1>>>>LLIS904 9/1993 2X52273 Lactococcus lactis insertion element iso-IS904 coding for a transposase. 9/1993 3LOCUS LLIS904 1245 bp DNA linear BCT 12-SEP-1993 4DEFINITION Lactococcus lactis insertion element iso-IS904 coding for a 5 transposase. 6ACCESSION X52273 7VERSION X52273.1 GI:44028 8KEYWORDS insertion element; insertion element iso-IS904; transposon. 9SOURCE Lactococcus lactis. 10 ORGANISM Lactococcus lactis 11 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 12 Lactococcus. 13REFERENCE 1 (bases 1 to 1245) 14 AUTHORS Rauch,P.J.G. 15 TITLE Direct Submission 16 JOURNAL Submitted (11-APR-1990) Rauch P.J.G., Netherlands Institute for 17 Dairy Research, P O Box 20, 6710 BA EDE, The Netherlands 18REFERENCE 2 (bases 1 to 1245) 19 AUTHORS Rauch,P.J., Beerthuyzen,M.M. and de Vos,W.M. 20 TITLE Nucleotide sequence of IS904 from Lactococcus lactis subsp. lactis 21 strain NIZO R5 22 JOURNAL Nucleic Acids Res. 18 (14), 4253-4254 (1990) 23 MEDLINE 90332428 24FEATURES Location/Qualifiers 25 source 1. .1245 26 /organism="Lactococcus lactis" 27 /strain="lactis NIZO R5." 28 /db_xref="taxon:1358" 29 repeat_unit 1. .39 30 /note="imperfect inverted repeat A" 31 promoter 265. .270 32 /note="put. -35 region (1)" 33 promoter 286. .291 34 /note="put. -10 region (1)" 35 misc_feature 289. .336 36 /note="dyad symmetry region" 37 promoter 302. .307 38 /note="put. -35 region (2)" 39 promoter 326. .331 40 /note="put. -10 region (2)" 41 CDS 444. .1205 42 /note="put. transposase (AA 1-253)" 43 /codon_start=1 44 /transl_table=11 45 /protein_id="CAA36516.1" 46 /db_xref="GI:44029" 47 /db_xref="SPTREMBL:Q48648" 48 /translation="MHRRPSKQQVEREILSEKIKAVFHEHKGRYGAVRITKVLHNTGI 49 MTNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGSSLSRPNLINQIFKATAPNKVWLGDM 50 TYIPTKEGTLYLAVNIDVFSRKIVGWSMSSRMQDKLVRDYFLQACGKEHPQPGLIVHT 51 DQGSQYTSSRYQSTLRQVGAQSSMSRKGNPYDNAMMESFYKTLKRELINDAHFETRAE 52 ATQEIFKYIETYYNTKRMHSGLDYKSPKDFEKYNS" 53 repeat_unit 1207. .1245 54 /note="imperfect inverted repeat A'" 55BASE COUNT 426 a 213 c 255 g 351 t 56ORIGIN 57>>>>LLISS1 6/1992 58X62737 L.lactis plasmid pTD1 insertion sequence ISS1. 6/1992 59LOCUS LLISS1 808 bp DNA linear BCT 05-JUN-1992 60DEFINITION L.lactis plasmid pTD1 insertion sequence ISS1. 61ACCESSION X62737 62VERSION X62737.1 GI:44030 63KEYWORDS insertion sequence; insertion sequence ISS1; transposase. 64SOURCE Lactococcus lactis. 65 ORGANISM Lactococcus lactis 66 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 67 Lactococcus. 68REFERENCE 1 (bases 1 to 808) 69 AUTHORS Schaefer,A., Jahns,A., Geis,A. and Teuber,M. 70 TITLE Distribution of the IS elements ISS1 and IS904 in lactococci 71 JOURNAL FEMS Microbiol. Lett. 80, 311-318 (1991) 72REFERENCE 2 (bases 1 to 808) 73 AUTHORS Schaefer,A. 74 TITLE Direct Submission 75 JOURNAL Submitted (13-JAN-1992) Schaefer A., Institut fuer Mikrobiologie, 76 Bundesanstalt fuer Milchforschung, D-2300 Kiel, FRG 77COMMENT See also M18290-4 & M37395-6. 78FEATURES Location/Qualifiers 79 source 1. .808 80 /organism="Lactococcus lactis" 81 /plasmid="pTD1" 82 /strain="W67" 83 /db_xref="taxon:1358" 84 /insertion_seq="ISS1" 85 repeat_region 1. .17 86 /rpt_type=INVERTED 87 -35_signal 8. .13 88 -10_signal 30. .35 89 RBS 61. .66 90 CDS 74. .754 91 /codon_start=1 92 /transl_table=11 93 /product="putative transposase" 94 /protein_id="CAA44601.1" 95 /db_xref="GI:44031" 96 /db_xref="SPTREMBL:Q04224" 97 /translation="MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYDRGINVCH 98 TTIYRWVQEYSKVLYYLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTLDI 99 WLRKKRDTQAAYAFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQSVGLYTKTEHRTVK 100 YLNNLIEQDHQPIKRRNKFCQSLRTASSTIKGIKTLRGIYKKNRRNGTLFGFSVSTEI 101 KVLMGITA" 102 repeat_region 791. .808 103 /rpt_type=INVERTED 104BASE COUNT 277 a 141 c 165 g 225 t 105ORIGIN 106>>>>LLISS1T 12/1992 107Z14022 L.lactis insertion sequence ISS1T. 12/1992 108LOCUS LLISS1T 1108 bp DNA linear BCT 15-DEC-1992 109DEFINITION L.lactis insertion sequence ISS1T. 110ACCESSION Z14022 111VERSION Z14022.1 GI:44032 112KEYWORDS insertion sequence; insertion sequence ISS1T. 113SOURCE Lactococcus lactis. 114 ORGANISM Lactococcus lactis 115 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 116 Lactococcus. 