1TBLASTX 2.1.2 [Oct-19-2000] 2 3 4Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 5Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 6"Gapped BLAST and PSI-BLAST: a new generation of protein database search 7programs", Nucleic Acids Res. 25:3389-3402. 8 9Query= HUMBETGLOA Human haplotype C4 beta-globin gene, complete cds. 10 (3002 letters) 11 12Database: ecoli.nt 13 400 sequences; 4,662,239 total letters 14 15Searching.................................................done 16 17 Score E 18Sequences producing significant alignments: (bits) Value 19 20gb|AE000479.1|AE000479 Escherichia coli K-12 MG1655 section 369 ... 34 0.13 21gb|AE000302.1|AE000302 Escherichia coli K-12 MG1655 section 192 ... 31 0.61 22gb|AE000277.1|AE000277 Escherichia coli K-12 MG1655 section 167 ... 31 0.84 23gb|AE000168.1|AE000168 Escherichia coli K-12 MG1655 section 58 o... 29 2.2 24gb|AE000400.1|AE000400 Escherichia coli K-12 MG1655 section 290 ... 29 3.0 25gb|AE000408.1|AE000408 Escherichia coli K-12 MG1655 section 298 ... 29 3.0 26gb|AE000438.1|AE000438 Escherichia coli K-12 MG1655 section 328 ... 29 3.0 27gb|AE000396.1|AE000396 Escherichia coli K-12 MG1655 section 286 ... 29 3.0 28gb|AE000466.1|AE000466 Escherichia coli K-12 MG1655 section 356 ... 26 3.4 29gb|AE000482.1|AE000482 Escherichia coli K-12 MG1655 section 372 ... 29 4.1 30gb|AE000341.1|AE000341 Escherichia coli K-12 MG1655 section 231 ... 29 4.1 31gb|AE000198.1|AE000198 Escherichia coli K-12 MG1655 section 88 o... 29 4.1 32gb|AE000367.1|AE000367 Escherichia coli K-12 MG1655 section 257 ... 29 4.1 33gb|AE000136.1|AE000136 Escherichia coli K-12 MG1655 section 26 o... 29 4.1 34gb|AE000327.1|AE000327 Escherichia coli K-12 MG1655 section 217 ... 28 5.7 35gb|AE000498.1|AE000498 Escherichia coli K-12 MG1655 section 388 ... 28 7.8 36gb|AE000509.1|AE000509 Escherichia coli K-12 MG1655 section 399 ... 28 7.8 37gb|AE000306.1|AE000306 Escherichia coli K-12 MG1655 section 196 ... 28 7.8 38gb|AE000203.1|AE000203 Escherichia coli K-12 MG1655 section 93 o... 28 7.8 39gb|AE000208.1|AE000208 Escherichia coli K-12 MG1655 section 98 o... 28 7.8 40 41>gb|AE000479.1|AE000479 Escherichia coli K-12 MG1655 section 369 of 400 of the complete 42 genome 43 Length = 10934 44 45 Score = 33.6 bits (67), Expect = 0.13 46 Identities = 11/26 (42%), Positives = 16/26 (61%) 47 Frame = +1 / -2 48 49 50Query: 1057 SAYWSIFPPLGCWWSTLGPRGSLSPL 1134 51 +A W++FPP+G W L + SPL 52Sbjct: 5893 AAVWALFPPVGSQWGCLASQWRTSPL 5816 53 54 55>gb|AE000302.1|AE000302 Escherichia coli K-12 MG1655 section 192 of 400 of the complete 56 genome 57 Length = 10264 58 59 Score = 31.3 bits (62), Expect = 0.61 60 