1msgid "" 2msgstr "" 3"Project-Id-Version: \n" 4"POT-Creation-Date: \n" 5"PO-Revision-Date: 2007-06-05 09:18+0100\n" 6"Last-Translator: Darius Blaszijk <dhkblaszyk@zeelandnet.nl>\n" 7"Language-Team: \n" 8"MIME-Version: 1.0\n" 9"Content-Type: text/plain; charset=UTF-8\n" 10"Content-Transfer-Encoding: 8bit\n" 11 12#: lazarusidestrconsts.dbgbreakgroupdlgcaption 13msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption" 14msgid "Select Groups" 15msgstr "" 16 17#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable 18msgid "Select groups to disable when breakpoint is hit" 19msgstr "" 20 21#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable 22msgid "Select groups to enable when breakpoint is hit" 23msgstr "" 24 25#: lazarusidestrconsts.dbgbreakpropertygroupnotfound 26#, object-pascal-format 27msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s" 28msgstr "" 29 30#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint 31#, object-pascal-format 32msgid "Address Breakpoint %s" 33msgstr "" 34 35#: lazarusidestrconsts.dbgeventbreakataddress 36#, object-pascal-format 37msgid "at $%s" 38msgstr "" 39 40#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline 41#, object-pascal-format 42msgid "at $%s: from origin %s line %d" 43msgstr "" 44 45#: lazarusidestrconsts.dbgeventbreakataddresssourceline 46#, object-pascal-format 47msgid "at $%s: %s line %d" 48msgstr "" 49 50#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint 51#, object-pascal-format 52msgid "Source Breakpoint %s" 53msgstr "" 54 55#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint 56#, object-pascal-format 57msgid "Unknown Breakpoint %s" 58msgstr "" 59 60#: lazarusidestrconsts.dbgeventbreakwatchpoint 61#, object-pascal-format 62msgid "Watchpoint %s" 63msgstr "" 64 65#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended 66#, object-pascal-format 67msgid "Unknown Watchpoint out of scope %s" 68msgstr "" 69 70#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered 71#, object-pascal-format 72msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\"" 73msgstr "" 74 75#: lazarusidestrconsts.dbgeventwatchscopeended 76#, object-pascal-format 77msgid "Watchpoint for \"%s\" out of scope %s" 78msgstr "" 79 80#: lazarusidestrconsts.dbgeventwatchtriggered 81#, object-pascal-format 82msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\"" 83msgstr "" 84 85#: lazarusidestrconsts.dlfmousepredefinedscheme 86msgid "Use predefined scheme" 87msgstr "" 88 89#: lazarusidestrconsts.dlfmouseresetall 90msgid "Reset all settings" 91msgstr "" 92 93#: lazarusidestrconsts.dlfmouseresetgutter 94msgid "Reset all gutter settings" 95msgstr "" 96 97#: lazarusidestrconsts.dlfmouseresettext 98msgid "Reset all text settings" 99msgstr "" 100 101#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint 102msgid "Add history point" 103msgstr "" 104 105#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu 106msgid "Context Menu" 107msgstr "" 108 109#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg 110msgid "Context Menu (debug)" 111msgstr "" 112 113#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab 114msgid "Context Menu (tab)" 115msgstr "" 116 117#: lazarusidestrconsts.dlfmousesimplebuttondeclaration 118msgid "Jumps to implementation" 119msgstr "" 120 121#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock 122msgid "Jumps to implementation/other block end" 123msgstr "" 124 125#: lazarusidestrconsts.dlfmousesimplebuttonhistback 126msgid "History back" 127msgstr "" 128 129#: lazarusidestrconsts.dlfmousesimplebuttonhistforw 130msgid "History forward" 131msgstr "" 132 133#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle 134msgid "Toggle extra Caret" 135msgstr "" 136 137#: lazarusidestrconsts.dlfmousesimplebuttonnothing 138msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing" 139msgid "Nothing/Default" 140msgstr "" 141 142#: lazarusidestrconsts.dlfmousesimplebuttonpaste 143msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste" 144msgid "Paste" 145msgstr "Plakken" 146 147#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue 148#, object-pascal-format 149msgid "Continue %0:s (Bound to: %1:s)" 150msgstr "" 151 152#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain 153#, object-pascal-format 154msgid "Continue %0:s" 155msgstr "" 156 157#: lazarusidestrconsts.dlfmousesimplebuttonselect 158msgid "Select text" 159msgstr "" 160 161#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline 162msgid "Select text (lines)" 163msgstr "" 164 165#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken 166msgid "Select text (tokens)" 167msgstr "" 168 169#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword 170msgid "Select text (words)" 171msgstr "" 172 173#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn 174msgid "Select text (Column mode)" 175msgstr "" 176 177#: lazarusidestrconsts.dlfmousesimplebuttonselectline 178msgid "Select text (Line mode)" 179msgstr "" 180 181#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark 182msgid "Set free bookmark" 183msgstr "" 184 185#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull 186msgid "Select current Line (Full)" 187msgstr "" 188 189#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart 190msgid "Select current Line (Text)" 191msgstr "" 192 193#: lazarusidestrconsts.dlfmousesimplebuttonsetpara 194msgid "Select current Paragraph" 195msgstr "" 196 197#: lazarusidestrconsts.dlfmousesimplebuttonsetword 198msgid "Select current Word" 199msgstr "" 200 201#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset 202msgid "Reset zoom" 203msgstr "" 204 205#: lazarusidestrconsts.dlfmousesimplediff 206msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes" 207msgstr "" 208 209#: lazarusidestrconsts.dlfmousesimplegenericsect 210msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect" 211msgid "General" 212msgstr "Algemeen" 213 214#: lazarusidestrconsts.dlfmousesimplegutterleftdown 215msgid "Standard, All actions (breakpoint, fold) on mouse down" 216msgstr "" 217 218#: lazarusidestrconsts.dlfmousesimplegutterleftup 219msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move" 220msgstr "" 221 222#: lazarusidestrconsts.dlfmousesimplegutterleftupright 223msgid "Extended, Actions, right gutter half only" 224msgstr "" 225 226#: lazarusidestrconsts.dlfmousesimplegutterlines 227msgid "Use line numbers to select lines" 228msgstr "" 229 230#: lazarusidestrconsts.dlfmousesimpleguttersect 231msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect" 232msgid "Gutter" 233msgstr "" 234 235#: lazarusidestrconsts.dlfmousesimplerightmovecaret 236msgid "Right button click includes caret move" 237msgstr "" 238 239#: lazarusidestrconsts.dlfmousesimpletextsect 240msgctxt "lazarusidestrconsts.dlfmousesimpletextsect" 241msgid "Text" 242msgstr "Tekst" 243 244#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel 245msgid "Alt-Ctrl Button" 246msgstr "" 247 248#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel 249msgid "Alt-Ctrl Wheel" 250msgstr "" 251 252#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel 253msgid "Alt Button" 254msgstr "" 255 256#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel 257msgid "Alt Wheel" 258msgstr "" 259 260#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel 261msgid "Ctrl Button" 262msgstr "" 263 264#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel 265msgid "Ctrl Wheel" 266msgstr "" 267 268#: lazarusidestrconsts.dlfmousesimpletextsectdrag 269msgid "Drag selection (copy/paste)" 270msgstr "" 271 272#: lazarusidestrconsts.dlfmousesimpletextsectextra1label 273msgid "Extra-1 Button" 274msgstr "" 275 276#: lazarusidestrconsts.dlfmousesimpletextsectextra2label 277msgid "Extra-2 Button" 278msgstr "" 279 280#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel 281msgid "Alt Double" 282msgstr "" 283 284#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel 285msgid "Ctrl Double" 286msgstr "" 287 288#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel 289msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel" 290msgid "Double" 291msgstr "" 292 293#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel 294msgid "Shift Double" 295msgstr "" 296 297#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel 298msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel" 299msgid "Quad" 300msgstr "" 301 302#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel 303msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel" 304msgid "Triple" 305msgstr "" 306 307#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel 308msgid "Middle Button" 309msgstr "" 310 311#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn 312msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn" 313msgid "Middle" 314msgstr "" 315 316#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1 317msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1" 318msgid "Extra 1" 319msgstr "" 320 321#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2 322msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2" 323msgid "Extra 2" 324msgstr "" 325 326#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel 327msgid "Horizontal-Wheel" 328msgstr "" 329 330#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod 331msgid "Left 1" 332msgstr "" 333 334#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti 335msgid "Left 2" 336msgstr "" 337 338#: lazarusidestrconsts.dlfmousesimpletextsectpageright 339msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright" 340msgid "Right" 341msgstr "Rechts" 342 343#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel 344msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel" 345msgid "Wheel" 346msgstr "" 347 348#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel 349msgid "Right Button" 350msgstr "" 351 352#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel 353msgid "Shift-Alt-Ctrl Button" 354msgstr "" 355 356#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel 357msgid "Shift-Alt-Ctrl" 358msgstr "" 359 360#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel 361msgid "Shift-Alt Button" 362msgstr "" 363 364#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel 365msgid "Shift-Alt Wheel" 366msgstr "" 367 368#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel 369msgid "Shift-Ctrl Button" 370msgstr "" 371 372#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel 373msgid "Shift-Ctrl Wheel" 374msgstr "" 375 376#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel 377msgid "Shift Button" 378msgstr "" 379 380#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel 381msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel" 382msgid "Wheel" 383msgstr "" 384 385#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel 386msgid "Shift Wheel" 387msgstr "" 388 389#: lazarusidestrconsts.dlfmousesimplewarning 390msgid "You have unsaved changes. Using this page will undo changes made on the advanced page" 391msgstr "" 392 393#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef 394msgid "Scroll horizontal (System speed)" 395msgstr "" 396 397#: lazarusidestrconsts.dlfmousesimplewheelhsrollline 398msgid "Scroll horizontal (Single line)" 399msgstr "" 400 401#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage 402msgid "Scroll horizontal (Page)" 403msgstr "" 404 405#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf 406msgid "Scroll horizontal (Half page)" 407msgstr "" 408 409#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless 410msgid "Scroll horizontal (Page, less one line)" 411msgstr "" 412 413#: lazarusidestrconsts.dlfmousesimplewheelnothing 414msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing" 415msgid "Nothing/Default" 416msgstr "" 417 418#: lazarusidestrconsts.dlfmousesimplewheelsrolldef 419msgid "Scroll (System speed)" 420msgstr "" 421 422#: lazarusidestrconsts.dlfmousesimplewheelsrollline 423msgid "Scroll (Single line)" 424msgstr "" 425 426#: lazarusidestrconsts.dlfmousesimplewheelsrollpage 427msgid "Scroll (Page)" 428msgstr "" 429 430#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf 431msgid "Scroll (Half page)" 432msgstr "" 433 434#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless 435msgid "Scroll (Page, less one line)" 436msgstr "" 437 438#: lazarusidestrconsts.dlfmousesimplewheelzoom 439msgid "Zoom" 440msgstr "" 441 442#: lazarusidestrconsts.dlfnopredefinedscheme 443msgid "< None >" 444msgstr "" 445 446#: lazarusidestrconsts.dlfreadonlycolor 447msgctxt "lazarusidestrconsts.dlfreadonlycolor" 448msgid "Read Only" 449msgstr "Niet wijzigbaar" 450 451#: lazarusidestrconsts.dlg1up2low 452msgid "Lowercase, first letter up" 453msgstr "Kleine letters, eerste letter hoofdletter" 454 455#: lazarusidestrconsts.dlgactivedesktop 456msgid "active" 457msgstr "" 458 459#: lazarusidestrconsts.dlgaddassignmentoperator 460msgid "Add assignment operator :=" 461msgstr "" 462 463#: lazarusidestrconsts.dlgaddhiattrbracketmatch 464msgid "Brackets highlight" 465msgstr "" 466 467#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree 468msgid "Code folding tree" 469msgstr "" 470 471#: lazarusidestrconsts.dlgaddhiattrdefault 472msgid "Default Text" 473msgstr "" 474 475#: lazarusidestrconsts.dlgaddhiattrdefaultwindow 476msgid "Default Text / Window" 477msgstr "" 478 479#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint 480msgid "Disabled breakpoint" 481msgstr "" 482 483#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint 484msgid "Enabled breakpoint" 485msgstr "" 486 487#: lazarusidestrconsts.dlgaddhiattrerrorline 488msgid "Error line" 489msgstr "" 490 491#: lazarusidestrconsts.dlgaddhiattrexecutionpoint 492msgid "Execution point" 493msgstr "" 494 495#: lazarusidestrconsts.dlgaddhiattrfoldedcode 496msgid "Folded code marker" 497msgstr "" 498 499#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline 500msgid "Fold start-line" 501msgstr "" 502 503#: lazarusidestrconsts.dlgaddhiattrgroupdefault 504msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault" 505msgid "Global" 506msgstr "" 507 508#: lazarusidestrconsts.dlgaddhiattrgroupgutter 509msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter" 510msgid "Gutter" 511msgstr "" 512 513#: lazarusidestrconsts.dlgaddhiattrgroupifdef 514msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef" 515msgid "IfDef" 516msgstr "IfDef" 517 518#: lazarusidestrconsts.dlgaddhiattrgroupline 519msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline" 520msgid "Line" 521msgstr "Regel" 522 523#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors 524msgid "Outline Colors" 525msgstr "" 526 527#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit 528msgid "Syncron Edit" 529msgstr "" 530 531#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit 532msgid "Template Edit" 533msgstr "" 534 535#: lazarusidestrconsts.dlgaddhiattrgrouptext 536msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext" 537msgid "Text" 538msgstr "Tekst" 539 540#: lazarusidestrconsts.dlgaddhiattrgutterseparator 541msgid "Gutter Separator" 542msgstr "" 