftmost 23467msgid "Move Page Leftmost" 23468msgstr "" 23469 23470#: lazarusidestrconsts.uemmovepageright 23471msgid "Move Page Right" 23472msgstr "" 23473 23474#: lazarusidestrconsts.uemmovepagerightmost 23475msgid "Move Page Rightmost" 23476msgstr "" 23477 23478#: lazarusidestrconsts.uemmovetonewwindow 23479msgid "Move to New Window" 23480msgstr "" 23481 23482#: lazarusidestrconsts.uemmovetootherwindow 23483msgid "Move to Other Window" 23484msgstr "" 23485 23486#: lazarusidestrconsts.uemmovetootherwindownew 23487msgctxt "lazarusidestrconsts.uemmovetootherwindownew" 23488msgid "New Window" 23489msgstr "" 23490 23491#: lazarusidestrconsts.uemnextbookmark 23492#, fuzzy 23493#| msgid "Goto next Bookmark" 23494msgid "Goto Next Bookmark" 23495msgstr "Ves al següent Marcador" 23496 23497#: lazarusidestrconsts.uemodified 23498msgid "Modified" 23499msgstr "Modificat" 23500 23501#: lazarusidestrconsts.uemopenfileatcursor 23502#, fuzzy 23503#| msgid "&Open file at cursor" 23504msgid "&Open File at Cursor" 23505msgstr "&Obre el fitxer al cursor" 23506 23507#: lazarusidestrconsts.uemprevbookmark 23508#, fuzzy 23509#| msgid "Goto previous Bookmark" 23510msgid "Goto Previous Bookmark" 23511msgstr "Ves al Marcador anterior" 23512 23513#: lazarusidestrconsts.uemprocedurejump 23514msgid "Procedure Jump" 23515msgstr "" 23516 23517#: lazarusidestrconsts.uemreadonly 23518msgctxt "lazarusidestrconsts.uemreadonly" 23519msgid "Read Only" 23520msgstr "Només lectura" 23521 23522#: lazarusidestrconsts.uemrefactor 23523msgid "Refactoring" 23524msgstr "Torna a factoritzar" 23525 23526#: lazarusidestrconsts.uemsetfreebookmark 23527#, fuzzy 23528#| msgid "Set a free Bookmark" 23529msgctxt "lazarusidestrconsts.uemsetfreebookmark" 23530msgid "Set a Free Bookmark" 23531msgstr "Estableix un Marcador lliure" 23532 23533#: lazarusidestrconsts.uemshowlinenumbers 23534msgid "Show Line Numbers" 23535msgstr "Mostra nombre de línia" 23536 23537#: lazarusidestrconsts.uemsource 23538msgctxt "lazarusidestrconsts.uemsource" 23539msgid "Source" 23540msgstr "" 23541 23542#: lazarusidestrconsts.uemtogglebookmark 23543msgid "&Toggle Bookmark" 23544msgstr "" 23545 23546#: lazarusidestrconsts.uemtogglebookmarknset 23547#, object-pascal-format 23548msgid "Toggle Bookmark &%s: %s" 23549msgstr "" 23550 23551#: lazarusidestrconsts.uemtogglebookmarknunset 23552#, object-pascal-format 23553msgid "Toggle Bookmark &%s" 23554msgstr "" 23555 23556#: lazarusidestrconsts.uemtogglebookmarks 23557msgid "Toggle Bookmark ..." 23558msgstr "" 23559 23560#: lazarusidestrconsts.uemtogglebreakpoint 23561msgid "Toggle &Breakpoint" 23562msgstr "" 23563 23564#: lazarusidestrconsts.uemviewcallstack 23565msgctxt "lazarusidestrconsts.uemviewcallstack" 23566msgid "View Call Stack" 23567msgstr "Mostra la pila de les crides" 23568 23569#: lazarusidestrconsts.uenotimplcap 23570msgid "Not implemented yet" 23571msgstr "Encara no està implementat" 23572 23573#: lazarusidestrconsts.uepins 23574msgid "INS" 23575msgstr "INS" 23576 23577#: lazarusidestrconsts.uepovr 23578msgid "OVR" 23579msgstr "OVR" 23580 23581#: lazarusidestrconsts.uepreadonly 23582msgid "Readonly" 23583msgstr "Només de lectura" 23584 23585#: lazarusidestrconsts.unitdepoptionsforpackage 23586msgid "Options for Package graph" 23587msgstr "" 23588 23589#: lazarusidestrconsts.unitdepoptionsforunit 23590msgid "Options for Unit graph" 23591msgstr "" 23592 23593#: lazarusidestrconsts.versioninfotitle 23594msgid "Version Info" 23595msgstr "Informació de la versió" 23596 23597