Identities = 8/17 (47%), Positives = 13/17 (76%) 61 Frame = +2 / +2 62 63 64Query: 2177 WSVCWPITLAKNSPHQC 2227 65 + CWP+ L ++SP+QC 66Sbjct: 1157 YPACWPLPLRRSSPYQC 1207 67 68 69>gb|AE000277.1|AE000277 Escherichia coli K-12 MG1655 section 167 of 400 of the complete 70 genome 71 Length = 11653 72 73 Score = 30.8 bits (61), Expect = 0.84 74 Identities = 9/25 (36%), Positives = 14/25 (56%) 75 Frame = +2 / -3 76 77 78Query: 2174 CWSVCWPITLAKNSPHQCRLPIRKW 2248 79 CW + L K+ P QCR+ + +W 80Sbjct: 4931 CWLTASVLRLQKSLPRQCRITVVRW 4857 81 82 83>gb|AE000168.1|AE000168 Escherichia coli K-12 MG1655 section 58 of 400 of the complete genome 84 Length = 12663 85 86 Score = 29.5 bits (58), Expect = 2.2 87 Identities = 12/41 (29%), Positives = 24/41 (58%) 88 Frame = -1 / +1 89 90 91Query: 2813 KEHFRGKVVSLSKRTEWSQG*EMQDKQMGSEKTFMRTAKTI 2691 92 K H RG+ V + ++ ++ E+ D++ G+ + RT +TI 93Sbjct: 13 KRHLRGE*VKVGEKYITARRGELPDQEPGNGEASYRTMRTI 135 94 95 96>gb|AE000400.1|AE000400 Escherichia coli K-12 MG1655 section 290 of 400 of the complete 97 genome 98 Length = 14295 99 100 Score = 29.0 bits (57), Expect = 3.0 101 Identities = 7/18 (38%), Positives = 10/18 (54%) 102 Frame = +2 / +3 103 104 105Query: 2165 WATCWSVCWPITLAKNSP 2218 106 W TCW+ CW ++P 107Sbjct: 9096 WITCWNCCWQAGWISSAP 9149 108 109 110>gb|AE000408.1|AE000408 Escherichia coli K-12 MG1655 section 298 of 400 of the complete 111 genome 112 Length = 10944 113 114 Score = 29.0 bits (57), Expect = 3.0 115 Identities = 17/39 (43%), Positives = 20/39 (50%) 116 Frame = -3 / +1 117 118 119Query: 1020 LSPHAQFLLVSLNLSCNLDTNLPRASPPTSSTFTLPHRA 904 120 L+ A FLLV + +S DT LPR T TF RA 121Sbjct: 7618 LTSTAAFLLV*VKISRACDTFLPRIRSATRRTF*AEERA 7734 122 123 124>gb|AE000438.1|AE000438 Escherichia coli K-12 MG1655 section 328 of 400 of the complete 125 genome 126 Length = 10426 127 128 Score = 29.0 bits (57), Expect = 3.0 129 Identities = 10/28 (35%), Positives = 12/28 (42%) 130 Frame = +2 / +3 131 132 133Query: 2165 WATCWSVCWPITLAKNSPHQCRLPIRKW 2248 134 WA CW C + +A NS R W 135Sbjct: 750 WACCWRTCSLVVVALNSLRAVRQSSTSW 833 136 137 138>gb|AE000396.1|AE000396 Escherichia coli K-12 MG1655 section 286 of 400 of the complete 139 genome 140 Length = 10098 141 142 Score = 29.0 bits (57), Expect = 3.0 143 Identities = 9/27 (33%), Positives = 18/27 (66%) 144 Frame = -3 / -1 145 146 147Query: 633 PPSKIYLLAPYHQYKLLLKTSSFASVF 553 148 PP++ YLL+P H+++++ S + F 149Sbjct: 309 PPARFYLLSPVHEWRVIAS*SWYHQSF 229 150 151 152>gb|AE000466.1|AE000466 Escherichia coli K-12 MG1655 section 356 of 400 of the complete 153 genome 154 Length = 10208 155 156 Score = 26.3 bits (51), Expect(2) = 3.4 157 Identities = 11/26 (42%), Positives = 14/26 (53%) 158 Frame = +3 / +2 159 160 161Query: 2796 SPEVFLPCFTARWFLLAWPLSLSCLC 2873 162 S V L C T ++L W L+LS C 163Sbjct: 5579 SSAVVLRCLTTVFWLPVWALTLSICC 5656 164 165 166 Score = 20.3 bits (38), Expect(2) = 3.4 167 Identities = 4/11 (36%), Positives = 7/11 (63%) 168 Frame = +3 / +1 169 170 171Query: 2892 LKKEKQGSWFD 2924 172 +K+ +G W D 173Sbjct: 5737 MKRPFKGDWLD 5769 174 175 176>gb|AE000482.1|AE000482 Escherichia coli K-12 MG1655 section 372 of 400 of the complete genome 177 Length = 20906 178 179 Score = 28.6 bits (56), Expect = 4.1 180 Identities = 14/48 (29%), Positives = 19/48 (39%) 181 Frame = +3 / +1 182 183 184Query: 660 SQCQKSQGQVRLSSLRPHPVEPHPRVGQSTPRSREGRSQGWA*KSGQS 803 185 S+C G R RP + P +P GR +GW GQ+ 186Sbjct: 20239 SRCALILGPARRWVHRPESLSPAASAHGQSPHVAAGRRRGWKRADGQN 20382 187 188 189>gb|AE000341.1|AE000341 Escherichia coli K-12 MG1655 section 231 of 400 of the complete 190 genome 191 Length = 10231 192 193 Score = 28.6 bits (56), Expect = 4.1 194 Identities = 12/20 (60%), Positives = 13/20 (65%) 195 Frame = -2 / +2 196 197 198Query: 2995 PGD*HCRFRVTVSGGGREEG 2936 199 PG H +R TVSG GRE G 200Sbjct: 7538 PGWLHAVYRETVSGSGREAG 7597 201 202 203>gb|AE000198.1|AE000198 Escherichia coli K-12 MG1655 section 88 of 400 of the complete genome 204 Length = 11639 205 206 Score = 28.6 bits (56), Expect = 4.1 207 Identities = 11/22 (50%), Positives = 15/22 (68%) 208 Frame = +1 / +3 209 210 211Query: 2332 FPKSNY*TGGYYEGP*ASGFCL 2397 212 F +S * GGY+ GP +S FC+ 213Sbjct: 10947 FQRSGG*PGGYHAGPGSSPFCV 11012 214 215 216>gb|AE000367.1|AE000367 Escherichia coli K-12 MG1655 section 257 of 400 of the complete 217 genome 218 Length = 11438 219 220 Score = 28.6 bits (56), Expect = 4.1 221 Identities = 8/27 (29%), Positives = 13/27 (47%) 222 Frame = +3 / -2 223 224 225Query: 1332 CFLSPSFLWLSSCHRKGISNRVQFRMG 1412 226 C + +F+W + CH+ I F G 227Sbjct: 7990 CLFAAAFVWFAKCHQPVIGRNTTFSKG 7910 228 229 230>gb|AE000136.1|AE000136 Escherichia coli K-12 MG1655 section 26 of 400 of the complete genome 231 Length = 16823 232 233 Score = 28.6 bits (56), Expect = 4.1 234 Identities = 11/23 (47%), Positives = 12/23 (51%) 235 Frame = -2 / +1 236 237 238Query: 2860 RLSGQARRNHLAVKHGRNTSGER 2792 239 RLSG+ RR A H SG R 240Sbjct: 13873 RLSGKVRRRGSAASHFLYLSGSR 13941 241 242 243>gb|AE000327.1|AE000327 Escherichia coli K-12 MG1655 section 217 of 400 of the complete 244 genome 245 Length = 10048 246 247 Score = 28.1 bits (55), Expect = 5.7 248 Identities = 9/19 (47%), Positives = 12/19 (62%) 249 Frame = +1 / +2 250 251 252Query: 1231 WTTSRAPLPH*VSCTVTSC 1287 253 W S P+PH C+V+SC 254Sbjct: 2426 WRQSLYPIPHCYRCSVSSC 2482 255 256 