117REFERENCE 1 (bases 86 to 134; 849 to 891) 118 AUTHORS Gasson,M.J. and Swindell,S.R. 119 TITLE Molecular rearrangement of lactose plasmid DNA associated with high 120 frequency aggregation in Lactococcus lactis 712 121 JOURNAL Unpublished 122REFERENCE 2 (bases 1 to 1056) 123 AUTHORS Swindell,S.R. 124 TITLE Direct Submission 125 JOURNAL Submitted (08-JUL-1992) S.R. Swindell, Genetics & Microbiology, 126 Institute of Food Research, Norwich Research Park, Norwich, 127 Norfolk, NR4 7UA, ENGLAND 128FEATURES Location/Qualifiers 129 source 1. .1108 130 /organism="Lactococcus lactis" 131 /strain="Lactococcus lactis 712" 132 /db_xref="taxon:1358" 133 /clone="pFI341" 134 source 111. .867 135 /organism="Lactococcus lactis" 136 /insertion_seq="" 137 /db_xref="taxon:1358" 138BASE COUNT 381 a 187 c 204 g 336 t 139ORIGIN 140>>>>LLISTRA 11/1993 141X60594 L.lactis insertion sequence (plasmid pUCL22) gene for transposase. 11/1993 142LOCUS LLISTRA 934 bp DNA linear BCT 22-NOV-1993 143DEFINITION L.lactis insertion sequence (plasmid pUCL22) gene for transposase. 144ACCESSION X60594 S43267 145VERSION X60594.1 GI:44033 146KEYWORDS insertion sequence; transposase. 147SOURCE Lactococcus lactis. 148 ORGANISM Lactococcus lactis 149 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 150 Lactococcus. 151REFERENCE 1 (bases 1 to 934) 152 AUTHORS Huang,D.C. 153 TITLE Direct Submission 154 JOURNAL Submitted (07-AUG-1991) D.C. Huang, Lab de Genetique Microbienne, 155 Universite' de Caen, Esplanade de la Paix 14032, Caen Cedex, FRANCE 156REFERENCE 2 (bases 1 to 934) 157 AUTHORS Huang,D.C., Novel,M., Huang,X.F. and Novel,G. 158 TITLE Nonidentity between plasmid and chromosomal copies of ISS1-like 159 sequences in Lactococcus lactis subsp. lactis CNRZ270 and their 160 possible role in chromosomal integration of plasmid genes 161 JOURNAL Gene 118 (1), 39-46 (1992) 162 MEDLINE 92380489 163FEATURES Location/Qualifiers 164 source 1. .934 165 /organism="Lactococcus lactis" 166 /plasmid="" 167 /strain="Z270" 168 /db_xref="taxon:1358" 169 /clone="D472" 170 source 61. .868 171 /organism="Lactococcus lactis" 172 /insertion_seq="" 173 /db_xref="taxon:1358" 174 -35_signal 68. .73 175 -10_signal 90. .95 176 RBS 121. .126 177 CDS 134. .814 178 /note="orf1" 179 /codon_start=1 180 /transl_table=11 181 /protein_id="CAA43047.1" 182 /db_xref="GI:44034" 183 /db_xref="SPTREMBL:Q48649" 184 /translation="MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYDRGINVCH 185 TTIYRWVQEYSKVLYHLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTLDI 186 WLRKKRNTQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQSNGLYTKTEHRTVK 187 YLNNLIEQDHRPIKRRNKFYRSLQTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEI 188 KVLMGILA" 189 CDS complement(209. .394) 190 /note="orf3" 191 /codon_start=1 192 /transl_table=11 193 /protein_id="CAA43049.1" 194 /db_xref="GI:44036" 195 /db_xref="SPTREMBL:Q48651" 196 /translation="MPTTFDFDISFIHFPRIEGLSIFLFPEMIEDFTVFLYPTINSCV 197 TNINSTIIKEFLNFTIA" 198 CDS 240. .428 199 /note="orf2" 200 /codon_start=1 201 /transl_table=11 202 /protein_id="CAA43048.1" 203 /db_xref="GI:44035" 204 /db_xref="SPTREMBL:Q48650" 205 /translation="MIVELMFVTQLFIVGYKNTVKSSIISGKRKIDSPSIRGKWMKLI 206 SKSKVVGIISIVQLMRMD" 207 CDS complement(508. .630) 208 /note="orf4" 209 /codon_start=1 210 /transl_table=11 211 /protein_id="CAA43050.1" 212 /db_xref="GI:44037" 213 /db_xref="SPTREMBL:Q48652" 214 /translation="MRLLRYFTVRCSVLVYKPLLCNFLNAEPIEGALSVTITLG" 215BASE COUNT 340 a 150 c 174 g 270 t 216ORIGIN 217>>>>LLJ000883 11/1998 218AJ000883 Lactococcus lactis lactis purDEK operon. 11/1998 219LOCUS LLJ000883 3573 bp DNA linear BCT 17-NOV-1998 220DEFINITION Lactococcus lactis lactis purDEK operon. 221ACCESSION AJ000883 222VERSION AJ000883.1 GI:3892881 223KEYWORDS purDEK operon. 224SOURCE Lactococcus lactis. 225 ORGANISM Lactococcus lactis 226 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 227 Lactococcus. 228REFERENCE 1 (bases 1 to 3573) 229 AUTHORS Nilsson,D. and Kilstrup,M. 230 TITLE Cloning and expression of the Lactococcus lactis purDEK genes, 231 required for growth in milk 232 JOURNAL Appl. Environ. Microbiol. 