543 544#: lazarusidestrconsts.dlgaddhiattrhiddencodeline 545msgid "Hide start-line" 546msgstr "" 547 548#: lazarusidestrconsts.dlgaddhiattrhighlightall 549msgid "Incremental others" 550msgstr "" 551 552#: lazarusidestrconsts.dlgaddhiattrhighlightprefix 553msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix" 554msgid "Highlight prefix" 555msgstr "" 556 557#: lazarusidestrconsts.dlgaddhiattrhighlightword 558msgid "Highlight current word" 559msgstr "" 560 561#: lazarusidestrconsts.dlgaddhiattrincrementalsearch 562msgid "Incremental search" 563msgstr "" 564 565#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint 566msgid "Invalid breakpoint" 567msgstr "" 568 569#: lazarusidestrconsts.dlgaddhiattrlinehighlight 570msgid "Current line highlight" 571msgstr "" 572 573#: lazarusidestrconsts.dlgaddhiattrlinenumber 574msgid "Line number" 575msgstr "" 576 577#: lazarusidestrconsts.dlgaddhiattrmodifiedline 578msgid "Modified line" 579msgstr "" 580 581#: lazarusidestrconsts.dlgaddhiattrmouselink 582msgid "Mouse link" 583msgstr "" 584 585#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color 586msgid "Level 10" 587msgstr "" 588 589#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color 590msgid "Level 1" 591msgstr "" 592 593#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color 594msgid "Level 2" 595msgstr "" 596 597#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color 598msgid "Level 3" 599msgstr "" 600 601#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color 602msgid "Level 4" 603msgstr "" 604 605#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color 606msgid "Level 5" 607msgstr "" 608 609#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color 610msgid "Level 6" 611msgstr "" 612 613#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color 614msgid "Level 7" 615msgstr "" 616 617#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color 618msgid "Level 8" 619msgstr "" 620 621#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color 622msgid "Level 9" 623msgstr "" 624 625#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea 626msgid "Selected Area" 627msgstr "" 628 629#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur 630msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur" 631msgid "Active Cell" 632msgstr "" 633 634#: lazarusidestrconsts.dlgaddhiattrsyncroeditother 635msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother" 636msgid "Other Cells" 637msgstr "" 638 639#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync 640msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync" 641msgid "Syncronized Cells" 642msgstr "" 643 644#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur 645msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur" 646msgid "Active Cell" 647msgstr "" 648 649#: lazarusidestrconsts.dlgaddhiattrtemplateeditother 650msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother" 651msgid "Other Cells" 652msgstr "" 653 654#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync 655msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync" 656msgid "Syncronized Cells" 657msgstr "" 658 659#: lazarusidestrconsts.dlgaddhiattrtextblock 660msgid "Text block" 661msgstr "" 662 663#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint 664msgid "Unknown breakpoint" 665msgstr "" 666 667#: lazarusidestrconsts.dlgaddhiattrwindowborder 668msgid "Window border" 669msgstr "" 670 671#: lazarusidestrconsts.dlgaddhiattrwordgroup 672msgid "Word-Brackets" 673msgstr "" 674 675#: lazarusidestrconsts.dlgaddhispecialvisiblechars 676msgid "Visualized Special Chars" 677msgstr "" 678 679#: lazarusidestrconsts.dlgaddnewmode 680msgid "Add new mode" 681msgstr "" 682 683#: lazarusidestrconsts.dlgaddsemicolon 684msgid "Add semicolon" 685msgstr "" 686 687#: lazarusidestrconsts.dlgadjusttopline 688msgid "Adjust top line due to comment in front" 689msgstr "Bewerk bovenste lijn" 690 691#: lazarusidestrconsts.dlgalphabetically 692msgid "Alphabetically" 693msgstr "Alfabetisch" 694 695#: lazarusidestrconsts.dlgalwaysvisiblecursor 696msgid "Always keep caret in visible area of editor" 697msgstr "" 698 699#: lazarusidestrconsts.dlgambigfileact 700msgid "Ambiguous file action:" 701msgstr "Dubbelzinnig bestand actie:" 702 703#: lazarusidestrconsts.dlgambigwarn 704msgid "Warn on compile" 705msgstr "Waarschuw voor compilatie" 706 707#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown 708msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case." 709msgstr "" 710 711#: lazarusidestrconsts.dlgansicommenttab 712msgid "Ansi (* *)" 713msgstr "" 714 715#: lazarusidestrconsts.dlgapplicationsettings 716#, fuzzy 717#| msgid "Application Settings" 718msgid "Application settings" 719msgstr "Applicatie instellingen" 720 721#: lazarusidestrconsts.dlgassertcode 722#, fuzzy 723#| msgid "Include Assertion Code" 724msgid "Include assertion code" 725msgstr "Gebruik assertie code" 726 727#: lazarusidestrconsts.dlgassociateddebugdesktop 728#, object-pascal-format 729msgid "Associated debug desktop for \"%s\"" 730msgstr "" 731 732#: lazarusidestrconsts.dlgassociateddebugdesktophint 733msgid "If you select the desktop, the associated debug desktop will be selected as well." 734msgstr "" 735 736#: lazarusidestrconsts.dlgautocreateforms 737msgid "Auto-create forms:" 738msgstr "Automatisch maken van formulieren" 739 740#: lazarusidestrconsts.dlgautocreateformshint 741msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically." 742msgstr "" 743 744#: lazarusidestrconsts.dlgautocreatenewforms 745#, fuzzy 746#| msgid "When creating new forms, add them to auto-created forms" 747msgid "Auto-create new forms" 748msgstr "Nieuwe forms toevoegen aan de \"auto-created forms\"" 749 750#: lazarusidestrconsts.dlgautodel 751msgid "Auto delete file" 752msgstr "Verwijder bestand automatisch" 753 754#: lazarusidestrconsts.dlgautodisplayfuncproto 755msgid "Auto Display Function Prototypes" 756msgstr "" 757 758#: lazarusidestrconsts.dlgautohidecursor 759msgid "Hide mouse pointer when typing" 760msgstr "" 761 762#: lazarusidestrconsts.dlgautoindent 763msgctxt "lazarusidestrconsts.dlgautoindent" 764msgid "Auto indent" 765msgstr "" 766 767#: lazarusidestrconsts.dlgautoindentlink 768msgid "(Set up smart indent)" 769msgstr "" 770 771#: lazarusidestrconsts.dlgautoindenttype 772msgctxt "lazarusidestrconsts.dlgautoindenttype" 773msgid "Auto indent" 774msgstr "" 775 776#: lazarusidestrconsts.dlgautoremoveemptymethods 777msgid "Auto remove empty methods" 778msgstr "" 779 780#: lazarusidestrconsts.dlgautoren 781msgid "Auto rename file lowercase" 782msgstr "Automatisch hernoemen bestand naar kleine letters" 783 784#: lazarusidestrconsts.dlgautosaveactivedesktop 785msgid "Auto save active desktop" 786msgstr "" 787 788#: lazarusidestrconsts.dlgautosaveactivedesktophint 789msgid "" 790"Save active desktop on IDE close\n" 791"Save debug desktop on IDE close and debug end" 792msgstr "" 793 794#: lazarusidestrconsts.dlgavailableforms 795msgid "Available forms:" 796msgstr "Beschikbare Forms:" 797 798#: lazarusidestrconsts.dlgavailableformshint 799msgid "These forms must be created and freed in the program code." 800msgstr "" 801 802#: lazarusidestrconsts.dlgavoidunnecessaryjumps 803msgid "Avoid unnecessary jumps" 804msgstr "" 805 806#: lazarusidestrconsts.dlgbackcolor 807msgid "Background" 808msgstr "Achtergrond" 809 810#: lazarusidestrconsts.dlgbaknosubdirectory 811msgid "(no subdirectory)" 812msgstr "(geen subdirectory)" 813 814#: lazarusidestrconsts.dlgbckupsubdir 815msgid "Same name (in subdirectory)" 816msgstr "Dezelfde naam (in subdirectorie)" 817 818#: lazarusidestrconsts.dlgbehindmethods 819msgid "Behind methods" 820msgstr "Achter methoden" 821 822#: lazarusidestrconsts.dlgblockgroupoptions 823#, fuzzy 824msgctxt "lazarusidestrconsts.dlgblockgroupoptions" 825msgid "Selection" 826msgstr "Selectie" 827 828#: lazarusidestrconsts.dlgblockindent 829#, fuzzy 830#| msgid "Block indent" 831msgid "Block indent (spaces)" 832msgstr "Blok inspringen" 833 834#: lazarusidestrconsts.dlgblockindentkeys 835msgid "Block indent" 836msgstr "" 837 838#: lazarusidestrconsts.dlgblockindentlink 839msgid "(edit keys)" 840msgstr "" 841 842#: lazarusidestrconsts.dlgblockindenttypecopy 843msgid "Space/tab as prev Line" 844msgstr "" 845 846#: lazarusidestrconsts.dlgblockindenttypepos 847msgid "Position only" 848msgstr "" 849 850#: lazarusidestrconsts.dlgblockindenttypespace 851msgid "Spaces" 852msgstr "" 853 854#: lazarusidestrconsts.dlgblockindenttypetabonly 855msgid "Tabs, cut off" 856msgstr "" 857 858#: lazarusidestrconsts.dlgblockindenttypetabspace 859msgid "Tabs, then spaces" 860msgstr "" 861 862#: lazarusidestrconsts.dlgblocktabindent 863msgid "Block indent (tabs)" 864msgstr "" 865 866#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor 867msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0." 868msgstr "" 869 870#: lazarusidestrconsts.dlgbrackethighlight 871msgid "Bracket highlight" 872msgstr "" 873 874#: lazarusidestrconsts.dlgbracketmatchgroup 875msgid "Matching bracket and quote pairs" 876msgstr "" 877 878#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop 879msgid "You cannot use docked desktop in undocked environment and vice versa." 880msgstr "" 881 882#: lazarusidestrconsts.dlgcaretbackcolor 883msgid "Multi/2nd (NotXor)" 884msgstr "" 885 886#: lazarusidestrconsts.dlgcaretcolor 887msgctxt "lazarusidestrconsts.dlgcaretcolor" 888msgid "Caret" 889msgstr "" 890 891#: lazarusidestrconsts.dlgcaretforecolor 892msgid "Color (NotXor)" 893msgstr "" 894 895#: lazarusidestrconsts.dlgcaretgroupoptions 896msgid "Caret (Text Cursor)" 897msgstr "" 898 899#: lazarusidestrconsts.dlgcasesensitive 900msgctxt "lazarusidestrconsts.dlgcasesensitive" 901msgid "&Case sensitive" 902msgstr "" 903 904#: lazarusidestrconsts.dlgccocaption 905msgid "Checking compiler options" 906msgstr "" 907 908#: lazarusidestrconsts.dlgccoorphanedfilefound 909#, object-pascal-format 910msgid "orphaned file found: %s" 911msgstr "" 912 913#: lazarusidestrconsts.dlgccoresults 914msgid "Results" 915msgstr "" 916 917#: lazarusidestrconsts.dlgccotest 918msgctxt "lazarusidestrconsts.dlgccotest" 919msgid "Test" 920msgstr "Test" 921 922#: lazarusidestrconsts.dlgccotestcheckingcompiler 923msgid "Test: Checking compiler ..." 924msgstr "" 925 926#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig 927msgid "Test: Checking compiler configuration ..." 928msgstr "" 929 930#: lazarusidestrconsts.dlgccotestcompilerdate 931msgid "Test: Checking compiler date ..." 932msgstr "" 933 934#: lazarusidestrconsts.dlgccotestcompilingemptyfile 935msgid "Test: Compiling an empty file ..." 936msgstr "" 937 938#: lazarusidestrconsts.dlgccotestrtlunits 939msgid "Test: Checking RTL units ..." 940msgstr "" 941 942#: lazarusidestrconsts.dlgccotestsrcinppupaths 943msgid "Test: Checking sources in fpc ppu search paths ..." 944msgstr "" 945 946#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile 947msgid "Test: Compiling an empty file" 948msgstr "" 949 950#: lazarusidestrconsts.dlgccousingconfigfile 951#, object-pascal-format 952msgid "using config file %s" 953msgstr "" 954 955#: lazarusidestrconsts.dlgcdtclassorder 956msgid "Class order" 957msgstr "Klassevolgorde" 958 959#: lazarusidestrconsts.dlgcdtlast 960msgid "Last" 961msgstr "Laatste" 962 963#: lazarusidestrconsts.dlgcdtlower 964msgid "lowercase" 965msgstr "Kleine letters" 966 967#: lazarusidestrconsts.dlgcdtpreview 968#, fuzzy 969#| msgid "Preview (Max line length = 1)" 970msgid "Preview (max line length = 1)" 971msgstr "Voorbeeld (Max regellengte = 1)" 972 973#: lazarusidestrconsts.dlgcdtreadprefix 974msgid "Read prefix" 975msgstr "Lees voorloop" 976 977#: lazarusidestrconsts.dlgcdtstoredpostfix 978msgid "Stored postfix" 979msgstr "Opgeslagen postfix" 980 981#: lazarusidestrconsts.dlgcdtuppercase 982msgid "UPPERCASE" 983msgstr "HOOFDLETTERS" 984 985#: lazarusidestrconsts.dlgcdtvariableprefix 986msgid "Variable prefix" 987msgstr "Variabele prefix" 988 989#: lazarusidestrconsts.dlgcdtwriteprefix 990msgid "Write prefix" 991msgstr "Schrijf voorvoegsel" 992 993#: lazarusidestrconsts.dlgcharcasefileact 994#, fuzzy 995#| msgid "Save As - auto rename pascal files lower case" 996msgid "Save As - auto rename Pascal files lower case" 997msgstr "Opslaan als - Pascal bestands namen converteren naar kleine letters." 998 999#: lazarusidestrconsts.dlgcheckandautosavefiles 1000msgid "Check and Auto Save Files" 1001msgstr "" 1002 1003#: lazarusidestrconsts.dlgcheckpackagesonformcreate 1004msgid "Check packages on form create" 1005msgstr "" 1006 1007#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint 1008msgid "The form may require a package to work. Install such a package automatically." 1009msgstr "" 1010 1011#: lazarusidestrconsts.dlgchscodetempl 1012msgid "Choose code template file (*.dci)" 1013msgstr "Kies code sjabloonbestand (*.dci)" 1014 1015#: lazarusidestrconsts.dlgclosebuttonsnotebook 1016msgid "Show close buttons in notebook" 1017msgstr "Toon sluitknoppen in notebook" 1018 1019#: lazarusidestrconsts.dlgclrscheme 1020msgid "Color Scheme" 1021msgstr "Kleuren schema" 1022 1023#: lazarusidestrconsts.dlgcmacro 1024#, fuzzy 1025#| msgid "C Style Macros (global)" 1026msgid "C style macros (global)" 1027msgstr "C -stijl macro's (globaal)" 1028 1029#: lazarusidestrconsts.dlgcoansistr 1030#, fuzzy 1031#| msgid "Use ansi strings" 1032msgctxt "lazarusidestrconsts.dlgcoansistr" 1033msgid "Use Ansistrings" 1034msgstr "Gebruik ANSI strings" 1035 1036#: lazarusidestrconsts.dlgcoasmstyle 1037msgid "Assembler style" 1038msgstr "" 1039 1040#: lazarusidestrconsts.dlgcocfgcmpmessages 1041#, fuzzy 1042msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages" 1043msgid "Messages" 1044msgstr "Berichten" 1045 1046#: lazarusidestrconsts.dlgcochecksandassertion 1047msgid "Checks and assertion" 1048msgstr "" 1049 1050#: lazarusidestrconsts.dlgcocompilercommands 1051msgid "Compiler Commands" 1052msgstr "" 1053 1054#: lazarusidestrconsts.dlgcocops 1055#, fuzzy 1056#| msgid "C Style Operators (*=, +=, /= and -=)" 1057msgid "C style operators (*=, +=, /= and -=)" 1058msgstr "C -stijl Operators (*=, +=, /= and -=)" 1059 1060#: lazarusidestrconsts.dlgcocreatemakefile 1061msgctxt "lazarusidestrconsts.dlgcocreatemakefile" 1062msgid "Create Makefile" 1063msgstr "Maak MakeFile" 1064 1065#: lazarusidestrconsts.dlgcodebugging 1066#, fuzzy 1067#| msgid "Debugging info" 1068msgctxt "lazarusidestrconsts.dlgcodebugging" 1069msgid "Debugging" 1070msgstr "Debugging:" 1071 1072#: lazarusidestrconsts.dlgcodebugpath 1073msgid "Debugger path addition (none):" 1074msgstr "Debugger pad toevoeging (geen):" 1075 1076#: lazarusidestrconsts.dlgcodecreation 1077msgid "Code Creation" 1078msgstr "Codecreatie" 1079 1080#: lazarusidestrconsts.dlgcodefoldenableboth 1081msgid "Both" 1082msgstr "" 1083 1084#: lazarusidestrconsts.dlgcodefoldenablefold 1085msgid "Fold" 1086msgstr "" 1087 1088#: lazarusidestrconsts.dlgcodefoldenablehide 1089msgid "Hide" 1090msgstr "" 1091 1092#: lazarusidestrconsts.dlgcodefoldpopuporder 1093msgid "Reverse fold-order in Popup" 1094msgstr "" 1095 1096#: lazarusidestrconsts.dlgcogdb 1097#, fuzzy 1098#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)" 1099msgid "Generate info for the debugger (slower / increases exe-size)" 1100msgstr "Genereer Debugging info voor GDB (Compileert langzamer)" 1101 1102#: lazarusidestrconsts.dlgcoheaptrc 1103#, fuzzy 1104#| msgid "Use Heaptrc Unit (check for mem-leaks)" 1105msgid "Use Heaptrc unit (check for mem-leaks)" 1106msgstr "Gebruik Heaptrc unit" 1107 1108#: lazarusidestrconsts.dlgcoincfiles 1109#, fuzzy 1110#| msgid "Include Files (-Fi):" 1111msgid "Include files (-Fi):" 1112msgstr "Include bestanden (-Fi):" 1113 1114#: lazarusidestrconsts.dlgcoinfoforgdb 1115msgid "Debugger info" 1116msgstr "" 1117 1118#: lazarusidestrconsts.dlgcolibraries 1119msgid "Libraries (-Fl):" 1120msgstr "Bibliotheken (-Fl):" 1121 1122#: lazarusidestrconsts.dlgcolinking 1123msgid "Linking" 1124msgstr "Linken" 1125 1126#: lazarusidestrconsts.dlgcoloadsavehint 1127#, fuzzy 1128#| msgid "Load/Save" 1129msgctxt "lazarusidestrconsts.dlgcoloadsavehint" 1130msgid "Compiler options can be saved to an XML file." 1131msgstr "Laden/Bewaren" 1132 1133#: lazarusidestrconsts.dlgcolor 1134msgid "Color" 1135msgstr "" 1136 1137#: lazarusidestrconsts.dlgcolorlink 1138msgid "(Edit Color)" 1139msgstr "" 1140 1141#: lazarusidestrconsts.dlgcolornotmodified 1142msgid "Not modified" 1143msgstr "" 1144 1145#: lazarusidestrconsts.dlgcolors 1146msgctxt "lazarusidestrconsts.dlgcolors" 1147msgid "Colors" 1148msgstr "Kleuren" 1149 1150#: lazarusidestrconsts.dlgcommandlineparams 1151msgid "Command line parameters (without application name)" 1152msgstr "Command line parameters (zonder applicatie naam)" 1153 1154#: lazarusidestrconsts.dlgcommentalignmaxdefault 1155msgid "Max indent for new line if prefix is based on start of comment on first comment line:" 1156msgstr "" 1157 1158#: lazarusidestrconsts.dlgcommentalignmaxtoken 1159msgid "Limit indent to" 1160msgstr "" 1161 1162#: lazarusidestrconsts.dlgcommentcontinue 1163msgid "Prefix comments on linebreak" 1164msgstr "" 1165 1166#: lazarusidestrconsts.dlgcommentcontinuematch 1167msgid "Match current line" 1168msgstr "" 1169 1170#: lazarusidestrconsts.dlgcommentcontinuematchasterisk 1171msgid "Match text including \"*\" of token \"(*\"" 1172msgstr "" 1173 1174#: lazarusidestrconsts.dlgcommentcontinuematchline 1175msgid "Match whole line" 1176msgstr "" 1177 1178#: lazarusidestrconsts.dlgcommentcontinuematchtext 1179#, object-pascal-format 1180msgid "Match text after token \"%s\"" 1181msgstr "" 1182 1183#: lazarusidestrconsts.dlgcommentcontinuematchtoken 1184#, object-pascal-format 1185msgid "Match text including token \"%s\"" 1186msgstr "" 1187 1188#: lazarusidestrconsts.dlgcommentcontinueprefix 1189msgid "Prefix new line" 1190msgstr "" 1191 1192#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault 1193msgid "Align Prefix at indent of previous line" 1194msgstr "" 1195 1196#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch 1197msgid "Align Prefix below start of comment on first comment line" 1198msgstr "" 1199 1200#: lazarusidestrconsts.dlgcommentcontinueprefixindnone 1201msgid "Do not indent prefix" 1202msgstr "" 1203 1204#: lazarusidestrconsts.dlgcommentindentgroupoptions 1205msgid "Comments and Strings" 1206msgstr "" 1207 1208#: lazarusidestrconsts.dlgcommentshlashextendalways 1209msgid "Extend if matched or not matched" 1210msgstr "" 1211 1212#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit 1213msgid "Extend if matched or not matched (not at EOL)" 1214msgstr "" 1215 1216#: lazarusidestrconsts.dlgcommentshlashextendmatch 1217msgid "Extend if matched" 1218msgstr "" 1219 1220#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit 1221msgid "Extend if matched and caret in the middle of text (not at EOL)" 1222msgstr "" 1223 1224#: lazarusidestrconsts.dlgcompilationandlinking 1225msgid "Compilation and Linking" 1226msgstr "" 1227 1228#: lazarusidestrconsts.dlgcompilermessage 1229msgid "Compiler messages" 1230msgstr "" 1231 1232#: lazarusidestrconsts.dlgcompilermessages 1233msgid "Compiler messages language file (*.msg)" 1234msgstr "" 1235 1236#: lazarusidestrconsts.dlgcompileroptions 1237msgctxt "lazarusidestrconsts.dlgcompileroptions" 1238msgid "Compiler Options" 1239msgstr "Compileropties" 1240 1241#: lazarusidestrconsts.dlgcompleteproperties 1242msgid "Complete properties" 1243msgstr "Completeer properties" 1244 1245#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected 1246msgid "Component under mouse cursor is first selected, then the popup menu commands work on it." 1247msgstr "" 1248 1249#: lazarusidestrconsts.dlgconfigandtarget 1250msgid "Config and Target" 1251msgstr "" 1252 1253#: lazarusidestrconsts.dlgconfigfiles 1254#, fuzzy 1255#| msgid "Config Files:" 1256msgid "Config files" 1257msgstr "Configuratiebestanden:" 1258 1259#: lazarusidestrconsts.dlgcootherdebugginginfo 1260msgid "Other debugging info" 1261msgstr "" 1262 1263#: lazarusidestrconsts.dlgcooverflow 1264msgid "Overflow" 1265msgstr "Overloop" 1266 1267#: lazarusidestrconsts.dlgcoparsing 1268msgid "Parsing" 1269msgstr "Ontleden" 1270 1271#: lazarusidestrconsts.dlgcopypastekeepfolds 1272msgid "Copy/Paste with fold info" 1273msgstr "" 1274 1275#: lazarusidestrconsts.dlgcopywordatcursoroncopynone 1276msgid "Copy current word when no selection exists" 1277msgstr "" 1278 1279#: lazarusidestrconsts.dlgcorange 1280msgctxt "lazarusidestrconsts.dlgcorange" 1281msgid "Range" 1282msgstr "Bereik" 1283 1284#: lazarusidestrconsts.dlgcorelocatable 1285msgid "Relocatable" 1286msgstr "" 1287 1288#: lazarusidestrconsts.dlgcosetasdefault 1289msgid "Set compiler options as default" 1290msgstr "" 1291 1292#: lazarusidestrconsts.dlgcoshowerr 1293#, fuzzy 1294#| msgid "Show Errors" 1295msgid "Show errors" 1296msgstr "Toon fouten" 1297 1298#: lazarusidestrconsts.dlgcoshowoptions 1299#, fuzzy 1300#| msgid "Show Options" 1301msgid "&Show Options" 1302msgstr "Toon opties" 1303 1304#: lazarusidestrconsts.dlgcosmartlinkable 1305#, fuzzy 1306#| msgid "Smart Linkable" 1307msgid "Smart linkable" 1308msgstr "Slim te linken" 1309 1310#: lazarusidestrconsts.dlgcosources 1311#, fuzzy 1312#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" 1313msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)" 1314msgstr "Andere Bronnen (.pp / .pas bestanden, alleen door IDE gebruikt)" 1315 1316#: lazarusidestrconsts.dlgcostack 1317msgid "Stack" 1318msgstr "Stack" 1319 1320#: lazarusidestrconsts.dlgcostrip 1321#, fuzzy 1322#| msgid "Strip Symbols From Executable" 1323msgid "Strip symbols from executable" 1324msgstr "Verwijderen symbolen uit het uitvoerbaar bestand." 1325 1326#: lazarusidestrconsts.dlgcosymboltype 1327msgid "Type of debug info" 1328msgstr "" 1329 1330#: lazarusidestrconsts.dlgcosymboltypeauto 1331msgctxt "lazarusidestrconsts.dlgcosymboltypeauto" 1332msgid "Automatic" 1333msgstr "" 1334 1335#: lazarusidestrconsts.dlgcosymboltypedwarf2 1336msgid "Dwarf2" 1337msgstr "" 1338 1339#: lazarusidestrconsts.dlgcosymboltypedwarf2set 1340msgid "Dwarf with sets" 1341msgstr "" 1342 1343#: lazarusidestrconsts.dlgcosymboltypedwarf3 1344msgid "Dwarf3 (beta)" 1345msgstr "" 1346 1347#: lazarusidestrconsts.dlgcosymboltypestabs 1348msgid "Stabs" 1349msgstr "" 1350 1351#: lazarusidestrconsts.dlgcotrashvariables 1352msgid "Trash variables" 1353msgstr "" 1354 1355#: lazarusidestrconsts.dlgcounitstyle 1356#, fuzzy 1357#| msgid "Unit Style" 1358msgid "Unit style" 1359msgstr "Unitstijl:" 1360 1361#: lazarusidestrconsts.dlgcovalgrind 1362msgid "Generate code for valgrind" 1363msgstr "Genereer code voor valgrind" 1364 1365#: lazarusidestrconsts.dlgcoverbosity 1366msgid "Verbosity" 1367msgstr "" 1368 1369#: lazarusidestrconsts.dlgcppinline 1370#, fuzzy 1371#| msgid "C++ Styled INLINE" 1372msgid "C++ styled INLINE" 1373msgstr "C++-achtige INLINE" 1374 1375#: lazarusidestrconsts.dlgcreatenewrunparameterssettings 1376msgid "Create new Run Parameters settings" 1377msgstr "" 1378 1379#: lazarusidestrconsts.dlgcurlycommenttab 1380msgid "Curly { }" 1381msgstr "" 1382 1383#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow 1384msgid "Currently respected by messages window, jump history and search results." 1385msgstr "" 1386 1387#: lazarusidestrconsts.dlgcursorbeyondeol 1388msgid "Cursor beyond EOL" 1389msgstr "Cursor voorbij EOL" 1390 1391#: lazarusidestrconsts.dlgcursormoveclearsselection 1392msgid "Caret left/right clears selection (no move)" 1393msgstr "" 1394 1395#: lazarusidestrconsts.dlgcursorskipsselection 1396msgid "Caret skips selection" 1397msgstr "" 1398 1399#: lazarusidestrconsts.dlgcursorskipstab 1400msgid "Caret skips tabs" 1401msgstr "" 1402 1403#: lazarusidestrconsts.dlgcustomext 1404msgid "User defined extension (.pp.xxx)" 1405msgstr "Door gebruiker gedefinieerde extensie (.pp.xxx)" 1406 1407#: lazarusidestrconsts.dlgdebugdesktop 1408msgid "debug" 1409msgstr "" 1410 1411#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption 1412msgid "Path Editor" 1413msgstr "" 1414 1415#: lazarusidestrconsts.dlgdebugtype 1416msgid "Debugger type and path" 1417msgstr "Debuggertype en pad" 1418 1419#: lazarusidestrconsts.dlgdefaulteditorfont 1420msgid "Default editor font" 1421msgstr "Standaard editorfont" 1422 1423#: lazarusidestrconsts.dlgdefvaluecolor 1424msgid "Default Value" 1425msgstr "Standaardwaarde" 1426 1427#: lazarusidestrconsts.dlgdeletemode 1428msgid "Delete mode" 1429msgstr "" 1430 1431#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption 1432#, fuzzy 1433msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption" 1434msgid "Delete" 1435msgstr "Verwijder" 1436 1437#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint 1438msgid "Delete selected desktop" 1439msgstr "" 1440 1441#: lazarusidestrconsts.dlgdeltemplate 1442msgid "Delete template " 1443msgstr "Verwijder template" 1444 1445#: lazarusidestrconsts.dlgdesktopbuttons 1446msgid "Buttons - " 1447msgstr "" 1448 1449#: lazarusidestrconsts.dlgdesktophints 1450msgid "Hints" 1451msgstr "" 1452 1453#: lazarusidestrconsts.dlgdesktopmenus 1454msgid "Menus - " 1455msgstr "" 1456 1457#: lazarusidestrconsts.dlgdesktopname 1458msgid "Desktop name" 1459msgstr "" 1460 1461#: lazarusidestrconsts.dlgdesktopsexported 1462#, object-pascal-format 1463msgid "%d desktop(s) successfully exported to \"%s\"" 1464msgstr "" 1465 1466#: lazarusidestrconsts.dlgdesktopsimported 1467#, object-pascal-format 1468msgid "%d desktop(s) successfully imported from \"%s\"" 1469msgstr "" 1470 1471#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor 1472msgid "Different values background" 1473msgstr "" 1474 1475#: lazarusidestrconsts.dlgdirection 1476msgid "Direction" 1477msgstr "Richting" 1478 1479#: lazarusidestrconsts.dlgdisableantialiasing 1480msgid "Disable anti-aliasing" 1481msgstr "" 1482 1483#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep 1484msgid "Distance between grid points is the smallest step when moving a control." 1485msgstr "" 1486 1487#: lazarusidestrconsts.dlgdividercolordefault 1488msgid "Use right margin color" 1489msgstr "" 1490 1491#: lazarusidestrconsts.dlgdividerdrawdepth 1492msgid "Draw divider level" 1493msgstr "" 1494 1495#: lazarusidestrconsts.dlgdividernestcolor 1496msgid "Nested line color" 1497msgstr "" 1498 1499#: lazarusidestrconsts.dlgdividertopcolor 1500msgid "Line color" 1501msgstr "" 1502 1503#: lazarusidestrconsts.dlgdivpasbeginendname 1504msgid "Begin/End" 1505msgstr "" 1506 1507#: lazarusidestrconsts.dlgdivpasprocedurename 1508msgid "Procedure/Function" 1509msgstr "" 1510 1511#: lazarusidestrconsts.dlgdivpasstructglobalname 1512msgid "Class/Struct" 1513msgstr "" 1514 1515#: lazarusidestrconsts.dlgdivpasstructlocalname 1516msgid "Class/Struct (local)" 1517msgstr "" 1518 1519#: lazarusidestrconsts.dlgdivpastryname 1520msgid "Try/Except" 1521msgstr "" 1522 1523#: lazarusidestrconsts.dlgdivpasunitsectionname 1524msgid "Unit sections" 1525msgstr "" 1526 1527#: lazarusidestrconsts.dlgdivpasusesname 1528msgid "Uses clause" 1529msgstr "" 1530 1531#: lazarusidestrconsts.dlgdivpasvarglobalname 1532msgid "Var/Type" 1533msgstr "" 1534 1535#: lazarusidestrconsts.dlgdivpasvarlocalname 1536msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname" 1537msgid "Var/Type (local)" 1538msgstr "" 1539 1540#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit 1541msgid "Draw the component's name below it." 1542msgstr "" 1543 1544#: lazarusidestrconsts.dlgedback 1545msgid "Back" 1546msgstr "Terug" 1547 1548#: lazarusidestrconsts.dlgedbold 1549msgid "Bold" 1550msgstr "Vet" 1551 1552#: lazarusidestrconsts.dlgedbsubdir 1553msgid "Sub directory" 1554msgstr "Subdirectorie" 1555 1556#: lazarusidestrconsts.dlgedcodetempl 1557#, fuzzy 1558#| msgid "Code templates" 1559msgctxt "lazarusidestrconsts.dlgedcodetempl" 1560msgid "Code Templates" 1561msgstr "Broncode templates" 1562 1563#: lazarusidestrconsts.dlgedcompleteblocks 1564msgid "Add close statement for Pascal blocks" 1565msgstr "" 1566 1567#: lazarusidestrconsts.dlgedcustomext 1568msgid "User defined extension" 1569msgstr "Door gebruiker gedefinieerde extensie" 1570 1571#: lazarusidestrconsts.dlgeddelayinsec 1572#, object-pascal-format 1573msgid "(%s sec delay)" 1574msgstr "" 1575 1576#: lazarusidestrconsts.dlgeddisplay 1577msgid "Display" 1578msgstr "Beeld" 1579 1580#: lazarusidestrconsts.dlgedfiles 1581#, fuzzy 1582#| msgid "Editor files" 1583msgid "Editor Files" 1584msgstr "Editor bestanden" 1585 1586#: lazarusidestrconsts.dlgedidcomlet 1587msgctxt "lazarusidestrconsts.dlgedidcomlet" 1588msgid "Identifier completion" 1589msgstr "Identifier completering" 1590 1591#: lazarusidestrconsts.dlgedinvert 1592msgid "Invert" 1593msgstr "" 1594 1595#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit 1596msgid "Ignore Locks, use longest unused editor" 1597msgstr "" 1598 1599#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit 1600msgid "Ignore Locks, if editor is current" 1601msgstr "" 1602 1603#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin 1604msgid "Ignore Locks, if editor in current window" 1605msgstr "" 1606 1607#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview 1608msgid "Locked, if text in view" 1609msgstr "" 1610 1611#: lazarusidestrconsts.dlgeditaccesscaptionunlocked 1612msgid "Unlocked" 1613msgstr "" 1614 1615#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview 1616msgid "Unlocked, if text in centered view" 1617msgstr "" 1618 1619#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin 1620msgid "New tab, existing or new window" 1621msgstr "" 1622 1623#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin 1624msgid "New tab in new window" 1625msgstr "" 1626 1627#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin 1628msgid "New tab in existing window" 1629msgstr "" 1630 1631#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit 1632msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested." 