257>gb|AE000498.1|AE000498 Escherichia coli K-12 MG1655 section 388 of 400 of the complete 258 genome 259 Length = 10264 260 261 Score = 27.6 bits (54), Expect = 7.8 262 Identities = 8/18 (44%), Positives = 10/18 (55%) 263 Frame = +3 / +3 264 265 266Query: 2670 YAVFYITYCFSCPHECLF 2723 267 + + T C SCPH C F 268Sbjct: 4278 FITLHFT*CVSCPHNCSF 4331 269 270 271>gb|AE000509.1|AE000509 Escherichia coli K-12 MG1655 section 399 of 400 of the complete 272 genome 273 Length = 10589 274 275 Score = 27.6 bits (54), Expect = 7.8 276 Identities = 8/17 (47%), Positives = 12/17 (70%) 277 Frame = -2 / -3 278 279 280Query: 682 PWLFWHWLRSWTSNPQP 632 281 P L W+W+R S+P+P 282Sbjct: 261 PSLLWYWVRRCLSSPRP 211 283 284 285>gb|AE000306.1|AE000306 Escherichia coli K-12 MG1655 section 196 of 400 of the complete 286 genome 287 Length = 10446 288 289 Score = 27.6 bits (54), Expect = 7.8 290 Identities = 7/18 (38%), Positives = 12/18 (65%) 291 Frame = +3 / +1 292 293 294Query: 1341 SPSFLWLSSCHRKGISNR 1394 295 +P+ W+S CHR+ + R 296Sbjct: 136 TPAGCWISGCHRRSVQQR 189 297 298 299>gb|AE000203.1|AE000203 Escherichia coli K-12 MG1655 section 93 of 400 of the complete genome 300 Length = 10751 301 302 Score = 27.6 bits (54), Expect = 7.8 303 Identities = 13/47 (27%), Positives = 23/47 (48%) 304 Frame = +1 / +3 305 306 307Query: 1156 LLWATLR*RLMARKCSVPLVMAWLTWTTSRAPLPH*VSCTVTSCTWI 1296 308 +L T R A + +V + WT S P P + C+++S +W+ 309Sbjct: 1554 ILRLTYRLPTWAEPVTWAMVSSMRVWTPSVRP*PEALICSISSGSWL 1694 310 311 312>gb|AE000208.1|AE000208 Escherichia coli K-12 MG1655 section 98 of 400 of the complete genome 313 Length = 10619 314 315 Score = 27.6 bits (54), Expect = 7.8 316 Identities = 10/25 (40%), Positives = 15/25 (60%) 317 Frame = -3 / +3 318 319 320Query: 981 LSCNLDTNLPRASPPTSSTFTLPHR 907 321 ++C L + P ++TFTLPHR 322Sbjct: 2829 VACTLTCKYRLSLPQRANTFTLPHR 2903 323 324 325 Database: ecoli.nt 326 Posted date: Jun 14, 2001 3:27 PM 327 Number of letters in database: 4,662,239 328 Number of sequences in database: 400 329 330Lambda K H 331 0.318 0.135 0.401 332 333 334Matrix: BLOSUM62 335Number of Hits to DB: 31907970 336Number of Sequences: 400 337Number of extensions: 491769 338Number of successful extensions: 23184 339Number of sequences better than 10.0: 20 340length of query: 1000 341length of database: 1,554,079 342effective HSP length: 47 343effective length of query: 953 344effective length of database: 1,535,279 345effective search space: 1463120887 346effective search space used: 1463120887 347frameshift window, decay const: 50, 0.1 348T: 13 349A: 40 350X1: 16 ( 7.3 bits) 351X2: 0 ( 0.0 bits) 352S1: 41 (21.7 bits) 353S2: 53 (27.2 bits) 354