64 (11), 4321-4327 (1998) 233 MEDLINE 99013630 234REFERENCE 2 (bases 1 to 3573) 235 AUTHORS Nilsson,D. 236 TITLE Direct Submission 237 JOURNAL Submitted (27-JAN-1998) Nilsson D., Department of Physiology and 238 Metabolism, Chr. Hansen A/S, Boege Alle 10-12,, DK-2970 Hoersholm, 239 DENMARK 240FEATURES Location/Qualifiers 241 source 1. .3573 242 /organism="Lactococcus lactis" 243 /strain="CHCC373" 244 /sub_species="lactis" 245 /db_xref="taxon:1358" 246 CDS complement(<1. .364) 247 /note="orf1" 248 /codon_start=1 249 /transl_table=11 250 /product="hypothetical protein" 251 /protein_id="CAA04373.1" 252 /db_xref="GI:3892882" 253 /translation="MATQPTKDKIISSSWELLEELTLTEFSMRKLASAVGMTVSSLYY 254 HFSSKEALFAELIDKASLEIIFPANEKTWQDRLFVYGKNIYTVLESYPNLAQLMMDYP 255 PESENYLRLFDKLLMIVDD" 256 gene join(563. .568,575. .3573) 257 /gene="purDEK" 258 -10_signal 563. .568 259 /gene="purDEK" 260 /citation=[1] 261 prim_transcript 575. .>3573 262 /gene="purDEK" 263 /citation=[1] 264 /evidence=experimental 265 gene 711. .715 266 /gene="purD" 267 RBS 711. .715 268 /gene="purD" 269 /citation=[1] 270 gene 720. .1958 271 /gene="purD" 272 CDS 720. .1958 273 /gene="purD" 274 /codon_start=1 275 /transl_table=11 276 /protein_id="CAA04374.1" 277 /db_xref="GI:3892883" 278 /translation="MKILVIGSGGREHALAKKFMESPQVEEVFVAPGNSGMEKDGIQI 279 VHISELSNDKLVKFAQNQNIGLTFVGPETALMNGVVDAFIKAELPIFGPNKMAAELEG 280 SKDFAKSIMKKYGVPTADYATFDSLEPALAYLDEKGVPLVIKADGLAAGKGVTVAFDI 281 ETAKSALADIFSGSQGKVVIEEFLDGEEFSLFSFIHDGKIYPMPIAQDHKRAFDEDKG 282 PNTGGMGAYSPVLHISKEVVNEALEKVVKPTVAGMIEEGKSFTGVLYAGLILTEDGVK 283 TIEFNARFGDPETQVVLPRLKSDLAQAIIDILAGNEPTLEWLESGVTLGVVVAAEGYP 284 SQAKLGLILPEIPEGLNVYYAGVSKNENNQLISSGGRVYLVSETGEDVKSTQKLLYEK 285 LDKLENDGFFYRHDIGSRAI" 286 gene 1982. .1986 287 /gene="purE" 288 RBS 1982. .1986 289 /gene="purE" 290 /citation=[1] 291 gene 1991. .2476 292 /gene="purE" 293 CDS 1991. .2476 294 /gene="purE" 295 /codon_start=1 296 /transl_table=11 297 /protein_id="CAA04375.1" 298 /db_xref="GI:3892884" 299 /translation="MAEVAIIMGCSSDWATMKETAKILDDFGLAYEKKVVSAHRTPAL 300 MAEFSSQARERGYKVIIAGAGGAAHLPGMVSAQTLVPVIGVPIKSRALSGLDSLYSIV 301 QMPAGVPVATMAIGEAGAKNAALFALQLLANTNENLIQKLLVYRAAAQEMVEESNKAL 302 L" 303 gene 2518. .2522 304 /gene="purK" 305 RBS 2518. .2522 306 /gene="purK" 307 /citation=[1] 308 gene 2527. .3573 309 /gene="purK" 310 CDS 2527. .>3573 311 /gene="purK" 312 /codon_start=1 313 /transl_table=11 314 /protein_id="CAA04376.1" 315 /db_xref="GI:3892885" 316 /translation="MIKNTKQTIGIIGGGQLGQMMAIAAQYMGHKVITLDPNPNCSAA 317 KVSDELIVAPYDDVENLLRLAYACDVITYEFENVSAKALHEIEGCVRIPQGIRLLEIT 318 QNRRFEKEFLTNEAKVNVAPWQLVDSAEKLPETVTRKQVLKTTTGGYDGHGQVVLNTD 319 EKLSAAKSLTELSECVLEDFISFEREISVIISGNGHEYVVFPLAENEHRENILHQTIS 320 PARISAEITENAYKIATSIAEKLELSGVLCVEMFLTADGQIYVNELAPRPHNSGHFTI 321 EACDFNQFDLHIKGILGEDLPEPKLLKPAIMLNVLGQHVEAVKKLNHEHADWHQHDYG 322 KADAKHNRKMGHVTI" 323BASE COUNT 1172 a 569 c 753 g 1079 t 324ORIGIN 325>>>>LLJ002203 8/2000 326AJ002203 Lactococcus lactis subsp. lactis plasmid pBL1 DNA for lactococcin 972 operon. 8/2000 327LOCUS LLJ002203 2455 bp DNA linear BCT 18-AUG-2000 328DEFINITION Lactococcus lactis subsp. lactis plasmid pBL1 DNA for lactococcin 329 972 operon. 330ACCESSION AJ002203 331VERSION AJ002203.2 GI:9795227 332KEYWORDS lactococcin 972; lcn972; operon. 333SOURCE Lactococcus lactis subsp. lactis. 334 ORGANISM Lactococcus lactis subsp. lactis 335 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 336 Lactococcus. 337REFERENCE 1 (bases 1 to 2455) 338 AUTHORS Martinez,B., Fernandez,M., Suarez,J.E. and Rodriguez,A. 339 TITLE Synthesis of lactococcin 972, a bacteriocin produced by Lactococcus 340 lactis IPLA 972, depends on the expression of a plasmid-encoded 341 bicistronic operon 342 JOURNAL Microbiology 145 (Pt 11), 3155-3161 (1999) 343 MEDLINE 20055640 344REFERENCE 2 (bases 1 to 2455) 345 AUTHORS Suarez,J.E. 346 TITLE Direct Submission 347 JOURNAL Submitted (26-JAN-1998) Suarez J.E., Microbiologia, Universidad de 348 Oviedo, Julian Claveria sn, 33006 Oviedo, SPAIN 349 REMARK Revised by [3] 350REFERENCE 3 (bases 1 to 2455) 351 AUTHORS Martinez,B. 352 TITLE Direct Submission 353 JOURNAL Submitted (07-AUG-2000) Martinez B.,Instituto de Productos Lacteos 354 de Asturias, CSIC Apdo. 85, 33300 Villaviciosa, SPAIN 355COMMENT On Aug 11, 2000 this sequence version replaced gi:3355781. 356 Related sequence AF242367. 