1633msgstr "" 1634 1635#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit 1636msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling." 1637msgstr "" 1638 1639#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin 1640msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling." 1641msgstr "" 1642 1643#: lazarusidestrconsts.dlgeditaccessdesclockedinview 1644msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)." 1645msgstr "" 1646 1647#: lazarusidestrconsts.dlgeditaccessdescunlocked 1648msgid "This option will use any not locked Editor." 1649msgstr "" 1650 1651#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview 1652msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)." 1653msgstr "" 1654 1655#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin 1656msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested." 1657msgstr "" 1658 1659#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin 1660msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested." 1661msgstr "" 1662 1663#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin 1664msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet." 1665msgstr "" 1666 1667#: lazarusidestrconsts.dlgedital 1668msgid "Italic" 1669msgstr "Italic" 1670 1671#: lazarusidestrconsts.dlgeditorfontsize 1672msgid "Editor font size" 1673msgstr "" 1674 1675#: lazarusidestrconsts.dlgeditoroptions 1676msgctxt "lazarusidestrconsts.dlgeditoroptions" 1677msgid "Editor options" 1678msgstr "" 1679 1680#: lazarusidestrconsts.dlgeditschemdefaults 1681msgid "Scheme globals" 1682msgstr "" 1683 1684#: lazarusidestrconsts.dlgedmisc 1685#, fuzzy 1686msgctxt "lazarusidestrconsts.dlgedmisc" 1687msgid "Miscellaneous" 1688msgstr "Overige" 1689 1690#: lazarusidestrconsts.dlgedoff 1691msgid "Off" 1692msgstr "" 1693 1694#: lazarusidestrconsts.dlgedon 1695msgid "On" 1696msgstr "" 1697 1698#: lazarusidestrconsts.dlgedtabindent 1699msgid "Tab and Indent" 1700msgstr "" 1701 1702#: lazarusidestrconsts.dlgedunder 1703msgid "Underline" 1704msgstr "Onderstreep" 1705 1706#: lazarusidestrconsts.dlgelementattributes 1707msgid "Element Attributes" 1708msgstr "" 1709 1710#: lazarusidestrconsts.dlgendkeyjumpstoneareststart 1711msgid "End key jumps to nearest end" 1712msgstr "" 1713 1714#: lazarusidestrconsts.dlgenvask 1715msgid "Ask" 1716msgstr "Vraag" 1717 1718#: lazarusidestrconsts.dlgenvbackuphelpnote 1719msgid "Notes: Project files are all files in the project directory" 1720msgstr "Toelichting: Project bestanden zijn alle bestanden in de project directorie" 1721 1722#: lazarusidestrconsts.dlgenvbckup 1723msgid "Backup" 1724msgstr "Backup" 1725 1726#: lazarusidestrconsts.dlgenvfiles 1727msgid "Files" 1728msgstr "Bestanden" 1729 1730#: lazarusidestrconsts.dlgenvgrid 1731msgid "Grid" 1732msgstr "Raster" 1733 1734#: lazarusidestrconsts.dlgenvidestartup 1735msgid "IDE Startup" 1736msgstr "" 1737 1738#: lazarusidestrconsts.dlgenvlanguage 1739msgctxt "lazarusidestrconsts.dlgenvlanguage" 1740msgid "Language" 1741msgstr "Taal" 1742 1743#: lazarusidestrconsts.dlgenvlanguagehint 1744msgid "Language of all IDE strings. Restart IDE after changing it for best result." 1745msgstr "" 1746 1747#: lazarusidestrconsts.dlgenvlguidelines 1748msgid "Guide lines" 1749msgstr "Richtlijnen" 1750 1751#: lazarusidestrconsts.dlgenvmisc 1752msgctxt "lazarusidestrconsts.dlgenvmisc" 1753msgid "Miscellaneous" 1754msgstr "Overige" 1755 1756#: lazarusidestrconsts.dlgenvnone 1757msgctxt "lazarusidestrconsts.dlgenvnone" 1758msgid "None" 1759msgstr "Geen" 1760 1761#: lazarusidestrconsts.dlgenvotherfiles 1762#, fuzzy 1763#| msgid "Other files" 1764msgid "Other Files" 1765msgstr "Andere bestanden" 1766 1767#: lazarusidestrconsts.dlgenvproject 1768#, fuzzy 1769#| msgid "Project" 1770msgid "Tabs for project" 1771msgstr "Project" 1772 1773#: lazarusidestrconsts.dlgenvtype 1774msgctxt "lazarusidestrconsts.dlgenvtype" 1775msgid "Type" 1776msgstr "Type" 1777 1778#: lazarusidestrconsts.dlgeofocusmessagesatcompilation 1779msgid "Focus messages at compilation" 1780msgstr "" 1781 1782#: lazarusidestrconsts.dlgextracharspacing 1783msgid "Extra character spacing" 1784msgstr "" 1785 1786#: lazarusidestrconsts.dlgextralinespacing 1787msgid "Extra line spacing" 1788msgstr "Extra regel afstand" 1789 1790#: lazarusidestrconsts.dlgextsymb 1791msgid "Use external debug symbols file" 1792msgstr "" 1793 1794#: lazarusidestrconsts.dlgfileassociationinos 1795msgid "Opening Files from OS" 1796msgstr "" 1797 1798#: lazarusidestrconsts.dlgfileexts 1799msgid "File extensions" 1800msgstr "Bestands extensie" 1801 1802#: lazarusidestrconsts.dlgfiles 1803#, object-pascal-format 1804msgid "%s files" 1805msgstr "" 1806 1807#: lazarusidestrconsts.dlgfilterall 1808#, fuzzy 1809msgctxt "lazarusidestrconsts.dlgfilterall" 1810msgid "All files" 1811msgstr "Alle bestanden" 1812 1813#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile 1814msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile" 1815msgid "CodeTools template file" 1816msgstr "" 1817 1818#: lazarusidestrconsts.dlgfilterdcifile 1819msgid "DCI file" 1820msgstr "" 1821 1822#: lazarusidestrconsts.dlgfilterdelphiform 1823msgid "Delphi form" 1824msgstr "" 1825 1826#: lazarusidestrconsts.dlgfilterdelphipackage 1827msgctxt "lazarusidestrconsts.dlgfilterdelphipackage" 1828msgid "Delphi package" 1829msgstr "" 1830 1831#: lazarusidestrconsts.dlgfilterdelphiproject 1832#, fuzzy 1833msgctxt "lazarusidestrconsts.dlgfilterdelphiproject" 1834msgid "Delphi project" 1835msgstr "Delphi project" 1836 1837#: lazarusidestrconsts.dlgfilterdelphiunit 1838msgctxt "lazarusidestrconsts.dlgfilterdelphiunit" 1839msgid "Delphi unit" 1840msgstr "" 1841 1842#: lazarusidestrconsts.dlgfilterexecutable 1843msgctxt "lazarusidestrconsts.dlgfilterexecutable" 1844msgid "Executable" 1845msgstr "" 1846 1847#: lazarusidestrconsts.dlgfilterfpcmessagefile 1848msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile" 1849msgid "FPC message file" 1850msgstr "" 1851 1852#: lazarusidestrconsts.dlgfilterhtml 1853msgid "HTML files" 1854msgstr "" 1855 1856#: lazarusidestrconsts.dlgfilterimagesbitmap 1857msgid "Bitmap images" 1858msgstr "" 1859 1860#: lazarusidestrconsts.dlgfilterimagespixmap 1861msgid "Pixmap images" 1862msgstr "" 1863 1864#: lazarusidestrconsts.dlgfilterimagespng 1865msgid "PNG images" 1866msgstr "" 1867 1868#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings 1869#, fuzzy 1870msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings" 1871msgid "Lazarus Desktop Settings" 1872msgstr "Lazarus Desktop instellingen" 1873 1874#: lazarusidestrconsts.dlgfilterlazaruseditorfile 1875msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile" 1876msgid "Editor file types" 1877msgstr "" 1878 1879#: lazarusidestrconsts.dlgfilterlazarusfile 1880#, fuzzy 1881#| msgid "Lazarus File" 1882msgctxt "lazarusidestrconsts.dlgfilterlazarusfile" 1883msgid "Lazarus file" 1884msgstr "Lazarus bestand" 1885 1886#: lazarusidestrconsts.dlgfilterlazarusform 1887#, fuzzy 1888msgctxt "lazarusidestrconsts.dlgfilterlazarusform" 1889msgid "Lazarus form" 1890msgstr "Lazarus form" 1891 1892#: lazarusidestrconsts.dlgfilterlazarusinclude 1893#, fuzzy 1894msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude" 1895msgid "Lazarus include file" 1896msgstr "Lazarus include bestand" 1897 1898#: lazarusidestrconsts.dlgfilterlazarusotherfile 1899msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile" 1900msgid "Lazarus other file" 1901msgstr "" 1902 1903#: lazarusidestrconsts.dlgfilterlazaruspackage 1904#, fuzzy 1905msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage" 1906msgid "Lazarus package" 1907msgstr "Lazarus pakket" 1908 1909#: lazarusidestrconsts.dlgfilterlazarusproject 1910#, fuzzy 1911msgctxt "lazarusidestrconsts.dlgfilterlazarusproject" 1912msgid "Lazarus project" 1913msgstr "Lazarus project" 1914 1915#: lazarusidestrconsts.dlgfilterlazarusprojectsource 1916#, fuzzy 1917msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource" 1918msgid "Lazarus project source" 1919msgstr "Lazarus project broncode" 1920 1921#: lazarusidestrconsts.dlgfilterlazarussession 1922msgid "Lazarus session" 1923msgstr "" 1924 1925#: lazarusidestrconsts.dlgfilterlazarusunit 1926#, fuzzy 1927msgctxt "lazarusidestrconsts.dlgfilterlazarusunit" 1928msgid "Lazarus unit" 1929msgstr "Lazarus unit" 1930 1931#: lazarusidestrconsts.dlgfilterpascalfile 1932msgctxt "lazarusidestrconsts.dlgfilterpascalfile" 1933msgid "Pascal file" 1934msgstr "" 1935 1936#: lazarusidestrconsts.dlgfilterprograms 1937msgctxt "lazarusidestrconsts.dlgfilterprograms" 1938msgid "Programs" 1939msgstr "" 1940 1941#: lazarusidestrconsts.dlgfilterxml 1942#, fuzzy 1943msgctxt "lazarusidestrconsts.dlgfilterxml" 1944msgid "XML files" 1945msgstr "XML bestanden" 1946 1947#: lazarusidestrconsts.dlgfindtextatcursor 1948msgid "Find text at cursor" 1949msgstr "Zoek Tekst (op cursor)" 1950 1951#: lazarusidestrconsts.dlgfolddiffchunk 1952msgid "Chunk" 1953msgstr "" 1954 1955#: lazarusidestrconsts.dlgfolddiffchunksect 1956msgid "Chunk section" 1957msgstr "" 1958 1959#: lazarusidestrconsts.dlgfoldhtmlasp 1960msgid "ASP" 1961msgstr "" 1962 1963#: lazarusidestrconsts.dlgfoldhtmlcomment 1964msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment" 1965msgid "Comment" 1966msgstr "" 1967 1968#: lazarusidestrconsts.dlgfoldhtmlnode 1969msgctxt "lazarusidestrconsts.dlgfoldhtmlnode" 1970msgid "Node" 1971msgstr "" 1972 1973#: lazarusidestrconsts.dlgfoldlfmitem 1974msgid "Item" 1975msgstr "" 1976 1977#: lazarusidestrconsts.dlgfoldlfmlist 1978msgid "List <>" 1979msgstr "" 1980 1981#: lazarusidestrconsts.dlgfoldlfmobject 1982msgid "Object (inherited, inline)" 1983msgstr "" 1984 1985#: lazarusidestrconsts.dlgfoldlocalpasvartype 1986msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype" 1987msgid "Var/Type (local)" 1988msgstr "" 1989 1990#: lazarusidestrconsts.dlgfoldpasansicomment 1991msgid "Comment (* *)" 1992msgstr "" 1993 1994#: lazarusidestrconsts.dlgfoldpasasm 1995msgid "Asm" 1996msgstr "" 1997 1998#: lazarusidestrconsts.dlgfoldpasbeginend 1999msgid "Begin/End (nested)" 2000msgstr "" 2001 2002#: lazarusidestrconsts.dlgfoldpasborcomment 2003msgid "Comment { }" 2004msgstr "" 2005 2006#: lazarusidestrconsts.dlgfoldpascase 2007msgid "Case" 2008msgstr "" 2009 2010#: lazarusidestrconsts.dlgfoldpasclass 2011msgid "Class/Object" 2012msgstr "" 2013 2014#: lazarusidestrconsts.dlgfoldpasclasssection 2015msgid "public/private" 2016msgstr "" 2017 2018#: lazarusidestrconsts.dlgfoldpasexcept 2019msgid "Except/Finally" 2020msgstr "" 2021 2022#: lazarusidestrconsts.dlgfoldpasfordo 2023msgid "For/Do" 2024msgstr "" 2025 2026#: lazarusidestrconsts.dlgfoldpasifdef 2027msgid "{$IfDef}" 2028msgstr "" 2029 2030#: lazarusidestrconsts.dlgfoldpasifthen 2031msgid "If/Then/Else" 2032msgstr "" 2033 2034#: lazarusidestrconsts.dlgfoldpasnestedcomment 2035msgid "Nested Comment" 2036msgstr "" 2037 2038#: lazarusidestrconsts.dlgfoldpasprocbeginend 2039msgid "Begin/End (procedure)" 2040msgstr "" 2041 2042#: lazarusidestrconsts.dlgfoldpasprocedure 2043msgctxt "lazarusidestrconsts.dlgfoldpasprocedure" 2044msgid "Procedure" 2045msgstr "Procedure" 2046 2047#: lazarusidestrconsts.dlgfoldpasprogram 2048msgctxt "lazarusidestrconsts.dlgfoldpasprogram" 2049msgid "Program" 2050msgstr "Programma" 2051 2052#: lazarusidestrconsts.dlgfoldpasrecord 2053msgctxt "lazarusidestrconsts.dlgfoldpasrecord" 2054msgid "Record" 2055msgstr "" 2056 2057#: lazarusidestrconsts.dlgfoldpasrepeat 2058msgctxt "lazarusidestrconsts.dlgfoldpasrepeat" 2059msgid "Repeat" 2060msgstr "" 2061 2062#: lazarusidestrconsts.dlgfoldpasslashcomment 2063msgid "Comment //" 2064msgstr "" 2065 2066#: lazarusidestrconsts.dlgfoldpastry 2067msgid "Try" 2068msgstr "" 2069 2070#: lazarusidestrconsts.dlgfoldpasunit 2071msgctxt "lazarusidestrconsts.dlgfoldpasunit" 2072msgid "Unit" 2073msgstr "Unit" 2074 2075#: lazarusidestrconsts.dlgfoldpasunitsection 2076msgid "Unit section" 2077msgstr "" 2078 2079#: lazarusidestrconsts.dlgfoldpasuserregion 2080msgid "{%Region}" 2081msgstr "" 2082 2083#: lazarusidestrconsts.dlgfoldpasuses 2084msgctxt "lazarusidestrconsts.dlgfoldpasuses" 2085msgid "Uses" 2086msgstr "" 2087 2088#: lazarusidestrconsts.dlgfoldpasvartype 2089msgid "Var/Type (global)" 2090msgstr "" 2091 2092#: lazarusidestrconsts.dlgfoldpaswhiledo 2093msgid "While/Do" 2094msgstr "" 2095 2096#: lazarusidestrconsts.dlgfoldpaswithdo 2097msgid "With/Do" 2098msgstr "" 2099 2100#: lazarusidestrconsts.dlgfoldxmlcdata 2101msgid "CData" 2102msgstr "" 2103 2104#: lazarusidestrconsts.dlgfoldxmlcomment 2105msgctxt "lazarusidestrconsts.dlgfoldxmlcomment" 2106msgid "Comment" 2107msgstr "" 2108 2109#: lazarusidestrconsts.dlgfoldxmldoctype 2110msgid "DocType" 2111msgstr "" 2112 2113#: lazarusidestrconsts.dlgfoldxmlnode 2114msgctxt "lazarusidestrconsts.dlgfoldxmlnode" 2115msgid "Node" 2116msgstr "" 2117 2118#: lazarusidestrconsts.dlgfoldxmlprocess 2119msgid "Processing Instruction" 2120msgstr "" 2121 2122#: lazarusidestrconsts.dlgforcedpiscalingindesigntime 2123msgid "Force DPI scaling in design-time" 2124msgstr "" 2125 2126#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint 2127msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account." 2128msgstr "" 2129 2130#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror 2131msgid "The running Lazarus instance cannot accept any files." 2132msgstr "" 2133 2134#: lazarusidestrconsts.dlgforecolor 2135msgid "Foreground" 2136msgstr "Voorgrond kleur" 2137 2138#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector 2139msgid "Change Object Inspector contents on clicking form title bar" 2140msgstr "" 2141 2142#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint 2143msgid "Show a form's properties in Object Inspector by clicking on its title bar." 2144msgstr "" 2145 2146#: lazarusidestrconsts.dlgforwardprocsinsertpolicy 2147msgid "Procedure insert policy" 2148msgstr "Wijze van procedures toevoegen" 2149 2150#: lazarusidestrconsts.dlgforwardprocskeeporder 2151msgid "Keep order of procedures" 2152msgstr "Houd procedure volgorde aan" 2153 2154#: lazarusidestrconsts.dlgfpcexecutable 2155#, object-pascal-format 2156msgid "Compiler executable (e.g. %s)" 2157msgstr "" 2158 2159#: lazarusidestrconsts.dlgfpcsrcpath 2160msgid "FPC source directory" 2161msgstr "FPC broncode directory" 2162 2163#: lazarusidestrconsts.dlgfppkgconfigurationfile 2164msgid "Fppkg configuration file (e.g. fppkg.cfg)" 2165msgstr "" 2166 2167#: lazarusidestrconsts.dlgframecolor 2168msgid "Text-mark" 2169msgstr "" 2170 2171#: lazarusidestrconsts.dlgfrmeditor 2172msgid "Form Editor" 2173msgstr "Formulierbewerker" 2174 2175#: lazarusidestrconsts.dlgfrombeginning 2176msgid "From b&eginning" 2177msgstr "" 2178 2179#: lazarusidestrconsts.dlgfromcursor 2180msgid "From c&ursor" 2181msgstr "" 2182 2183#: lazarusidestrconsts.dlgglobal 2184msgid "&Global" 2185msgstr "" 2186 2187#: lazarusidestrconsts.dlggprof 2188msgid "Generate code for gprof" 2189msgstr "Genereer code voor gprof" 2190 2191#: lazarusidestrconsts.dlggrabbercolor 2192msgid "Grabber color" 2193msgstr "Kleur opnemen" 2194 2195#: lazarusidestrconsts.dlggrayeddesktopsdocked 2196msgid "Grayed desktops are for docked environment." 