1# This file has comments in it 2>gi|3318709|pdb|1A91| 3MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGL 4GLYVMFAVA 5# I don't really know if FASTA format is supposed to support this 6# but we might be able to without many problems 7>gi|whatever|whatever 8MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGG 9# More comments at the end of the file 10# Man, this file has more comments than sequence 11