357FEATURES Location/Qualifiers 358 source 1. .2455 359 /organism="Lactococcus lactis subsp. lactis" 360 /plasmid="pBL1" 361 /strain="IPLA 972" 362 /sub_species="lactis" 363 /db_xref="taxon:1360" 364 -35_signal 57. .62 365 /gene="lcn972" 366 /evidence=experimental 367 gene 57. .2455 368 /gene="lcn972" 369 -10_signal 80. .85 370 /gene="lcn972" 371 /evidence=experimental 372 prim_transcript 93. .456 373 /gene="lcn972" 374 /evidence=experimental 375 prim_transcript 93. .2455 376 /gene="lcn972" 377 /note="ORF2" 378 /evidence=experimental 379 stem_loop 126. .150 380 /gene="lcn972" 381 RBS 166. .171 382 /gene="lcn972" 383 CDS 178. .453 384 /gene="lcn972" 385 /function="bacteriocin" 386 /codon_start=1 387 /transl_table=11 388 /evidence=experimental 389 /product="lactococcin 972" 390 /protein_id="CAA05247.1" 391 /db_xref="GI:3355782" 392 /db_xref="SPTREMBL:O86283" 393 /translation="MKTKSLVLALSAVTLFSAGGIVAQAEGTWQHGYGVSSAYSNYHH 394 GSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW" 395 sig_peptide 178. .252 396 /gene="lcn972" 397 mat_peptide 253. .450 398 /gene="lcn972" 399 /function="bacteriocin" 400 /product="lactococcin 972" 401 terminator 456. .493 402 /gene="lcn972" 403 /evidence=experimental 404 RBS 498. .503 405 /gene="lcn972" 406 /note="ORF2" 407 CDS 509. .2455 408 /gene="lcn972" 409 /function="putative immunity" 410 /note="ORF2" 411 /codon_start=1 412 /transl_table=11 413 /protein_id="CAC03468.1" 414 /db_xref="GI:9795228" 415 /translation="MYKKLERVLITLSIVLVSAFSMIIVINKHKQMFAGTNGGVLVLK 416 AKSNIKESIAEIAKKNNVLIAKQIMVPSTDGKTDNQPTFQKFGNGTLPKDFPEQKNKE 417 FIEDSNDSVYYFIFGKTLSSIDLSKYLNEKGNTSMVSDNDWRFQGITALLDTRMIVGL 418 LLFLISYTSILMANIIINLKKQGVQRLAGISCFRLSFLGLKKRLTYIFITTIITLLTS 419 SLILYIINLRRIMYFYVIIFPTIFIVLVLLLIELIVGILVYLFLQRQKINLVIKDMAP 420 IRALMSFVFLLQLISLLCLIFSFSSISSSHKDLVLLKKATNKWKSQDYYSPSLLNGNT 421 EKSKENVLRFLSEANQKEEVLIIADNFNKYPLQNQYFPTSNGNENILYVTPNYLKKVG 422 IKFNNTMKSDITILVPETEKSRKNKLSTLWSQAFNSLNETSFSYNSSVYKSPSKDLFT 423 FRIFGWSAVDNQAFVQEPLIVVMSPKLFNINNKNINSDVLFSWFSREQILFSNNKTTA 424 DLIKKYRLENVLGSFSNGNLSVKNRFVEIKSQQLFIVVTSSIALISSTFLFYLMNKIY 425 LYQNRKKFAVARISGESLFTTHKTYLIQLFIIIIFAIGMIFIWHLNPLTLIIPPILGG 426 LQLILLTRQIKNNKTFNISVLKGE" 427BASE COUNT 890 a 354 c 350 g 861 t 428ORIGIN 429>>>>LLJW563RP 11/1995 430X85168 L.lactis plasmid pJW563 repB and ORFX genes. 11/1995 431LOCUS LLJW563RP 2297 bp DNA linear BCT 10-NOV-1995 432DEFINITION L.lactis plasmid pJW563 repB and ORFX genes. 433ACCESSION X85168 434VERSION X85168.1 GI:728598 435KEYWORDS orfX gene; repB gene. 436SOURCE Lactococcus lactis. 437 ORGANISM Lactococcus lactis 438 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 439 Lactococcus. 440REFERENCE 1 (bases 1 to 2297) 441 AUTHORS Gravesen,A., Josephsen,J., von Wright,A. and Vogensen,F.K. 442 TITLE Characterization of the replicon from the lactococcal 443 theta-replicating plasmid pJW563 444 JOURNAL Plasmid 34 (2), 105-118 (1995) 445 MEDLINE 96117602 446REFERENCE 2 (bases 1 to 2297) 447 AUTHORS Gravesen,A.L. 448 TITLE Direct Submission 449 JOURNAL Submitted (07-MAR-1995) A.L. Gravesen, The Royal Veterinary & 450 Agric. Univ., Dept of Dairy & Food Science, Rolighedsvej 30, 1958 451 Frederiksberg C, DENMARK 452FEATURES Location/Qualifiers 453 source 1. .2297 454 /organism="Lactococcus lactis" 455 /plasmid="pJW563" 456 /sub_species="cremoris" 457 /db_xref="taxon:1358" 458 /clone_lib="pAG34,35,36,37,38,39,40,41,43" 459 repeat_region 178. .199 460 /note="DRI" 461 /rpt_type=DIRECT 462 repeat_region 257. .337 463 /note="DRII" 464 /rpt_type=DIRECT 465 repeat_region 328. .354 466 /note="IR1" 467 /rpt_type=INVERTED 468 -35_signal 343. .347 469 -10_signal 365. .370 470 repeat_region 373. .414 471 /note="IR2" 472 /rpt_type=INVERTED 473 gene join(431. .436,446. .1603) 474 /gene="repB" 475 RBS 431. .436 476 /gene="repB" 477 CDS 446. .1603 478 /gene="repB" 479 /codon_start=1 480 /transl_table=11 481 /protein_id="CAA59451.1" 482 /db_xref="GI:728599" 483 /db_xref="SPTREMBL:Q48654" 484 /translation="MEIITKNDRNSNERTVCSLKEIEKRKIVEHNDLITSVAKMDKTP 485 LKIFELAVSCIDTENLPKDNIIYLSKKELFTFFDVSDNGKHTRFKEAVEKMQKQAFFE 486 IKEVKGKGYKVKSIVPIPYVEWNSYNDVVTLQFQPQIMPYLIELKKNFTKYALSDIMR 487 LNSKYSIILYKWLCMFYNQYEHYSVKGGRRAEQVETYRNPSIKISELRSLTDTINEYK 488 DMSNFTKRVLDNSLKEINHHTSFNVTYDKIKKGRSIDSIVFHIEKKRMADDNSYKLDD 489 RAYQEDKARKAETEDKLAIEAMKSKYTTLLLENMLLSPFEMQDTKIMAGLQAHVYPLY 490 DELKALRGLKGVKEHLSYVAAKQEAYSKRNVAKYLKKAIEQYLPTVKRQDL" 491 gene 1600. .2193 492 /gene="ORFX" 493 CDS 1600. .2193 494 /gene="ORFX" 495 /codon_start=1 496 /transl_table=11 497 /protein_id="CAA59452.1" 498 /db_xref="GI:728600" 499 /db_xref="SPTREMBL:Q48655" 500 /translation="MMSEKLKTIKELADEFNVSKQAVRKRLTEEFRANHVETVTSNGV 501 KTLVVTYTGYMLLKQHFTTSNATSNDKVTDTSNPTNADLSVVKILEQQLFVKDKQLEN 502 KDSQISQMQNLLDQQQRLALQDKKLIEEYKSEINELRALKMPQEDMKDGSPIRGEAQE 503 EIERLKAQLKLSEEERNKEKEKDRVKTESKKWWQLWK" 504BASE COUNT 901 a 352 c 441 g 603 t 505ORIGIN 506>>>>LLL216SRR 5/1998 507X97364 L.lyticum 16S rRNA gene, strain L2. 