2197msgstr "" 2198 2199#: lazarusidestrconsts.dlggrayeddesktopsundocked 2200msgid "Grayed desktops are for undocked environment." 2201msgstr "" 2202 2203#: lazarusidestrconsts.dlggridcolor 2204msgid "Grid color" 2205msgstr "Rasterkleur" 2206 2207#: lazarusidestrconsts.dlggridconsistsofsmalldots 2208msgid "Grid consists of small dots which help aligning controls." 2209msgstr "" 2210 2211#: lazarusidestrconsts.dlggridx 2212msgid "Grid size X" 2213msgstr "Rastergrootte X" 2214 2215#: lazarusidestrconsts.dlggridxhint 2216msgid "Horizontal grid step size" 2217msgstr "Horizontale rasterafstand" 2218 2219#: lazarusidestrconsts.dlggridy 2220msgid "Grid size Y" 2221msgstr "Rastergrootte Y" 2222 2223#: lazarusidestrconsts.dlggridyhint 2224msgid "Vertical grid step size" 2225msgstr "Vertikale stapgrootte van raster" 2226 2227#: lazarusidestrconsts.dlggroupcodeexplorer 2228#, fuzzy 2229msgctxt "lazarusidestrconsts.dlggroupcodeexplorer" 2230msgid "Code Explorer" 2231msgstr "Codeverkenner" 2232 2233#: lazarusidestrconsts.dlggroupcodetools 2234msgid "Codetools" 2235msgstr "" 2236 2237#: lazarusidestrconsts.dlggroupdebugger 2238msgctxt "lazarusidestrconsts.dlggroupdebugger" 2239msgid "Debugger" 2240msgstr "" 2241 2242#: lazarusidestrconsts.dlggroupeditor 2243msgid "Editor" 2244msgstr "" 2245 2246#: lazarusidestrconsts.dlggroupenvironment 2247msgctxt "lazarusidestrconsts.dlggroupenvironment" 2248msgid "Environment" 2249msgstr "Omgeving" 2250 2251#: lazarusidestrconsts.dlggroupundo 2252msgid "Group Undo" 2253msgstr "" 2254 2255#: lazarusidestrconsts.dlgguidelines 2256msgid "Show Guide Lines" 2257msgstr "Toon steunlijnen" 2258 2259#: lazarusidestrconsts.dlgguidelineshint 2260msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown." 2261msgstr "" 2262 2263#: lazarusidestrconsts.dlggutter 2264msgctxt "lazarusidestrconsts.dlggutter" 2265msgid "Gutter" 2266msgstr "" 2267 2268#: lazarusidestrconsts.dlgguttercollapsedcolor 2269msgid "Collapsed" 2270msgstr "" 2271 2272#: lazarusidestrconsts.dlgguttercolor 2273msgid "Gutter Color" 2274msgstr "Goot kleur" 2275 2276#: lazarusidestrconsts.dlggutteredgecolor 2277msgid "Gutter Edge Color" 2278msgstr "" 2279 2280#: lazarusidestrconsts.dlggutterseparatorindex 2281msgid "Gutter separator index" 2282msgstr "" 2283 2284#: lazarusidestrconsts.dlghalfpagescroll 2285msgid "Half page scroll" 2286msgstr "Halve pagina scroll" 2287 2288#: lazarusidestrconsts.dlgheapandstacksize 2289msgid "Heap and stack sizes" 2290msgstr "" 2291 2292#: lazarusidestrconsts.dlgheapsize 2293#, fuzzy 2294#| msgid "Heap Size" 2295msgid "Heap size" 2296msgstr "Heap grootte" 2297 2298#: lazarusidestrconsts.dlgheightofonepropertyingrid 2299msgid "Height of one property in the grid." 2300msgstr "" 2301 2302#: lazarusidestrconsts.dlgheightpos 2303msgid "Height:" 2304msgstr "Hoogte:" 2305 2306#: lazarusidestrconsts.dlghideideonrun 2307msgid "Hide IDE windows on run" 2308msgstr "Verberg IDE vensters bij uitvoeren" 2309 2310#: lazarusidestrconsts.dlghideideonrunhint 2311msgid "Do not show the IDE at all while program is running." 2312msgstr "" 2313 2314#: lazarusidestrconsts.dlghidesingletabinnotebook 2315msgid "Hide tab in single page windows" 2316msgstr "" 2317 2318#: lazarusidestrconsts.dlghighlightcolor 2319msgid "Highlight Color" 2320msgstr "" 2321 2322#: lazarusidestrconsts.dlghighlightfontcolor 2323msgid "Highlight Font Color" 2324msgstr "" 2325 2326#: lazarusidestrconsts.dlghighlightleftofcursor 2327msgid "Left Of Caret" 2328msgstr "" 2329 2330#: lazarusidestrconsts.dlghighlightrightofcursor 2331msgid "Right Of Caret" 2332msgstr "" 2333 2334#: lazarusidestrconsts.dlghintsparametersendernotused 2335#, fuzzy 2336#| msgid "Show Hints for parameter \"Sender\" not used" 2337msgid "Show hints for parameter \"Sender\" not used" 2338msgstr "Toon Hints voor parameter \"Sender\" niet gebruikt" 2339 2340#: lazarusidestrconsts.dlghintsunused 2341#, fuzzy 2342#| msgid "Show Hints for unused units in main source" 2343msgid "Show hints for unused units in main" 2344msgstr "Toon Hints voor ongebruikte units in de hoofd broncode" 2345 2346#: lazarusidestrconsts.dlghomekeyjumpstoneareststart 2347msgid "Home key jumps to nearest start" 2348msgstr "Home toets springt naar dichtsbijzijnde begin" 2349 2350#: lazarusidestrconsts.dlghostapplication 2351msgid "Host application" 2352msgstr "Host applicatie" 2353 2354#: lazarusidestrconsts.dlgidentifiercompletion 2355#, fuzzy 2356#| msgid "Identifier completion" 2357msgctxt "lazarusidestrconsts.dlgidentifiercompletion" 2358msgid "Identifier Completion" 2359msgstr "Identifier completering" 2360 2361#: lazarusidestrconsts.dlgidentifierpolicy 2362msgid "Identifier policy" 2363msgstr "Identifier beleid" 2364 2365#: lazarusidestrconsts.dlgideoptions 2366msgid "IDE Options" 2367msgstr "" 2368 2369#: lazarusidestrconsts.dlgifdefblockactive 2370msgid "Active $IFDEF code" 2371msgstr "" 2372 2373#: lazarusidestrconsts.dlgifdefblockinactive 2374msgid "Inactive $IFDEF code" 2375msgstr "" 2376 2377#: lazarusidestrconsts.dlgifdefblocktmpactive 2378msgid "Included mixed state $IFDEF code" 2379msgstr "" 2380 2381#: lazarusidestrconsts.dlgifdefnodeactive 2382msgid "Active $IFDEF node" 2383msgstr "" 2384 2385#: lazarusidestrconsts.dlgifdefnodeinactive 2386msgid "Inactive $IFDEF node" 2387msgstr "" 2388 2389#: lazarusidestrconsts.dlgifdefnodetmpactive 2390msgid "Included mixed state $IFDEF node" 2391msgstr "" 2392 2393#: lazarusidestrconsts.dlgimportdesktopexists 2394msgid "" 2395"A desktop with the same name already exists.\n" 2396"Please confirm the desktop name:" 2397msgstr "" 2398 2399#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl 2400msgid "Include code templates" 2401msgstr "" 2402 2403#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix 2404msgid "Include identifiers containing prefix" 2405msgstr "" 2406 2407#: lazarusidestrconsts.dlgincludesystemvariables 2408msgid "Include system variables" 2409msgstr "Include systeemvariabelen" 2410 2411#: lazarusidestrconsts.dlgincludewordstoidentcompl 2412msgid "Include words" 2413msgstr "" 2414 2415#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude 2416msgid "don't include" 2417msgstr "" 2418 2419#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits 2420msgid "from all units" 2421msgstr "" 2422 2423#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit 2424msgid "from current unit" 2425msgstr "" 2426 2427#: lazarusidestrconsts.dlgindentsindentgroupoptions 2428msgid "Indent" 2429msgstr "" 2430 2431#: lazarusidestrconsts.dlgindentstabsgroupoptions 2432msgid "Tabs" 2433msgstr "" 2434 2435#: lazarusidestrconsts.dlginfrontofmethods 2436msgid "In front of methods" 2437msgstr "Voor methoden" 2438 2439#: lazarusidestrconsts.dlginitdoneonly 2440msgid "Constructor name must be 'init' (destructor must be 'done')" 2441msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')" 2442 2443#: lazarusidestrconsts.dlginsertclassparts 2444msgid "Insert class parts" 2445msgstr "" 2446 2447#: lazarusidestrconsts.dlginsertimplementation 2448msgid "Implementation" 2449msgstr "" 2450 2451#: lazarusidestrconsts.dlginsertinterface 2452msgid "Interface" 2453msgstr "" 2454 2455#: lazarusidestrconsts.dlginsertmethods 2456msgid "Insert method implementations" 2457msgstr "" 2458 2459#: lazarusidestrconsts.dlginsertsection 2460msgid "Insert into Uses section of" 2461msgstr "" 2462 2463#: lazarusidestrconsts.dlginsspaceafter 2464msgid "Insert space after" 2465msgstr "Spatie achter invoegen" 2466 2467#: lazarusidestrconsts.dlginsspacefront 2468msgid "Insert space in front of" 2469msgstr "Spatie voor invoegen" 2470 2471#: lazarusidestrconsts.dlgintvinsec 2472msgid "Interval in secs" 2473msgstr "Interval in seconden" 2474 2475#: lazarusidestrconsts.dlgjumpcodeblockpos 2476msgid "Vertical position for a code block jump in % (0=top, 100=bottom)" 2477msgstr "" 2478 2479#: lazarusidestrconsts.dlgjumpingetc 2480msgid "Jumping (e.g. Method Jumping)" 2481msgstr "Springen ('Method Jumping')" 2482 2483#: lazarusidestrconsts.dlgjumpsinglelinepos 2484msgid "Vertical position for a single line jump in % (0=top, 100=bottom)" 2485msgstr "" 2486 2487#: lazarusidestrconsts.dlgjumptomethodbody 2488msgid "Jump directly to method body" 2489msgstr "" 2490 2491#: lazarusidestrconsts.dlgkeepcursorx 2492msgid "Keep caret X position when navigating up/down" 2493msgstr "" 2494 2495#: lazarusidestrconsts.dlgkeylink 2496msgid "(Edit Key)" 2497msgstr "" 2498 2499#: lazarusidestrconsts.dlgkeymapping 2500msgid "Key Mappings" 2501msgstr "Toets mapping" 2502 2503#: lazarusidestrconsts.dlgkeymappingerrors 2504msgid "Key mapping errors" 2505msgstr "Toets mapping fouten" 2506 2507#: lazarusidestrconsts.dlgkeywordpolicy 2508msgid "Keyword policy" 2509msgstr "Sleutelwoord policy" 2510 2511#: lazarusidestrconsts.dlglabelgoto 2512msgid "Allow LABEL and GOTO" 2513msgstr "Sta LABEL en GOTO toe" 2514 2515#: lazarusidestrconsts.dlglang 2516msgctxt "lazarusidestrconsts.dlglang" 2517msgid "Language" 2518msgstr "Taal" 2519 2520#: lazarusidestrconsts.dlglast 2521msgid "Last (i.e. at end of source)" 2522msgstr "Laatste (einde broncode)" 2523 2524#: lazarusidestrconsts.dlglazarusdir 2525msgid "Lazarus directory (default for all projects)" 2526msgstr "Lazarus directory (standaard voor alle projecten)" 2527 2528#: lazarusidestrconsts.dlglazarusinstances 2529msgid "Lazarus instances" 2530msgstr "" 2531 2532#: lazarusidestrconsts.dlglefttopclr 2533#, fuzzy 2534#| msgid "Guid lines Left,Top" 2535msgid "Guide lines Left,Top" 2536msgstr "Kleur voor links, boven" 2537 2538#: lazarusidestrconsts.dlglevel1opt 2539msgid "1 (quick, debugger friendly with small limitations)" 2540msgstr "" 2541 2542#: lazarusidestrconsts.dlglevel2opt 2543msgid "2 (-O1 + quick optimizations)" 2544msgstr "" 2545 2546#: lazarusidestrconsts.dlglevel3opt 2547msgid "3 (-O2 + slow optimizations)" 2548msgstr "" 2549 2550#: lazarusidestrconsts.dlglevel4opt 2551msgid "4 (-O3 + aggressive optimizations, beware)" 2552msgstr "" 2553 2554#: lazarusidestrconsts.dlglevelnoneopt 2555#, fuzzy 2556#| msgid "Level 0 (no extra optimizations)" 2557msgid "0 (no optimization, for debugging)" 2558msgstr "Level 0 (geen extra optimalisaties)" 2559 2560#: lazarusidestrconsts.dlglinesplitting 2561msgid "Line Splitting" 2562msgstr "Regel splitsen" 2563 2564#: lazarusidestrconsts.dlglinksmart 2565#, fuzzy 2566#| msgid "Link Smart" 2567msgid "Link smart" 2568msgstr "Slim linken" 2569 2570#: lazarusidestrconsts.dlglnumsbct 2571#, fuzzy 2572#| msgid "Display Line Numbers in Run-time Error Backtraces" 2573msgid "Display line numbers in run-time error backtraces" 2574msgstr "Toon regelnummers in Run-time Error Backtraces" 2575 2576#: lazarusidestrconsts.dlgmainmenu 2577msgid "Main Menu" 2578msgstr "Hoofd menu" 2579 2580#: lazarusidestrconsts.dlgmainviewforms 2581#, fuzzy 2582#| msgid "View project forms" 2583msgid "View Project Forms" 2584msgstr "Toon Project Forms" 2585 2586#: lazarusidestrconsts.dlgmainviewframes 2587msgid "View Project Frames" 2588msgstr "" 2589 2590#: lazarusidestrconsts.dlgmainviewunits 2591#, fuzzy 2592#| msgid "View project units" 2593msgctxt "lazarusidestrconsts.dlgmainviewunits" 2594msgid "View Project Units" 2595msgstr "Toon Project Units" 2596 2597#: lazarusidestrconsts.dlgmakeexecutable 2598msgid "\"Make\" executable" 2599msgstr "" 2600 2601#: lazarusidestrconsts.dlgmanagedesktops 2602msgid "Manage desktops" 2603msgstr "" 2604 2605#: lazarusidestrconsts.dlgmargingutter 2606msgid "Margin and gutter" 2607msgstr "Marge en goot" 2608 2609#: lazarusidestrconsts.dlgmarkercolor 2610msgid "Marker color" 2611msgstr "Marker kleur" 2612 2613#: lazarusidestrconsts.dlgmarkupfoldcolor 2614msgid "Vertical-mark" 2615msgstr "" 2616 2617#: lazarusidestrconsts.dlgmarkupgroup 2618msgid "Highlight all occurrences of Word under Caret" 2619msgstr "" 2620 2621#: lazarusidestrconsts.dlgmarkupoutline 2622msgid "Outline (global)" 2623msgstr "" 2624 2625#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor 2626msgid "Warning: There are no colors configured for the selected language" 2627msgstr "" 2628 2629#: lazarusidestrconsts.dlgmarkupuserdefined 2630msgctxt "lazarusidestrconsts.dlgmarkupuserdefined" 2631msgid "User defined markup" 2632msgstr "" 2633 2634#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption 2635msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption" 2636msgid "Delete" 2637msgstr "Verwijder" 2638 2639#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt 2640#, object-pascal-format 2641msgid "Delete list \"%s\"?" 2642msgstr "" 2643 2644#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd 2645msgid "Add Word or Term" 2646msgstr "" 2647 2648#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove 2649msgid "Remove Word or Term" 2650msgstr "" 2651 2652#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle 2653msgid "Toggle Word or Term" 2654msgstr "" 2655 2656#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate 2657msgid "Duplicate Term" 2658msgstr "" 2659 2660#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg 2661#, object-pascal-format 2662msgid "The term %s already exists. Duplicates will be removed when the list is saved." 2663msgstr "" 2664 2665#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist 2666msgid "Add/Remove in all editors" 2667msgstr "" 2668 2669#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel 2670msgid "Delete list" 2671msgstr "" 2672 2673#: lazarusidestrconsts.dlgmarkupuserdefinedlistname 2674msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname" 2675msgid "Name" 2676msgstr "Naam" 2677 2678#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew 2679msgid "Add list" 2680msgstr "" 2681 2682#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase 2683msgid "Case sensitive" 2684msgstr "" 2685 2686#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound 2687msgid "Set bound at term end" 2688msgstr "" 2689 2690#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound 2691msgid "Set bound at term start" 2692msgstr "" 2693 2694#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen 2695msgid "Ignore bounds for terms longer than" 2696msgstr "" 2697 2698#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect 2699msgid "selection" 2700msgstr "" 2701 2702#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword 2703msgid "current word" 2704msgstr "" 2705 2706#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts 2707msgid "Settings for terms added by key" 2708msgstr "" 2709 2710#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect 2711msgid "Smart match selection bounds" 2712msgstr "" 2713 2714#: lazarusidestrconsts.dlgmarkupuserdefinednewname 2715msgid "New list" 2716msgstr "" 2717 2718#: lazarusidestrconsts.dlgmarkupuserdefinednolists 2719msgid "No lists" 2720msgstr "" 2721 2722#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel 2723msgid "Select ..." 