5/1998 508LOCUS LLL216SRR 1481 bp DNA linear BCT 06-MAY-1998 509DEFINITION L.lyticum 16S rRNA gene, strain L2. 510ACCESSION X97364 511VERSION X97364.1 GI:1310678 512KEYWORDS 16S ribosomal RNA; 16S rRNA. 513SOURCE Legionella lytica. 514 ORGANISM Legionella lytica 515 Bacteria; Proteobacteria; gamma subdivision; Legionellaceae group; 516 Legionellaceae; Legionella. 517REFERENCE 1 (bases 1 to 1481) 518 AUTHORS Birtles,R.J., Rowbotham,T.J., Raoult,D. and Harrison,T.G. 519 TITLE Phylogenetic diversity of intra-amoebal legionellae as revealed by 520 16S rRNA gene sequence comparison 521 JOURNAL Microbiology 142 (Pt 12), 3525-3530 (1996) 522 MEDLINE 97158243 523REFERENCE 2 (bases 1 to 1481) 524 AUTHORS Birtles,R.J. 525 TITLE Direct Submission 526 JOURNAL Submitted (19-APR-1996) R.J. Birtles, UNITE DES RICKETTSIES, CNRS 527 EP J0054, Fac. de Medicine, 27, bd Jean Moulin, F-13385 Marseille 528 Cedex 5, FRANCE 529FEATURES Location/Qualifiers 530 source 1. .1481 531 /organism="Legionella lytica" 532 /strain="L2" 533 /db_xref="taxon:96232" 534 rRNA 1. .1481 535 /gene="16S rRNA" 536 /product="16S ribosomal RNA" 537 gene 1. .1481 538 /gene="16S rRNA" 539BASE COUNT 394 a 317 c 468 g 302 t 540ORIGIN 541>>>>LLL5SRA 2/1999 542D90253 Leptonema illini 5S ribosomal RNA gene A. 2/1999 543LOCUS LLL5SRA 550 bp DNA linear BCT 07-FEB-1999 544DEFINITION Leptonema illini 5S ribosomal RNA gene A. 545ACCESSION D90253 546VERSION D90253.1 GI:216766 547KEYWORDS 5S ribosomal RNA. 548SOURCE Leptonema illini (strain:3055) DNA. 549 ORGANISM Leptonema illini 550 Bacteria; Spirochaetales; Leptospiraceae; Leptonema. 551REFERENCE 1 (bases 1 to 550) 552 AUTHORS Fukunaga,M., Horie,I., Mifuchi,I. and Takemoto,M. 553 TITLE Cloning, characterization and taxonomic significance of genes for 554 the 5S ribosomal RNA of Leptonema illini strain 3055 555 JOURNAL J. Gen. Microbiol. 137 (Pt 7), 1523-1528 (1991) 556 MEDLINE 92065221 557COMMENT These data kindly submitted in computer readable form by: Masahito 558 Fukunaga 559 Faculty of Pharmacy and Pharmaceutical Sciences 560 Fukuyama University 561 985 Higashimura-cho, Fukuyama 562 Hiroshima 729-02 563 Japan 564 Phone: 0849-36-2111 x5216 565 Fax: 0849-36-2213. 566FEATURES Location/Qualifiers 567 source 1. .550 568 /organism="Leptonema illini" 569 /strain="3055" 570 /db_xref="taxon:183" 571 -35_signal 216. .221 572 -10_signal 239. .243 573 rRNA 251. .357 574 /note="5S ribosomal RNA gene A" 575BASE COUNT 125 a 148 c 127 g 150 t 576ORIGIN 28 bp upstream of PvuII site. 577>>>>LLL5SRB 2/1999 578D90254 Leptonema illini 5S ribosomal RNA gene B. 2/1999 579LOCUS LLL5SRB 550 bp DNA linear BCT 07-FEB-1999 580DEFINITION Leptonema illini 5S ribosomal RNA gene B. 581ACCESSION D90254 582VERSION D90254.1 GI:216767 583KEYWORDS 5S ribosomal RNA. 584SOURCE Leptonema illini (strain:3055) DNA. 585 ORGANISM Leptonema illini 586 Bacteria; Spirochaetales; Leptospiraceae; Leptonema. 587REFERENCE 1 (bases 1 to 550) 588 AUTHORS Fukunaga,M., Horie,I., Mifuchi,I. and Takemoto,M. 589 TITLE Cloning, characterization and taxonomic significance of genes for 590 the 5S ribosomal RNA of Leptonema illini strain 3055 591 JOURNAL J. Gen. Microbiol. 137 (Pt 7), 1523-1528 (1991) 592 MEDLINE 92065221 593COMMENT These data kindly submitted in computer readable form by: Masahito 594 Fukunaga 595 Faculty of Pharmacy and Pharmaceutical Sciences 596 Fukuyama University 597 985 Higashimura-cho, Fukuyama 598 Hiroshima 729-02 599 Japan 600 Phone: 0849-36-2111 x5216 601 Fax: 0849-36-2213. 602FEATURES Location/Qualifiers 603 source 1. .550 604 /organism="Leptonema illini" 605 /strain="3055" 606 /db_xref="taxon:183" 607 -35_signal 216. .221 608 -10_signal 239. .243 609 rRNA 251. .357 610 /note="5S ribosomal RNA gene B" 611BASE COUNT 123 a 145 c 117 g 165 t 612ORIGIN 38 bp upstream of StuI site. 613>>>>LLLACA 4/1996 614X81358 L.lactis lacA gene. 4/1996 615LOCUS LLLACA 784 bp DNA linear BCT 15-APR-1996 616DEFINITION L.lactis lacA gene. 617ACCESSION X81358 618VERSION X81358.1 GI:1263134 619KEYWORDS galactoside O-acetyltransferase; lacA gene. 620SOURCE Lactococcus lactis. 621 ORGANISM Lactococcus lactis 622 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 623 Lactococcus. 624REFERENCE 1 (bases 1 to 784) 625 AUTHORS Griffin,H.G. and Gasson,M.J. 626 TITLE The gene (1acA) encoding galactoside acetyltransferase from 627 Lactococcus lactis 628 JOURNAL Biotechnol. Lett. 16, 1125-1130 (1994) 629REFERENCE 2 (bases 1 to 784) 630 AUTHORS Griffin,H.G. 631 TITLE Direct Submission 632 JOURNAL Submitted (02-SEP-1994) H.G. Griffin, Institute of Food Research, 633 Norwich Research Park, Colney, Norwich NR4 7UA, UK 634COMMENT Related sequence: X80037. 635FEATURES Location/Qualifiers 636 source 1. .784 637 /organism="Lactococcus lactis" 638 /strain="ATCC7962" 639 /db_xref="taxon:1358" 640 RBS 10. .16 641 gene 25. .648 642 /gene="lacA" 643 CDS 25. .648 644 /gene="lacA" 645 /EC_number="2.3.1.18" 646 /codon_start=1 647 /transl_table=11 648 /product="galactoside O-acetyltransferase" 649 /protein_id="CAA57126.1" 650 /db_xref="GI:1263135" 651 /db_xref="SWISS-PROT:P52984" 652 /translation="MPKLESYKRVHTEELYFPNDQKLWKEQQEALVLLEKFNQTSVTQ 653 PEQQMELLKKMFSEIGENCFIQPPFYANFGGKNVHFGTGIYANFNLTLVDDTDIFVGN 654 HVMFGPNVTIDTATHPVSPDLRKRGAQYNKKVYIEENVWLGAGVIVLPGVRIGKNSVI 655 GAGSLVTKDIPDNVVAFGTPCMVKRKINDSDFKTYDHGKKIDLDEFI" 656BASE COUNT 273 a 109 c 163 g 239 t 657ORIGIN 658>>>>LLLACZ 10/1996 659X80037 Lactococcus lactis lacZ gene. 10/1996 660LOCUS LLLACZ 3071 bp DNA linear BCT 07-OCT-1996 661DEFINITION Lactococcus lactis lacZ gene. 662ACCESSION X80037 663VERSION X80037.1 GI:1556405 664KEYWORDS beta-D-galactosidase; lacz gene. 665SOURCE Lactococcus lactis. 666 ORGANISM Lactococcus lactis 667 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 668 Lactococcus. 669REFERENCE 1 (bases 1 to 3071) 670 AUTHORS Griffin,H.G., MacCormick,C.A. and Gasson,M.J. 671 TITLE Cloning and analysis of a gene expressing a temperature-sensitive 672 beta-galactosidase from lactococcus lactis 673 JOURNAL DNA Seq. In press 674REFERENCE 2 (bases 1 to 3071) 675 AUTHORS Griffin,H.G. 676 TITLE Direct Submission 677 JOURNAL Submitted (05-JUL-1994) H.G. Griffin, Institute of Food Research, 678 Norwich Research Park, Colney, Norwich NR4 7UA, UK 679FEATURES Location/Qualifiers 680 source 1. .3071 681 /organism="Lactococcus lactis" 682 /strain="ATCC7962" 683 /db_xref="taxon:1358" 684 RBS 24. .30 685 /gene="lacZ" 686 gene 24. .3027 687 /gene="lacZ" 688 CDS 37. .3027 689 /gene="lacZ" 690 /codon_start=1 691 /transl_table=11 692 /product="beta-D-galactosidase" 693 /protein_id="CAA56341.1" 694 /db_xref="GI:1556406" 695 /db_xref="SWISS-PROT:Q48727" 696 /translation="MMTMIDVLERKDWENPVVSNWNRLPMHTPMDFLEKQSLNGLWNF 697 DHFSRISDVPKNWLELTESKTEIIVPSNWQIEFKDKSDVPIYTNVTYPIPIQPPYVPE 698 ANPVGAYSRYFDITKEWLESGHVHLTFEGVGSAFHFWLNGEYGGYSEDSRLPAEFDIS 699 NLAKEGQNCLKVLVFRWSKGTYFEDQDMWRMSGIFRSVNLQWLPDNYLLDFSIKTDLD 700 EDLDFANVKLQAYAKNMDDACLEFKLYDDEQLIGECHGFDAEIGVVNPKLWSDEIPYL 701 YRLELTLMDRSGAVFHKETKKIGIRKIAIEKGQLKINGKALLVRGVNKHEFTPEHGYV 702 VSEEVMIKDIKLMKEHNFNAVRCSHYPNDSRWYELCDEYGLYVMDEANIETHGMTPMN 703 RLTNDPTYLPLMSERVTRMVMRDRNHPSIIIWSLGNESGYGSNHQALYDWCKSFDSSR 704 PVHYEGGDDASRGATDATDIICPMYARVDSPSINAPYSLKTWMGVAGENRPLILCEYA 705 HDMGNSLGGFGKYWQAFREIDRLQGGFIWDWVDQGLLKDGNYAYGGDFGDKPNDRQFS 706 LNGLVFPNRQAKPALREAKYWQQYYQFELEKTPLGQVFAFTVTNEYLFRSTDNEKLCY 707 QLTNGLEVLWENELILNMPAGGSMRIDLSELPIDGTDNLFLNIQVKTIEKYNLLESDF 708 EVAHQQFVLQEKINFTDKIDSNEEITLLEDEELLTVRSAKQKFIFNKSNGNLSRWLDE 709 KGNEKLLHELSEQFTRAPLDNDIGVSEVEHIDPNAWLERWKAVGFYELKTLLKNMIIQ 710 ATENEVIISVQTDYEAKGKIAFSTIREYHIFRNGELLLKVDFKRNIEFPEPARIGLSL 711 QLAEKAENVTYFGLGPDENYPDRRGASLFGQWNLRITDMTTPYIFPSENGLRMETREL 712 NYGRLKVRAMGQSFAFNLSPYSQNQLAKKGHWHLLEEEAGTWLNIDGFHMGVGGDDSW 713 SPSVAQEYLLTKGNYHYEVSFKLT" 714BASE COUNT 1020 a 430 c 667 g 954 t 715ORIGIN 716>>>>LLLCPJ 9/1996 717X89503 L.lactis DNA for lcp J gene. 9/1996 718LOCUS LLLCPJ 400 bp DNA linear BCT 11-SEP-1996 719DEFINITION L.lactis DNA for lcp J gene. 720ACCESSION X89503 721VERSION X89503.1 GI:1536913 722KEYWORDS bacteriocin J46; lcp J gene. 723SOURCE Lactococcus lactis. 724 ORGANISM Lactococcus lactis 725 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 726 Lactococcus. 