2724msgstr "" 2725 2726#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys 2727msgid "Key Settings" 2728msgstr "" 2729 2730#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain 2731msgid "Main settings" 2732msgstr "" 2733 2734#: lazarusidestrconsts.dlgmarkupwordbracket 2735msgid "Keyword brackets on caret (global)" 2736msgstr "" 2737 2738#: lazarusidestrconsts.dlgmarkupwordfulllen 2739msgid "Match whole words, if length is less or equal to:" 2740msgstr "" 2741 2742#: lazarusidestrconsts.dlgmarkupwordnokeyword 2743msgid "Ignore keywords" 2744msgstr "" 2745 2746#: lazarusidestrconsts.dlgmarkupwordnotimer 2747msgid "Disable timer for markup current word" 2748msgstr "" 2749 2750#: lazarusidestrconsts.dlgmarkupwordtrim 2751msgid "Trim spaces (when highlighting current selection)" 2752msgstr "" 2753 2754#: lazarusidestrconsts.dlgmaxcntr 2755msgid "Maximum counter" 2756msgstr "Maximum teller" 2757 2758#: lazarusidestrconsts.dlgmaxlinelength 2759msgid "Max line length:" 2760msgstr "Max regellengte" 2761 2762#: lazarusidestrconsts.dlgmaxrecentfiles 2763msgid "Max recent files" 2764msgstr "Max aantal recente bestanden" 2765 2766#: lazarusidestrconsts.dlgmaxrecenthint 2767msgid "Value 0 means unlimited." 2768msgstr "" 2769 2770#: lazarusidestrconsts.dlgmaxrecentprojs 2771msgid "Max recent project files" 2772msgstr "Max aantal recente projecten" 2773 2774#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod 2775msgid "Middle-click-modifier to close all other tabs" 2776msgstr "" 2777 2778#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod 2779msgid "Middle-click-modifier to close tabs on the right" 2780msgstr "" 2781 2782#: lazarusidestrconsts.dlgmixmethodsandproperties 2783msgid "Mix methods and properties" 2784msgstr "Mix methodes en properties" 2785 2786#: lazarusidestrconsts.dlgmode 2787msgid "Mode" 2788msgstr "" 2789 2790#: lazarusidestrconsts.dlgmouseaction 2791msgid "Mouse Action" 2792msgstr "" 2793 2794#: lazarusidestrconsts.dlgmouseoptbtn1 2795msgctxt "lazarusidestrconsts.dlgmouseoptbtn1" 2796msgid "Single" 2797msgstr "" 2798 2799#: lazarusidestrconsts.dlgmouseoptbtn2 2800msgctxt "lazarusidestrconsts.dlgmouseoptbtn2" 2801msgid "Double" 2802msgstr "" 2803 2804#: lazarusidestrconsts.dlgmouseoptbtn3 2805msgctxt "lazarusidestrconsts.dlgmouseoptbtn3" 2806msgid "Triple" 2807msgstr "" 2808 2809#: lazarusidestrconsts.dlgmouseoptbtn4 2810msgctxt "lazarusidestrconsts.dlgmouseoptbtn4" 2811msgid "Quad" 2812msgstr "" 2813 2814#: lazarusidestrconsts.dlgmouseoptbtnany 2815msgid "Any" 2816msgstr "" 2817 2818#: lazarusidestrconsts.dlgmouseoptbtnextra1 2819msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1" 2820msgid "Extra 1" 2821msgstr "" 2822 2823#: lazarusidestrconsts.dlgmouseoptbtnextra2 2824msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2" 2825msgid "Extra 2" 2826msgstr "" 2827 2828#: lazarusidestrconsts.dlgmouseoptbtnleft 2829msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft" 2830msgid "Left" 2831msgstr "Links" 2832 2833#: lazarusidestrconsts.dlgmouseoptbtnmiddle 2834msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle" 2835msgid "Middle" 2836msgstr "" 2837 2838#: lazarusidestrconsts.dlgmouseoptbtnmoddef 2839msgid "Make Fallback" 2840msgstr "" 2841 2842#: lazarusidestrconsts.dlgmouseoptbtnright 2843msgctxt "lazarusidestrconsts.dlgmouseoptbtnright" 2844msgid "Right" 2845msgstr "Rechts" 2846 2847#: lazarusidestrconsts.dlgmouseoptbtnwheeldown 2848msgid "Wheel down" 2849msgstr "" 2850 2851#: lazarusidestrconsts.dlgmouseoptbtnwheelleft 2852msgid "Wheel left" 2853msgstr "" 2854 2855#: lazarusidestrconsts.dlgmouseoptbtnwheelright 2856msgid "Wheel right" 2857msgstr "" 2858 2859#: lazarusidestrconsts.dlgmouseoptbtnwheelup 2860msgid "Wheel up" 2861msgstr "" 2862 2863#: lazarusidestrconsts.dlgmouseoptcapture 2864msgid "Capture" 2865msgstr "" 2866 2867#: lazarusidestrconsts.dlgmouseoptcaretmove 2868msgid "Move Caret (extra)" 2869msgstr "" 2870 2871#: lazarusidestrconsts.dlgmouseoptcheckupdown 2872msgid "Act on Mouse up" 2873msgstr "" 2874 2875#: lazarusidestrconsts.dlgmouseoptdescaction 2876msgctxt "lazarusidestrconsts.dlgmouseoptdescaction" 2877msgid "Action" 2878msgstr "" 2879 2880#: lazarusidestrconsts.dlgmouseoptdescbutton 2881msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton" 2882msgid "Click" 2883msgstr "" 2884 2885#: lazarusidestrconsts.dlgmouseoptdlgtitle 2886msgid "Edit Mouse" 2887msgstr "" 2888 2889#: lazarusidestrconsts.dlgmouseopterrordup 2890msgid "Duplicate Entry" 2891msgstr "" 2892 2893#: lazarusidestrconsts.dlgmouseopterrorduptext 2894msgid "This entry conflicts with an existing entry" 2895msgstr "" 2896 2897#: lazarusidestrconsts.dlgmouseoptheadalt 2898msgctxt "lazarusidestrconsts.dlgmouseoptheadalt" 2899msgid "Alt" 2900msgstr "Alt" 2901 2902#: lazarusidestrconsts.dlgmouseoptheadbtn 2903msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn" 2904msgid "Button" 2905msgstr "" 2906 2907#: lazarusidestrconsts.dlgmouseoptheadcaret 2908msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret" 2909msgid "Caret" 2910msgstr "" 2911 2912#: lazarusidestrconsts.dlgmouseoptheadcontext 2913msgid "Context" 2914msgstr "" 2915 2916#: lazarusidestrconsts.dlgmouseoptheadcount 2917msgctxt "lazarusidestrconsts.dlgmouseoptheadcount" 2918msgid "Click" 2919msgstr "" 2920 2921#: lazarusidestrconsts.dlgmouseoptheadctrl 2922msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl" 2923msgid "Ctrl" 2924msgstr "Ctrl" 2925 2926#: lazarusidestrconsts.dlgmouseoptheaddesc 2927msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc" 2928msgid "Action" 2929msgstr "" 2930 2931#: lazarusidestrconsts.dlgmouseoptheaddir 2932msgid "Up/Down" 2933msgstr "" 2934 2935#: lazarusidestrconsts.dlgmouseoptheadopt 2936msgid "Option" 2937msgstr "" 2938 2939#: lazarusidestrconsts.dlgmouseoptheadorder 2940msgctxt "lazarusidestrconsts.dlgmouseoptheadorder" 2941msgid "Order" 2942msgstr "Volgorde" 2943 2944#: lazarusidestrconsts.dlgmouseoptheadpriority 2945msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority" 2946msgid "Priority" 2947msgstr "" 2948 2949#: lazarusidestrconsts.dlgmouseoptheadshift 2950msgctxt "lazarusidestrconsts.dlgmouseoptheadshift" 2951msgid "Shift" 2952msgstr "Shift" 2953 2954#: lazarusidestrconsts.dlgmouseoptions 2955msgctxt "lazarusidestrconsts.dlgmouseoptions" 2956msgid "Mouse" 2957msgstr "" 2958 2959#: lazarusidestrconsts.dlgmouseoptionsadv 2960msgid "Advanced" 2961msgstr "" 2962 2963#: lazarusidestrconsts.dlgmouseoptionsyncommand 2964msgid "IDE-Command" 2965msgstr "" 2966 2967#: lazarusidestrconsts.dlgmouseoptmodalt 2968msgctxt "lazarusidestrconsts.dlgmouseoptmodalt" 2969msgid "Alt" 2970msgstr "Alt" 2971 2972#: lazarusidestrconsts.dlgmouseoptmodctrl 2973msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl" 2974msgid "Ctrl" 2975msgstr "Ctrl" 2976 2977#: lazarusidestrconsts.dlgmouseoptmodkeyfalse 2978msgid "n" 2979msgstr "" 2980 2981#: lazarusidestrconsts.dlgmouseoptmodkeyignore 2982msgid "-" 2983msgstr "" 2984 2985#: lazarusidestrconsts.dlgmouseoptmodkeytrue 2986msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue" 2987msgid "Y" 2988msgstr "" 2989 2990#: lazarusidestrconsts.dlgmouseoptmodshift 2991msgctxt "lazarusidestrconsts.dlgmouseoptmodshift" 2992msgid "Shift" 2993msgstr "Shift" 2994 2995#: lazarusidestrconsts.dlgmouseoptmovemousetrue 2996msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue" 2997msgid "Y" 2998msgstr "" 2999 3000#: lazarusidestrconsts.dlgmouseoptnodeall 3001msgctxt "lazarusidestrconsts.dlgmouseoptnodeall" 3002msgid "All" 3003msgstr "" 3004 3005#: lazarusidestrconsts.dlgmouseoptnodegutter 3006msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter" 3007msgid "Gutter" 3008msgstr "" 3009 3010#: lazarusidestrconsts.dlgmouseoptnodegutterchanges 3011msgid "Line Changes" 3012msgstr "" 3013 3014#: lazarusidestrconsts.dlgmouseoptnodegutterfold 3015msgid "Fold Tree" 3016msgstr "" 3017 3018#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol 3019msgid "Collapsed [+]" 3020msgstr "" 3021 3022#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp 3023msgid "Expanded [-]" 3024msgstr "" 3025 3026#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview 3027msgid "Overview" 3028msgstr "" 3029 3030#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks 3031msgid "Overview Mark" 3032msgstr "" 3033 3034#: lazarusidestrconsts.dlgmouseoptnodegutterlines 3035msgid "Line Numbers" 3036msgstr "" 3037 3038#: lazarusidestrconsts.dlgmouseoptnodemain 3039msgctxt "lazarusidestrconsts.dlgmouseoptnodemain" 3040msgid "Text" 3041msgstr "Tekst" 3042 3043#: lazarusidestrconsts.dlgmouseoptnodeselect 3044msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect" 3045msgid "Selection" 3046msgstr "Selectie" 3047 3048#: lazarusidestrconsts.dlgmouseoptopt2label 3049msgid "Opt" 3050msgstr "" 3051 3052#: lazarusidestrconsts.dlgmouseoptotheract 3053msgid "Other actions using the same button" 3054msgstr "" 3055 3056#: lazarusidestrconsts.dlgmouseoptotheracthint 3057msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..." 3058msgstr "" 3059 3060#: lazarusidestrconsts.dlgmouseoptotheracttoggle 3061msgid "Filter Mod-Keys" 3062msgstr "" 3063 3064#: lazarusidestrconsts.dlgmouseoptpriorlabel 3065msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel" 3066msgid "Priority" 3067msgstr "" 3068 3069#: lazarusidestrconsts.dlgmsgs 3070#, fuzzy 3071msgctxt "lazarusidestrconsts.dlgmsgs" 3072msgid "Messages" 3073msgstr "Berichten" 3074 3075#: lazarusidestrconsts.dlgmsgwincolorurgentdebug 3076#, fuzzy 3077msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug" 3078msgid "Debug" 3079msgstr "Debug" 3080 3081#: lazarusidestrconsts.dlgmsgwincolorurgenterror 3082#, fuzzy 3083msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror" 3084msgid "Error" 3085msgstr "Fout" 3086 3087#: lazarusidestrconsts.dlgmsgwincolorurgentfatal 3088msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal" 3089msgid "Fatal" 3090msgstr "" 3091 3092#: lazarusidestrconsts.dlgmsgwincolorurgenthint 3093msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint" 3094msgid "Hint" 3095msgstr "" 3096 3097#: lazarusidestrconsts.dlgmsgwincolorurgentimportant 3098msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant" 3099msgid "Important" 3100msgstr "" 3101 3102#: lazarusidestrconsts.dlgmsgwincolorurgentnone 3103msgid "Normal" 3104msgstr "" 3105 3106#: lazarusidestrconsts.dlgmsgwincolorurgentnote 3107msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote" 3108msgid "Note" 3109msgstr "" 3110 3111#: lazarusidestrconsts.dlgmsgwincolorurgentpanic 3112msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic" 3113msgid "Panic" 3114msgstr "" 3115 3116#: lazarusidestrconsts.dlgmsgwincolorurgentprogress 3117msgid "Time and statistics" 3118msgstr "" 3119 3120#: lazarusidestrconsts.dlgmsgwincolorurgentverbose 3121msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose" 3122msgid "Verbose" 3123msgstr "" 3124 3125#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2 3126msgid "Verbose 2" 3127msgstr "" 3128 3129#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3 3130msgid "Verbose 3" 3131msgstr "" 3132 3133#: lazarusidestrconsts.dlgmsgwincolorurgentwarning 3134msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning" 3135msgid "Warning" 3136msgstr "" 3137 3138#: lazarusidestrconsts.dlgmulticaretcolumnmode 3139msgid "Navigation keys move all carets (column-select)" 3140msgstr "" 3141 3142#: lazarusidestrconsts.dlgmulticaretdelskipcr 3143msgid "Skip delete key at EOL (do not join lines)" 3144msgstr "" 3145 3146#: lazarusidestrconsts.dlgmulticaretgroupoptions 3147msgid "Multi-caret" 3148msgstr "" 3149 3150#: lazarusidestrconsts.dlgmulticaretmode 3151msgid "Navigation keys move all carets" 3152msgstr "" 3153 3154#: lazarusidestrconsts.dlgmulticaretoncolumnselection 3155msgid "Enable multi-caret for column selection" 3156msgstr "" 3157 3158#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew 3159msgid "always start a new instance" 3160msgstr "" 3161 3162#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance 3163msgid "do not allow multiple instances" 3164msgstr "" 3165 3166#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning 3167msgid "open files in a running instance" 3168msgstr "" 3169 3170#: lazarusidestrconsts.dlgmultiselect 3171msgid "Multi Select" 3172msgstr "Meervoudige selectie" 3173 3174#: lazarusidestrconsts.dlgmultiwinaccessgroup 3175msgid "Jump target priority between multiple editors" 3176msgstr "" 3177 3178#: lazarusidestrconsts.dlgmultiwinaccessorder 3179msgid "Order to use for editors matching the same criteria" 3180msgstr "" 3181 3182#: lazarusidestrconsts.dlgmultiwinaccessorderedit 3183msgid "Most recent focused editor for this file" 3184msgstr "" 3185 3186#: lazarusidestrconsts.dlgmultiwinaccessorderwin 3187msgid "Editor (for file) in most recent focused window" 3188msgstr "" 3189 3190#: lazarusidestrconsts.dlgmultiwinaccesstype 3191msgid "Priority list of criteria to choose an editor:" 3192msgstr "" 3193 3194#: lazarusidestrconsts.dlgmultiwinoptions 3195msgid "Pages and Windows" 3196msgstr "" 3197 3198#: lazarusidestrconsts.dlgmultiwintabgroup 3199msgid "Notebook Tabs" 3200msgstr "" 3201 3202#: lazarusidestrconsts.dlgnaming 3203msgid "Naming" 3204msgstr "Naamgeving" 3205 3206#: lazarusidestrconsts.dlgnewdesktop 3207msgid "New desktop ..." 3208msgstr "" 3209 3210#: lazarusidestrconsts.dlgnewprojecttype 3211msgid "New Project Type" 3212msgstr "" 3213 3214#: lazarusidestrconsts.dlgnoautomaticrenaming 3215#, fuzzy 3216#| msgid "no automatic renaming" 3217msgid "No automatic renaming" 3218msgstr "niet automatisch hernoemen" 3219 3220#: lazarusidestrconsts.dlgnoavailableunits 3221msgid "No available units to add." 3222msgstr "" 3223 3224#: lazarusidestrconsts.dlgnobrackethighlight 3225msgid "No Highlight" 3226msgstr "" 3227 3228#: lazarusidestrconsts.dlgnonformbackgroundcolor 3229msgid "Other Designer background color (e. g. TDataModule)" 3230msgstr "" 3231 3232#: lazarusidestrconsts.dlgnotebooktabpos 3233msgid "Source notebook tabs position" 3234msgstr "" 3235 3236#: lazarusidestrconsts.dlgnotsplitlineafter 3237#, fuzzy 3238#| msgid "Do not split line after:" 3239msgid "Do not split line after" 3240msgstr "Splits een regel niet na :" 3241 3242#: lazarusidestrconsts.dlgnotsplitlinefront 3243#, fuzzy 3244#| msgid "Do not split line In front of:" 3245msgid "Do not split line in front of" 3246msgstr "Splits een regel niet voor :" 3247 3248#: lazarusidestrconsts.dlgnsprincipalclass 3249msgid "NSPrincipalClass" 3250msgstr "" 3251 3252#: lazarusidestrconsts.dlgobjinsp 3253#, fuzzy 3254msgctxt "lazarusidestrconsts.dlgobjinsp" 3255msgid "Object Inspector" 3256msgstr "Object Inspecteur" 3257 3258#: lazarusidestrconsts.dlgoiitemheight 3259#, fuzzy 3260#| msgid "Item height" 3261msgid "Item height (0 = auto)" 3262msgstr "Item hoogte" 3263 3264#: lazarusidestrconsts.dlgoimiscellaneous 3265msgctxt "lazarusidestrconsts.dlgoimiscellaneous" 3266msgid "Miscellaneous" 3267msgstr "Overige" 3268 3269#: lazarusidestrconsts.dlgoispeedsettings 3270msgid "Speed settings" 3271msgstr "" 3272 3273#: lazarusidestrconsts.dlgoiusedefaultdelphisettings 3274msgid "Use default Delphi settings" 3275msgstr "" 3276 3277#: lazarusidestrconsts.dlgoiusedefaultlazarussettings 3278msgid "Use default Lazarus settings" 3279msgstr "" 3280 3281#: lazarusidestrconsts.dlgoptimizationlevels 3282msgid "Optimization levels" 3283msgstr "" 3284 3285#: lazarusidestrconsts.dlgotheroptimizations 3286msgid "Other optimizations" 3287msgstr "" 3288 3289#: lazarusidestrconsts.dlgotherunitfiles 3290#, fuzzy 3291#| msgid "Other unit files (-Fu) (delimiter is semicolon):" 3292msgid "Other unit files (-Fu):" 3293msgstr "Andere unit bestanden (-Fu)" 3294 3295#: lazarusidestrconsts.dlgoverviewgutterback1color 3296msgid "Background 1" 3297msgstr "" 3298 3299#: lazarusidestrconsts.dlgoverviewgutterback2color 3300msgid "Background 2" 3301msgstr "" 3302 3303#: lazarusidestrconsts.dlgoverviewguttercolor 3304msgid "Overview Gutter" 3305msgstr "" 3306 3307#: lazarusidestrconsts.dlgoverviewgutterpagecolor 3308msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor" 3309msgid "Page" 3310msgstr "" 3311 3312#: lazarusidestrconsts.dlgoverwriteblock 3313msgid "Overwrite block" 3314msgstr "" 3315 3316#: lazarusidestrconsts.dlgoverwritedesktop 3317#, object-pascal-format 3318msgid "" 3319"Desktop with the name \"%s\" was found.\n" 3320"Should the old desktop be overwritten?" 3321msgstr "" 3322 3323#: lazarusidestrconsts.dlgpalhints 3324msgid "Hints for component palette" 3325msgstr "Hints voor componenten palet" 3326 3327#: lazarusidestrconsts.dlgpasext 3328#, fuzzy 3329#| msgid "Default pascal extension" 3330msgid "Default Pascal extension" 3331msgstr "Standaard pascal extenties" 3332 3333#: lazarusidestrconsts.dlgpasextkeywords 3334msgid "Highlight control statements as keywords" 3335msgstr "" 3336 3337#: lazarusidestrconsts.dlgpasextkeywordsgroup 3338msgid "Extended Pascal Keyword Options" 3339msgstr "" 3340 3341#: lazarusidestrconsts.dlgpaskeywordsmarkup 3342msgid "Markup (on caret)" 3343msgstr "" 3344 3345#: lazarusidestrconsts.dlgpaskeywordsmatches 3346msgid "Matching Keywords" 3347msgstr "" 3348 3349#: lazarusidestrconsts.dlgpaskeywordsoutline 3350msgid "Outline" 3351msgstr "" 3352 3353#: lazarusidestrconsts.dlgpassoptslinker 3354#, fuzzy 3355#| msgid "Pass options to linker (delimiter is space)" 3356msgid "Pass options to linker with \"-k\", delimiter is space" 3357msgstr "Geef opties door aan de linker (Spatie is scheidingsteken)" 3358 3359#: lazarusidestrconsts.dlgpasstringkeywords 3360msgid "Highlight \"String\" keyword(s)" 3361msgstr "" 3362 3363#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault 3364msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault" 3365msgid "Default" 3366msgstr "Standaard" 3367 3368#: lazarusidestrconsts.dlgpasstringkeywordsoptnone 3369msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone" 3370msgid "None" 3371msgstr "Geen" 3372 3373#: lazarusidestrconsts.dlgpasstringkeywordsoptstring 3374msgid "Only \"String\"" 3375msgstr "" 3376 3377#: lazarusidestrconsts.dlgpersistentblock 3378msgid "Persistent block" 3379msgstr "" 3380 3381#: lazarusidestrconsts.dlgpersistentcursor 3382msgid "Visible caret in unfocused editor" 3383msgstr "" 3384 3385#: lazarusidestrconsts.dlgpersistentcursornoblink 3386msgid "Caret in unfocused editor does not blink" 3387msgstr "" 3388 3389#: lazarusidestrconsts.dlgpoansiutf8 3390msgid "ANSI codepage is UTF-8 (Windows 10 1903+)" 3391msgstr "" 3392 3393#: lazarusidestrconsts.dlgpoapplication 3394msgid "Application" 3395msgstr "Applicatie" 3396 3397#: lazarusidestrconsts.dlgpoasinvoker 3398msgid "as invoker (asInvoker)" 3399msgstr "" 3400 3401#: lazarusidestrconsts.dlgpoclearicon 3402msgid "&Clear Icon" 3403msgstr "" 3404 3405#: lazarusidestrconsts.dlgpocreateappbundle 3406msgid "Create Application Bundle" 3407msgstr "" 3408 3409#: lazarusidestrconsts.dlgpodebugger 3410msgctxt "lazarusidestrconsts.dlgpodebugger" 3411msgid "Debugger" 3412msgstr "" 3413 3414#: lazarusidestrconsts.dlgpodefaulticon 3415msgid "Load &Default" 3416msgstr "" 3417 3418#: lazarusidestrconsts.dlgpodpiawareness 3419msgid "DPI awareness" 3420msgstr "" 3421 3422#: lazarusidestrconsts.dlgpodpiawarenessoff 3423msgid "off" 3424msgstr "" 3425 3426#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor 3427msgid "Vista-8: off, 8.1+: per monitor" 3428msgstr "" 3429 3430#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor 3431msgid "Vista-8: on, 8.1+: per monitor" 3432msgstr "" 3433 3434#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2 3435msgid "Vista-8: on, 8.1/10+: per monitor/V2" 3436msgstr "" 3437 3438#: lazarusidestrconsts.dlgpodpiawarenesson 3439msgid "on" 3440msgstr "" 3441 3442#: lazarusidestrconsts.dlgpoexecutionlevel 3443msgid "Execution Level" 3444msgstr "" 3445 3446#: lazarusidestrconsts.dlgpofroms 3447msgid "Forms" 3448msgstr "Forms" 3449 3450#: lazarusidestrconsts.dlgpohighestavailable 3451msgid "highest available (highestAvailable)" 3452msgstr "" 3453 3454#: lazarusidestrconsts.dlgpoi18n 3455msgid "i18n" 3456msgstr "" 3457 3458#: lazarusidestrconsts.dlgpoicon 3459msgid "Icon:" 3460msgstr "" 3461 3462#: lazarusidestrconsts.dlgpoicondesc 3463#, object-pascal-format 3464msgid "(size: %d:%d, bpp: %d)" 3465msgstr "" 3466 3467#: lazarusidestrconsts.dlgpoicondescnone 3468msgctxt "lazarusidestrconsts.dlgpoicondescnone" 3469msgid "(none)" 3470msgstr "" 3471 3472#: lazarusidestrconsts.dlgpoloadicon 3473msgid "&Load Icon" 3474msgstr "" 3475 3476#: lazarusidestrconsts.dlgpolongpathaware 3477msgid "Long path awareness" 3478msgstr "" 3479 3480#: lazarusidestrconsts.dlgpomisc 3481msgctxt "lazarusidestrconsts.dlgpomisc" 3482msgid "Miscellaneous" 3483msgstr "Overige" 3484 3485#: lazarusidestrconsts.dlgporequireadministrator 3486msgid "require administrator (requireAdministrator)" 3487msgstr "" 3488 3489#: lazarusidestrconsts.dlgporesources 3490msgid "Resources" 3491msgstr "" 3492 3493#: lazarusidestrconsts.dlgposaveicon 3494msgid "&Save Icon" 3495msgstr "" 3496 3497#: lazarusidestrconsts.dlgposavesession 3498msgid "Session" 3499msgstr "Sessie" 3500 3501#: lazarusidestrconsts.dlgpotitle 3502msgid "Title:" 3503msgstr "Titel:" 3504 3505#: lazarusidestrconsts.dlgpouiaccess 3506msgid "UI Access (uiAccess)" 3507msgstr "" 3508 3509#: lazarusidestrconsts.dlgpouseappbundle 3510msgid "Use Application Bundle for running and debugging" 3511msgstr "" 3512 3513#: lazarusidestrconsts.dlgpouselclscaling 3514msgid "Use LCL scaling (Hi-DPI)" 3515msgstr "" 3516 3517#: lazarusidestrconsts.dlgpousemanifest 3518msgid "Use manifest resource (and enable themes)" 3519msgstr "" 3520 3521#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick 3522msgid "Prefer double-click over single-click" 3523msgstr "" 3524 3525#: lazarusidestrconsts.dlgpriorities 3526msgid "Priorities" 3527msgstr "" 3528 3529#: lazarusidestrconsts.dlgproject 3530msgctxt "lazarusidestrconsts.dlgproject" 3531msgid "Project" 3532msgstr "" 3533 3534#: lazarusidestrconsts.dlgprojectoptions 3535msgid "Project Options" 3536msgstr "Project Opties" 3537 3538#: lazarusidestrconsts.dlgprojectoptionsfor 3539#, object-pascal-format 3540msgid "Options for Project: %s" 3541msgstr "" 3542 3543#: lazarusidestrconsts.dlgprojecttoopenorcreate 3544msgid "Project to Open or Create" 3545msgstr "" 3546 3547#: lazarusidestrconsts.dlgprojfiles 3548#, fuzzy 3549#| msgid "Project files" 3550msgid "Project Files" 3551msgstr "Project bestanden" 3552 3553#: lazarusidestrconsts.dlgpromptonreplace 3554msgid "&Prompt on replace" 3555msgstr "" 3556 3557#: lazarusidestrconsts.dlgpropertycompletion 3558msgid "Property completion" 3559msgstr "Propertie completering" 3560 3561#: lazarusidestrconsts.dlgpropnamecolor 3562msgid "Property Name" 3563msgstr "Propertie naam" 3564 3565#: lazarusidestrconsts.dlgqopenlastprj 3566#, fuzzy 3567#| msgid "Open last project at start" 3568msgid "Open last project and packages at start" 3569msgstr "Open laatste project bij start" 3570 3571#: lazarusidestrconsts.dlgqshowborderspacing 3572msgid "Show border spacing" 3573msgstr "Toon \"\"border spacing\"\"" 3574 3575#: lazarusidestrconsts.dlgqshowgrid 3576msgid "Show grid" 3577msgstr "Toon grid" 3578 3579#: lazarusidestrconsts.dlgqsnaptogrid 3580msgid "Snap to grid" 3581msgstr "Aan raster plakken" 3582 3583#: lazarusidestrconsts.dlgreallydeletedesktop 3584#, object-pascal-format 3585msgid "Really delete desktop \"%s\"?" 3586msgstr "" 3587 3588#: lazarusidestrconsts.dlgreferencecolor 3589msgid "Reference" 3590msgstr "Referentie" 3591 3592#: lazarusidestrconsts.dlgregularexpressions 3593msgid "Regular e&xpressions" 3594msgstr "" 3595 3596#: lazarusidestrconsts.dlgrenamedesktop 3597msgid "Rename desktop" 3598msgstr "" 3599 3600#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption 3601#, fuzzy 3602msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption" 3603msgid "Rename" 3604msgstr "Hernoemen" 3605 3606#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint 3607msgid "Rename selected desktop" 3608msgstr "" 3609 3610#: lazarusidestrconsts.dlgreplaceall 3611msgid "Replace &All" 3612msgstr "Vervang &alles" 3613 3614#: lazarusidestrconsts.dlgreplacewith 3615#, fuzzy 3616#| msgid "&Replace with" 3617msgid "Replace wit&h" 3618msgstr "&Vervang Door" 3619 3620#: lazarusidestrconsts.dlgreport 3621msgid "Report" 3622msgstr "Rapporteer" 3623 3624#: lazarusidestrconsts.dlgreset 3625msgctxt "lazarusidestrconsts.dlgreset" 3626msgid "Reset" 3627msgstr "" 3628 3629#: lazarusidestrconsts.dlgresetall 3630msgid "Reset all" 3631msgstr "" 3632 3633#: lazarusidestrconsts.dlgrightbottomclr 3634#, fuzzy 3635#| msgid "color for right, bottom" 3636msgid "Guide lines Right,Bottom" 3637msgstr "Kleur voor rechts, onder" 3638 3639#: lazarusidestrconsts.dlgrightclickselects 3640#, fuzzy 3641#| msgid "Right Click selects" 3642msgid "Right click selects" 3643msgstr "Rechts klikken selecteert" 3644 3645#: lazarusidestrconsts.dlgrightmargin 3646msgid "Right margin" 3647msgstr "Rechter marge" 3648 3649#: lazarusidestrconsts.dlgroworkingdirectory 3650msgid "Working directory" 3651msgstr "Werkdirectory" 3652 3653#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren 3654msgid "Select grandchildren" 3655msgstr "" 3656 3657#: lazarusidestrconsts.dlgruberbandcreationcolor 3658#, fuzzy 3659#| msgid "Creation" 3660msgid "Rubberband Creation" 3661msgstr "Creatie" 3662 3663#: lazarusidestrconsts.dlgruberbandselectioncolor 3664#, fuzzy 3665#| msgid "Selection" 3666msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor" 3667msgid "Rubberband Selection" 3668msgstr "Selectie" 3669 3670#: lazarusidestrconsts.dlgrunninginstancemodalerror 3671#, object-pascal-format 3672msgid "" 3673"The running Lazarus instance cannot accept any files.\n" 3674"Do you want to open them in a new IDE instance?\n" 3675"\n" 3676"%s" 3677msgstr "" 3678 3679#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror 3680msgid "Lazarus instance is running but not responding." 3681msgstr "" 3682 3683#: lazarusidestrconsts.dlgrunodisplay 3684msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" 3685msgstr "Display (niet voor win32, bv. 198.112.45.11:0, x.org:1, hydra:0.1)" 3686 3687#: lazarusidestrconsts.dlgrunoenvironment 3688msgctxt "lazarusidestrconsts.dlgrunoenvironment" 3689msgid "Environment" 3690msgstr "Omgeving" 3691 3692#: lazarusidestrconsts.dlgrunolocal 3693msgid "Local" 3694msgstr "Lokaal" 3695 3696#: lazarusidestrconsts.dlgrunosystemvariables 3697msgid "System variables" 3698msgstr "Systeem variabelen" 3699 3700#: lazarusidestrconsts.dlgrunousedisplay 3701msgid "Use display" 3702msgstr "Gebruik display" 3703 3704#: lazarusidestrconsts.dlgrunouseroverrides 3705msgid "User overrides" 3706msgstr "Gebruiker voorkeuren" 3707 3708#: lazarusidestrconsts.dlgrunparameters 3709#, fuzzy 3710#| msgid "Run parameters" 3711msgid "Run Parameters" 3712msgstr "Start parameters" 3713 3714#: lazarusidestrconsts.dlgsavecurrentdesktop 3715msgid "Save current desktop" 3716msgstr "" 3717 3718#: lazarusidestrconsts.dlgsavecurrentdesktopas 3719msgid "Save current desktop as" 3720msgstr "" 3721 3722#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption 3723msgid "Save active desktop as ..." 3724msgstr "" 3725 3726#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint 3727msgid "Save active desktop as" 3728msgstr "" 3729 3730#: lazarusidestrconsts.dlgsavedlinecolor 3731msgid "Saved line" 3732msgstr "" 3733 3734#: lazarusidestrconsts.dlgsaveeditorinfo 3735msgid "Save editor info for closed files" 3736msgstr "Bewaar bewerker informatie voor gesloten bestanden" 3737 3738#: lazarusidestrconsts.dlgsaveeditorinfohint 3739msgid "The files are available in the \"Open Recent\" history list." 3740msgstr "" 3741 3742#: lazarusidestrconsts.dlgsaveeditorinfoproject 3743msgid "Save editor info only for project files" 3744msgstr "Sla alleen bewerker informatie op voor project bestanden" 3745 3746#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint 3747msgid "Only files that belong to this project." 3748msgstr "" 3749 3750#: lazarusidestrconsts.dlgsavein 3751msgid "Save in" 3752msgstr "" 3753 3754#: lazarusidestrconsts.dlgscrollbyoneless 3755msgid "Scroll by one less" 3756msgstr "Scroll met een minder" 3757 3758#: lazarusidestrconsts.dlgscrollgroupoptions 3759msgid "Scrolling" 3760msgstr "" 3761 3762#: lazarusidestrconsts.dlgscrollhint 3763msgctxt "lazarusidestrconsts.dlgscrollhint" 3764msgid "Show scroll hint" 3765msgstr "Toon scroll hint" 3766 3767#: lazarusidestrconsts.dlgscrollpastendfile 3768msgid "Scroll past end of file" 3769msgstr "Scroll voorbij het einde van het bestand" 3770 3771#: lazarusidestrconsts.dlgscrollpastendline 3772#, fuzzy 3773#| msgid "Scroll past end of line" 3774msgid "Allow caret to move past end of line" 3775msgstr "Scroll voorbij het eind van de regel" 3776 3777#: lazarusidestrconsts.dlgseachdirectorynotfound 3778#, object-pascal-format 3779msgid "Search directory \"%s\" not found." 3780msgstr "" 3781 3782#: lazarusidestrconsts.dlgsearchabort 3783msgid "Search terminated by user." 3784msgstr "Zoekopdracht afgebroken door de gebruiker" 3785 3786#: lazarusidestrconsts.dlgsearchcaption 3787#, fuzzy 3788#| msgid "Searching..." 3789msgid "Searching ..." 3790msgstr "Bezig met zoeken ..." 3791 3792#: lazarusidestrconsts.dlgsearchpaths 3793msgid "Paths" 3794msgstr "Paden" 3795 3796#: lazarusidestrconsts.dlgsearchscope 3797msgid "Search scope" 3798msgstr "" 3799 3800#: lazarusidestrconsts.dlgselectallchildcontrols 3801msgid "Select all child controls together with their parent." 