727REFERENCE 1 (bases 1 to 400) 728 AUTHORS Huot,E., Meghrous,J., Barrena-Gonzalez,C. and Petitdemange,H. 729 TITLE Bacteriocin J46, a new bacteriocin produced by Lactococcus lactis 730 subsp. cremoris J46 : isolation and characterization of the protein 731 and its gene 732 JOURNAL Anaerobe 2, 137-145 (1996) 733REFERENCE 2 (bases 1 to 400) 734 AUTHORS Petitdemange,H. 735 TITLE Direct Submission 736 JOURNAL Submitted (10-JUL-1995) H. Petitdemange, Laboratoire de chimie 737 biologique 1, Boulevard des Aiguillettes, BP 239 Faculte des 738 Sciences, F- 54506 Vandoeuvre-Les-Nancy Cedex, FRANCE 739FEATURES Location/Qualifiers 740 source 1. .400 741 /organism="Lactococcus lactis" 742 /strain="J46" 743 /sub_species="cremoris" 744 /db_xref="taxon:1358" 745 gene 62. .351 746 /gene="lcp J" 747 -35_signal 62. .67 748 /gene="lcp J" 749 TATA_signal 85. .90 750 /gene="lcp J" 751 RBS 132. .135 752 /gene="lcp J" 753 CDS 145. .300 754 /gene="lcp J" 755 /codon_start=1 756 /transl_table=11 757 /product="bacteriocin J46" 758 /protein_id="CAA61674.1" 759 /db_xref="GI:1536914" 760 /db_xref="SPTREMBL:P71449" 761 /translation="MKEQNSFNLLQEVTESELDLILGAKGGSGVIHTISHEVIYNSWN 762 FVFTCCS" 763 sig_peptide 145. .216 764 /gene="lcp J" 765 terminator 328. .351 766 /gene="lcp J" 767BASE COUNT 145 a 51 c 69 g 135 t 768ORIGIN 769>>>>LLLCT 9/1993 770X71410 L.lactis gene for lacticin 481. 9/1993 771LOCUS LLLCT 1345 bp DNA linear BCT 24-SEP-1993 772DEFINITION L.lactis gene for lacticin 481. 773ACCESSION X71410 774VERSION X71410.1 GI:296368 775KEYWORDS lacticin; lantibiotic; lct gene; structural gene. 776SOURCE Lactococcus lactis. 777 ORGANISM Lactococcus lactis 778 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 779 Lactococcus. 780REFERENCE 1 (bases 1 to 1345) 781 AUTHORS Piard,J. 782 TITLE Direct Submission 783 JOURNAL Submitted (13-APR-1993) J. Piard, Lab de Genetique Microbienne, 784 Institut de Biotechnologie, INRA, 78350 Jouy en Josas, FRANCE 785REFERENCE 2 (bases 1 to 1345) 786 AUTHORS Piard,J.C., Kuipers,O.P., Rollema,H.S., Desmazeaud,M.J. and de 787 Vos,W.M. 788 TITLE Structure, organization, and expression of the lct gene for 789 lacticin 481, a novel lantibiotic produced by Lactococcus lactis 790 JOURNAL J. Biol. Chem. 268 (22), 16361-16368 (1993) 791 MEDLINE 93346379 792FEATURES Location/Qualifiers 793 source 1. .1345 794 /organism="Lactococcus lactis" 795 /strain="CNRZ481" 796 /sub_species="lactis" 797 /db_xref="taxon:1358" 798 -35_signal 729. .734 799 -10_signal 752. .757 800 mRNA 764. .>1345 801 RBS 798. .801 802 /note="putative" 803 gene 811. .966 804 /gene="lct" 805 sig_peptide 811. .882 806 /gene="lct" 807 CDS 811. .966 808 /gene="lct" 809 /codon_start=1 810 /transl_table=11 811 /protein_id="CAA50534.1" 812 /db_xref="GI:296369" 813 /db_xref="SWISS-PROT:P36499" 814 /translation="MKEQNSFNLLQEVTESELDLILGAKGGSGVIHTISHECNMNSWQ 815 FVFTCCS" 816 mat_peptide 883. .963 817 /gene="lct" 818 /product="lacticin 481" 819 repeat_region 994. .1017 820 /note="putative rho-independant transcription terminator" 821 /rpt_type=INVERTED 822BASE COUNT 487 a 185 c 219 g 454 t 823ORIGIN 824>>>>LLLLAP316 5/1998 825X97358 L.lyticum 16S rRNA gene, strain LLAP3. 5/1998 826LOCUS LLLLAP316 1466 bp DNA linear BCT 06-MAY-1998 827DEFINITION L.lyticum 16S rRNA gene, strain LLAP3. 828ACCESSION X97358 829VERSION X97358.1 GI:1310679 830KEYWORDS 16S ribosomal RNA; 16S rRNA. 831SOURCE Legionella lytica. 832 ORGANISM Legionella lytica 833 Bacteria; Proteobacteria; gamma subdivision; Legionellaceae group; 834 Legionellaceae; Legionella. 835REFERENCE 1 (bases 1 to 1466) 836 AUTHORS Birtles,R.J., Rowbotham,T.J., Raoult,D. and Harrison,T.G. 837 TITLE Phylogenetic diversity of intra-amoebal legionellae as revealed by 838 16S rRNA gene sequence comparison 839 JOURNAL Microbiology 142 (Pt 12), 3525-3530 (1996) 840 MEDLINE 97158243 841REFERENCE 2 (bases 1 to 1466) 842 AUTHORS Birtles,R.J. 843 TITLE Direct Submission 844 JOURNAL Submitted (19-APR-1996) R.J. Birtles, UNITE DES RICKETTSIES, CNRS 845 EP J0054, Fac. de Medicine, 27, bd Jean Moulin, F-13385 Marseille 846 Cedex 5, FRANCE 847FEATURES Location/Qualifiers 848 source 1. .1466 849 /organism="Legionella lytica" 850 /strain="LLAP3" 851 /db_xref="taxon:96232" 852 rRNA 1. .1466 853 /gene="16S rRNA" 854 /product="16S ribosomal RNA" 855 gene 1. .1466 856 /gene="16S rRNA" 857BASE COUNT 387 a 316 c 463 g 300 t 858ORIGIN 859>>>>LLLMRP 11/1995 860X89779 L.lactis DNA for LmrP gene. 11/1995 861LOCUS LLLMRP 2019 bp DNA linear BCT 06-NOV-1995 862DEFINITION L.lactis DNA for LmrP gene. 863ACCESSION X89779 864VERSION X89779.1 GI:1052753 865KEYWORDS integral membrane protein; lmrP gene. 866SOURCE Lactococcus lactis. 867 ORGANISM Lactococcus lactis 868 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 869 Lactococcus. 870REFERENCE 1 (bases 1 to 2019) 871 AUTHORS Bolhuis,H., Poelarends,G., van Veen,H.W., Poolman,B., Driessen,A.J. 872 and Konings,W.N. 873 TITLE The Lactococcal lmrP gene encodes a proton motive force-dependent 874 drug transporter 875 JOURNAL J. Biol. Chem. 270 (44), 26092-26098 (1995) 876 MEDLINE 96064673 877REFERENCE 2 (bases 1 to 2019) 878 AUTHORS Bolhuis,H. 879 TITLE Direct Submission 880 JOURNAL Submitted (12-JUL-1995) H. Bolhuis, University of Groningen, 881 Department of Microbiology, Kerklaan 30, NL-9751 NN Haren, 882 NETHERLANDS 883FEATURES Location/Qualifiers 884 source 1. .2019 885 /organism="Lactococcus lactis" 886 /strain="MG1363" 887 /sub_species="lactis" 888 /db_xref="taxon:1358" 889 -35_signal 417. .422 890 -10_signal 439. .444 891 RBS 625. .628 892 gene 634. .1860 893 /gene="lmrP" 894 CDS 634. .1860 895 /gene="lmrP" 896 /codon_start=1 897 /transl_table=11 898 /product="LmrP integral membrane protein" 899 /protein_id="CAA61918.1" 900 /db_xref="GI:1052754" 901 /db_xref="SPTREMBL:Q48658" 902 /translation="MKEFWNLDKNLQLRLGIVFLGAFSYGTVFSSMTIYYNQYLGSAI 903 TGILLALSAVATFVAGILAGFFADRNGRKPVMVFGTIIQLLGAALAIASNLPGHVNPW 904 STFIAFLLISFGYNFVITAGNAMIIDASNAENRKVVFMLDYWAQNLSVILGAALGAWL 905 FRPAFEALLVILLLTVLVSFFLTTFVMTETFKPTVKVDEKAENIFQAYKTVLQDKTYM 906 IFMGANIATTFIIMQFDNFLPVHLSNSFKTITFWGFEIYGQRMLTIYLILACVLVVLL 907 MTTLNRLTKDWSHQKGFIWGSLFMAIGMIFSFLTTTFTPIFIAGIVYTLGEIVYTPSV 908 QTLGADLMNPEKIGSYNGVAAIKMPIASILAGLLVSISPMIKAIGVSLVLALTEVLAI 909 ILVLVAVNRHQKTKLN" 910 terminator 1888. .1910 911BASE COUNT 633 a 286 c 349 g 751 t 912ORIGIN 913>>>>LLLNISZ 10/1999 914Y13384 Lactococcus lactis nisZ gene and 3 ORF's. 10/1999 915LOCUS LLLNISZ 2778 bp DNA linear BCT 27-OCT-1999 916DEFINITION Lactococcus lactis nisZ gene and 3 ORF's. 917ACCESSION Y13384 918VERSION Y13384.1 GI:3157416 919KEYWORDS Nisin Z; NisZ gene. 920SOURCE Lactococcus lactis subsp. lactis. 921 ORGANISM Lactococcus lactis subsp. lactis 922 Bacteria; Firmicutes; Bacillus/Clostridium group; Streptococcaceae; 923 Lactococcus. 924REFERENCE 1 (bases 1 to 2778) 925 AUTHORS Immonen,T., Wahlstrom,G., Takala,T. and Saris,P.E. 926 TITLE Evidence for a mosaic structure of the Tn5481 in Lactococcus lactis 927 N8 928 JOURNAL DNA Seq. 9 (5-6), 245-261 (1998) 929 MEDLINE 99452384 930REFERENCE 2 (bases 1 to 2778) 931 AUTHORS Immonen,T. 932 TITLE Direct Submission 933 JOURNAL Submitted (27-MAY-1997) T. Immonen, Institute Of Biotechnology, 934 Biocenter 1, Viikinkaari 9, P.O.Box 56, 00014 University Of 935 Helsinki, FINLAND 936FEATURES Location/Qualifiers 937 source 1. .2778 938 /organism="Lactococcus lactis subsp. lactis" 939 /strain="N8" 940 /db_xref="taxon:1360" 941 /clone="pLEB506" 942 /clone="pLEB461" 943 /clone="pLEB462" 944 /clone="pLEB41" 945 /clone="pLEB43" 946 CDS complement(<1. .423) 947 /codon_start=1 948 /transl_table=11 949 /product="homologous to branched chain amino acid 950 transporters of LIV-II class" 951 /protein_id="CAA73811.1" 952 /db_xref="GI:3157417" 953 /db_xref="SPTREMBL:O69437" 954 /translation="MEEKLAGKDYLFIGSMLFGLFFGAGNLIFPIHMGQEAGAAISQA 955 NFGFLITAVGFPFLGIIALGISQSNGVFELASRVNRIYAYIFTILLYLVIGPFFALPR 956 LATTSFEIGISPFLSHELQAPLLALFSILFFGTAWFLSR" 957 CDS complement(660. .977) 958 /codon_start=1 959 /transl_table=11 960 /product="YjdJ-like protein" 961 /protein_id="CAA73812.1" 962 /db_xref="GI:3157418" 963 /db_xref="SPTREMBL:O69438" 964 /translation="MPFWSTKIFGEGEKLMNIIERENLFELLSDKGEIIGEMAYMPMN 965 NSIIITHTGVSLDYRGQGLAKKLVLAGIQKARREQLKLGATCPYAVKYFREHKEELTD 966 VLK" 967 CDS complement(932. .1204) 968 /codon_start=1 969 /transl_table=11 970 /product="YjdI-like protein" 971 /protein_id="CAA73813.1" 972 /db_xref="GI:3157419" 973 /db_xref="SPTREMBL:O69439" 974 /translation="MDNSKLFGEAANEEQLLKNDYRKYCGENMDIYYNVAICEHAGEC 975 VRGNPLVFEVSRKPWIIPDNGDVASNQSVINRCPSGALKYLAKEKN" 976 gene 2605. .2778 977 /gene="nisZ" 978 CDS 2605. .2778 979 /gene="nisZ" 980 /codon_start=1 981 /transl_table=11 982 /product="nisin Z" 983 /protein_id="CAA73814.1" 984 /db_xref="GI:3157420" 985 /translation="MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNM 986 KTATCNCSIHVSK" 987BASE COUNT 1020 a 399 c 436 g 923 t 988ORIGIN 989