3802msgstr "" 3803 3804#: lazarusidestrconsts.dlgselectallnoscroll 3805msgid "Do not scroll on Select-All / Paragraph or To-Brace" 3806msgstr "" 3807 3808#: lazarusidestrconsts.dlgselectedtext 3809msgid "&Selected text" 3810msgstr "" 3811 3812#: lazarusidestrconsts.dlgsetactivedesktopbtncaption 3813msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption" 3814msgid "Set active" 3815msgstr "" 3816 3817#: lazarusidestrconsts.dlgsetactivedesktopbtnhint 3818msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint" 3819msgid "Set active" 3820msgstr "" 3821 3822#: lazarusidestrconsts.dlgsetallelementdefault 3823msgid "Set all elements to default" 3824msgstr "Geef alle element standaardwaarde" 3825 3826#: lazarusidestrconsts.dlgsetelementdefault 3827msgid "Set element to default" 3828msgstr "Geef element standaardwaarde" 3829 3830#: lazarusidestrconsts.dlgsetpropertyvariable 3831msgid "Set property Variable" 3832msgstr "Geef property variabele een waarde" 3833 3834#: lazarusidestrconsts.dlgsetpropertyvariablehint 3835msgid "The parameter name for the default setter procedure." 3836msgstr "" 3837 3838#: lazarusidestrconsts.dlgsetpropertyvariableisprefix 3839msgid "is prefix" 3840msgstr "" 3841 3842#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint 3843msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name." 3844msgstr "" 3845 3846#: lazarusidestrconsts.dlgsetpropertyvariableuseconst 3847msgid "use const" 3848msgstr "" 3849 3850#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint 3851msgid "If checked, the setter parameter is marked with \"const\"." 3852msgstr "" 3853 3854#: lazarusidestrconsts.dlgshowallunits 3855msgid "Show all units" 3856msgstr "" 3857 3858#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals 3859msgid "Show captions of nonvisual components" 3860msgstr "" 3861 3862#: lazarusidestrconsts.dlgshowcompiledprocedures 3863msgid "Show compiled procedures" 3864msgstr "Toon gecompileerde procedures" 3865 3866#: lazarusidestrconsts.dlgshowcompilinglinenumbers 3867#, fuzzy 3868msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers" 3869msgid "Show line numbers" 3870msgstr "Toon regelnummers" 3871 3872#: lazarusidestrconsts.dlgshowconditionals 3873msgid "Show conditionals" 3874msgstr "Toon voorwaarden" 3875 3876#: lazarusidestrconsts.dlgshowdebuginfo 3877msgid "Show debug info" 3878msgstr "Toon debug informatie" 3879 3880#: lazarusidestrconsts.dlgshowdesignerhints 3881msgid "Show designer hints" 3882msgstr "" 3883 3884#: lazarusidestrconsts.dlgshowdesignerhintshint 3885msgid "Hint shows control's position or size while moving or resizing it." 3886msgstr "" 3887 3888#: lazarusidestrconsts.dlgshoweverything 3889msgid "Show everything" 3890msgstr "Toon alles" 3891 3892#: lazarusidestrconsts.dlgshowexecutableinfo 3893msgid "Show executable info (Win32 only)" 3894msgstr "Toon info uitvoerbaar bestand (Win32)" 3895 3896#: lazarusidestrconsts.dlgshowfilenameincaption 3897msgid "Show file name in caption" 3898msgstr "" 3899 3900#: lazarusidestrconsts.dlgshowgeneralinfo 3901msgid "Show general info" 3902msgstr "Toon algemene info" 3903 3904#: lazarusidestrconsts.dlgshowgutterhints 3905msgid "Show gutter hints" 3906msgstr "Toon goot hints" 3907 3908#: lazarusidestrconsts.dlgshowhint 3909#, fuzzy 3910#| msgid "Show Hints" 3911msgctxt "lazarusidestrconsts.dlgshowhint" 3912msgid "Show hints" 3913msgstr "Toon Hints" 3914 3915#: lazarusidestrconsts.dlgshowingwindows 3916msgid "Showing Windows" 3917msgstr "" 3918 3919#: lazarusidestrconsts.dlgshowlinenumbers 3920msgctxt "lazarusidestrconsts.dlgshowlinenumbers" 3921msgid "Show line numbers" 3922msgstr "Toon regelnummers" 3923 3924#: lazarusidestrconsts.dlgshowmessagesicons 3925msgid "Show Messages Icons" 3926msgstr "" 3927 3928#: lazarusidestrconsts.dlgshownotes 3929#, fuzzy 3930#| msgid "Show Notes" 3931msgid "Show notes" 3932msgstr "Toon notities" 3933 3934#: lazarusidestrconsts.dlgshowsummary 3935msgid "Show summary" 3936msgstr "Toon samenvatting" 3937 3938#: lazarusidestrconsts.dlgshowtriedfiles 3939msgid "Show tried files" 3940msgstr "Toon geteste bestanden" 3941 3942#: lazarusidestrconsts.dlgshowusedfiles 3943msgid "Show used files" 3944msgstr "Toon gebruikte bestanden" 3945 3946#: lazarusidestrconsts.dlgshowwarnings 3947#, fuzzy 3948#| msgid "Show Warnings" 3949msgid "Show warnings" 3950msgstr "Toon waarschuwingen" 3951 3952#: lazarusidestrconsts.dlgsingletaskbarbutton 3953msgid "Show single button in TaskBar" 3954msgstr "" 3955 3956#: lazarusidestrconsts.dlgskipforwardclassdeclarations 3957msgid "Skip forward class declarations" 3958msgstr "" 3959 3960#: lazarusidestrconsts.dlgslashcommenttab 3961msgid "Slash //" 3962msgstr "" 3963 3964#: lazarusidestrconsts.dlgsmarttabs 3965msgid "Smart tabs" 3966msgstr "Slimme tabs" 3967 3968#: lazarusidestrconsts.dlgsmbbehind 3969msgid "Symbol behind (.pp~)" 3970msgstr "Symbool erachter (.pp~)" 3971 3972#: lazarusidestrconsts.dlgsmbcounter 3973msgid "Counter (.pp;1)" 3974msgstr "Teller (.pp;1)" 3975 3976#: lazarusidestrconsts.dlgsmbfront 3977msgid "Symbol in front (.~pp)" 3978msgstr "Symbool ervoor (.~pp)" 3979 3980#: lazarusidestrconsts.dlgsnapguidelines 3981msgid "Snap to Guide Lines" 3982msgstr "Aan steunlijnen plakken" 3983 3984#: lazarusidestrconsts.dlgsnapguidelineshint 3985msgid "When a control is close to being aligned with another control, it snaps to the aligned position." 3986msgstr "" 3987 3988#: lazarusidestrconsts.dlgsourceedittabmultiline 3989msgid "Multiline tabs" 3990msgstr "" 3991 3992#: lazarusidestrconsts.dlgspacenotcosmos 3993msgctxt "lazarusidestrconsts.dlgspacenotcosmos" 3994msgid "Space" 3995msgstr "Spatie" 3996 3997#: lazarusidestrconsts.dlgspbhints 3998msgid "Hints for main speed buttons (open, save, ...)" 3999msgstr "Hints voor snelknoppen in hoofdbalk (openen, opslaan, ...)" 4000 4001#: lazarusidestrconsts.dlgsrcedit 4002#, fuzzy 4003msgctxt "lazarusidestrconsts.dlgsrcedit" 4004msgid "Source Editor" 4005msgstr "Broncode Bewerker" 4006 4007#: lazarusidestrconsts.dlgsrorigin 4008msgid "Origin" 4009msgstr "Oorsprong" 4010 4011#: lazarusidestrconsts.dlgstacksize 4012msgid "Stack size" 4013msgstr "" 4014 4015#: lazarusidestrconsts.dlgstatickeyword 4016#, fuzzy 4017#| msgid "Static Keyword in Objects" 4018msgid "Static keyword in objects" 4019msgstr "\"Static\"-sleutelwoord in objecten" 4020 4021#: lazarusidestrconsts.dlgstopafternrerr 4022msgid "Stop after number of errors:" 4023msgstr "Stop na aantal fouten:" 4024 4025#: lazarusidestrconsts.dlgstringautoappend 4026msgid "Append text to close string" 4027msgstr "" 4028 4029#: lazarusidestrconsts.dlgstringautoprefix 4030msgid "Prefix string on new line" 4031msgstr "" 4032 4033#: lazarusidestrconsts.dlgstringbreakindenttab 4034msgid "String ''" 4035msgstr "" 4036 4037#: lazarusidestrconsts.dlgstringenableautocontinue 4038msgid "Extend strings on linebreak" 4039msgstr "" 4040 4041#: lazarusidestrconsts.dlgsubpropcolor 4042msgid "SubProperties" 4043msgstr "" 4044 4045#: lazarusidestrconsts.dlgsyntaxoptions 4046msgid "Syntax options" 4047msgstr "Syntax opties" 4048 4049#: lazarusidestrconsts.dlgtabindent 4050msgid "Tab indents blocks" 4051msgstr "Tab laat blokken inspringen" 4052 4053#: lazarusidestrconsts.dlgtabnumbersnotebook 4054msgid "Show tab numbers in notebook" 4055msgstr "" 4056 4057#: lazarusidestrconsts.dlgtabstospaces 4058msgid "Tabs to spaces" 4059msgstr "Tabs naar spaties" 4060 4061#: lazarusidestrconsts.dlgtabwidths 4062msgctxt "lazarusidestrconsts.dlgtabwidths" 4063msgid "Tab widths" 4064msgstr "" 4065 4066#: lazarusidestrconsts.dlgtargetcpufamily 4067msgid "Target CPU family" 4068msgstr "" 4069 4070#: lazarusidestrconsts.dlgtargetos 4071#, fuzzy 4072msgctxt "lazarusidestrconsts.dlgtargetos" 4073msgid "Target OS" 4074msgstr "Doel OS" 4075 4076#: lazarusidestrconsts.dlgtargetplatform 4077#, fuzzy 4078#| msgid "Target Platform" 4079msgid "Target platform" 4080msgstr "Doelplatform:" 4081 4082#: lazarusidestrconsts.dlgtargetproc 4083msgid "Target processor" 4084msgstr "" 4085 4086#: lazarusidestrconsts.dlgtargetspecificoptions 4087msgid "Target-specific options" 4088msgstr "" 4089 4090#: lazarusidestrconsts.dlgtestprjdir 4091msgid "Directory for building test projects" 4092msgstr "Folder voor bouwen van test projecten" 4093 4094#: lazarusidestrconsts.dlgtextstyle 4095msgid "Text-Style" 4096msgstr "" 4097 4098#: lazarusidestrconsts.dlgtexttofind 4099#, fuzzy 4100#| msgid "&Text to Find" 4101msgctxt "lazarusidestrconsts.dlgtexttofind" 4102msgid "&Text to find" 4103msgstr "&Zoek tekst" 4104 4105#: lazarusidestrconsts.dlgthiselementusescolor 4106msgid "The element uses (and edits) the schemes:" 4107msgstr "" 4108 4109#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption 4110msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption" 4111msgid "Toggle as debug desktop" 4112msgstr "" 4113 4114#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint 4115msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint" 4116msgid "Toggle as debug desktop" 4117msgstr "" 4118 4119#: lazarusidestrconsts.dlgtopinfohint 4120msgid "Current Class/Proc Hint" 4121msgstr "" 4122 4123#: lazarusidestrconsts.dlgtrimspacetypecaption 4124msgid "Trim spaces style" 4125msgstr "" 4126 4127#: lazarusidestrconsts.dlgtrimspacetypecaretmove 4128msgid "Caret or Edit" 4129msgstr "" 4130 4131#: lazarusidestrconsts.dlgtrimspacetypeeditline 4132msgid "Line Edited" 4133msgstr "" 4134 4135#: lazarusidestrconsts.dlgtrimspacetypeleaveline 4136msgid "Leave line" 4137msgstr "" 4138 4139#: lazarusidestrconsts.dlgtrimspacetypeposonly 4140msgid "Position Only" 4141msgstr "" 4142 4143#: lazarusidestrconsts.dlgtrimtrailingspaces 4144msgid "Trim trailing spaces" 4145msgstr "Spatie aan het eind verwijderen" 4146 4147#: lazarusidestrconsts.dlgundoaftersave 4148msgid "Undo after save" 4149msgstr "Ongedaan maken na Opslaan" 4150 4151#: lazarusidestrconsts.dlgundogroupoptions 4152msgid "Undo / Redo" 4153msgstr "" 4154 4155#: lazarusidestrconsts.dlgundolimit 4156msgid "Undo limit" 4157msgstr "Limiet ongedaan maken" 4158 4159#: lazarusidestrconsts.dlgunitdepcaption 4160#, fuzzy 4161#| msgid "Unit dependencies" 4162msgctxt "lazarusidestrconsts.dlgunitdepcaption" 4163msgid "Unit Dependencies" 4164msgstr "Unit afhankelijkheden" 4165 4166#: lazarusidestrconsts.dlgunitdeprefresh 4167msgctxt "lazarusidestrconsts.dlgunitdeprefresh" 4168msgid "Refresh" 4169msgstr "Verversen" 4170 4171#: lazarusidestrconsts.dlgunitoutp 4172msgid "Unit output directory (-FU):" 4173msgstr "" 4174 4175#: lazarusidestrconsts.dlgunsavedlinecolor 4176msgid "Unsaved line" 4177msgstr "" 4178 4179#: lazarusidestrconsts.dlgusecodefolding 4180#, fuzzy 4181#| msgid "Code folding" 4182msgid "Code Folding" 4183msgstr "Code inschuiven" 4184 4185#: lazarusidestrconsts.dlgusecustomconfig 4186msgid "Use additional compiler config file" 4187msgstr "" 4188 4189#: lazarusidestrconsts.dlgusedividerdraw 4190msgid "Divider Drawing" 4191msgstr "" 4192 4193#: lazarusidestrconsts.dlgusefpccfg 4194#, fuzzy 4195#| msgid "Use standard Compiler Config File (fpc.cfg)" 4196msgid "Use standard compiler config file (fpc.cfg)" 4197msgstr "Gebruik standaard compiler configuratie bestand (fpc.cfg)" 4198 4199#: lazarusidestrconsts.dlgusehighlight 4200msgid "Use Highlight" 4201msgstr "" 4202 4203#: lazarusidestrconsts.dlguseiconsincompletionbox 4204msgid "Icons in code completion box" 4205msgstr "" 4206 4207#: lazarusidestrconsts.dlguselaunchingapp 4208msgid "Use launching application" 4209msgstr "Gebruik start programma" 4210 4211#: lazarusidestrconsts.dlguseminimumime 4212msgid "IME handled by System" 4213msgstr "" 4214 4215#: lazarusidestrconsts.dlguserschemeerror 4216#, object-pascal-format 4217msgid "Failed to load user-scheme file %s" 4218msgstr "" 4219 4220#: lazarusidestrconsts.dlguseschemedefaults 4221msgid "- Scheme globals -" 4222msgstr "" 4223 4224#: lazarusidestrconsts.dlguseschemelocal 4225msgid "selected language" 4226msgstr "" 4227 4228#: lazarusidestrconsts.dlgusesyntaxhighlight 4229msgid "Use syntax highlight" 4230msgstr "Gebruik syntax highlighting" 4231 4232#: lazarusidestrconsts.dlgusetabshistory 4233msgid "Use tab history when closing tabs" 4234msgstr "" 4235 4236#: lazarusidestrconsts.dlguseunitcaption 4237msgid "Add unit to Uses section" 4238msgstr "" 4239 4240#: lazarusidestrconsts.dlgvaluecolor 4241msgctxt "lazarusidestrconsts.dlgvaluecolor" 4242msgid "Value" 4243msgstr "Waarde" 4244 4245#: lazarusidestrconsts.dlgverbosity 4246msgid "Verbosity during compilation:" 4247msgstr "Aantal melding tijdens compilatie:" 4248 4249#: lazarusidestrconsts.dlgvisiblegutter 4250msgid "Visible gutter" 4251msgstr "Zichtbare goot" 4252 4253#: lazarusidestrconsts.dlgvisiblerightmargin 4254msgid "Visible right margin" 4255msgstr "Zichtbare rechter marge" 4256 4257#: lazarusidestrconsts.dlgwholewordsonly 4258msgid "&Whole words only" 4259msgstr "" 4260 4261#: lazarusidestrconsts.dlgwidthpos 4262msgid "Width:" 4263msgstr "Breedte:" 4264 4265#: lazarusidestrconsts.dlgwin32guiapp 4266msgid "Win32 gui application" 4267msgstr "" 4268 4269#: lazarusidestrconsts.dlgwindow 4270msgctxt "lazarusidestrconsts.dlgwindow" 4271msgid "Window" 4272msgstr "Venster" 4273 4274#: lazarusidestrconsts.dlgwordexceptions 4275msgid "Exceptions" 4276msgstr "" 4277 4278#: lazarusidestrconsts.dlgwordspolicies 4279msgctxt "lazarusidestrconsts.dlgwordspolicies" 4280msgid "Words" 4281msgstr "Woorden" 4282 4283#: lazarusidestrconsts.dlgwrdpreview 4284msgctxt "lazarusidestrconsts.dlgwrdpreview" 4285msgid "Preview" 4286msgstr "Voorbeeld" 4287 4288#: lazarusidestrconsts.dlgwritefpclogo 4289#, fuzzy 4290#| msgid "Write an FPC logo" 4291msgid "Write FPC logo" 4292msgstr "Maak een FPC logo" 4293 4294#: lazarusidestrconsts.fdinvalidmultiselectiontext 4295msgid "Multiselected components must be of a single form." 4296msgstr "Meervoudig geselecteerd componenten moeten van een enkel form zijn" 4297 4298#: lazarusidestrconsts.fdmalignmenu 4299msgid "Align ..." 4300msgstr "" 4301 4302#: lazarusidestrconsts.fdmdeleteselection 4303#, fuzzy 4304#| msgid "Delete selection" 4305msgid "Delete Selection" 4306msgstr "Verwijder selectie" 4307 4308#: lazarusidestrconsts.fdmmirrorhorizontal 4309#, fuzzy 4310#| msgid "Mirror horizontal" 4311msgid "Mirror Horizontal" 4312msgstr "Spiegel horizontaal" 4313 4314#: lazarusidestrconsts.fdmmirrorvertical 4315#, fuzzy 4316#| msgid "Mirror vertical" 4317msgid "Mirror Vertical" 4318msgstr "Spiegel vertikaal" 4319 4320#: lazarusidestrconsts.fdmorderbackone 4321#, fuzzy 4322#| msgid "Back one" 4323msgid "Back One" 4324msgstr "Een terug" 4325 4326#: lazarusidestrconsts.fdmorderforwardone 4327#, fuzzy 4328#| msgid "Forward one" 4329msgid "Forward One" 4330msgstr "Een vooruit" 4331 4332#: lazarusidestrconsts.fdmordermovetoback 4333#, fuzzy 4334#| msgid "Move to back" 4335msgid "Move to Back" 4336msgstr "Breng naar achter" 4337 4338#: lazarusidestrconsts.fdmordermovetofront 4339#, fuzzy 4340#| msgid "Move to front" 4341msgid "Move to Front" 4342msgstr "Breng naar voren" 4343 4344#: lazarusidestrconsts.fdmresetmenu 4345msgid "Reset ..." 4346msgstr "" 4347 4348#: lazarusidestrconsts.fdmsaveformasxml 4349#, fuzzy 4350#| msgid "Save form as XML" 4351msgid "Save Form as XML" 4352msgstr "Sla formulier als xml op" 4353 4354#: lazarusidestrconsts.fdmscalemenu 4355msgid "Scale ..." 4356msgstr "" 4357 4358#: lazarusidestrconsts.fdmscaleword 4359msgid "Scale" 4360msgstr "Schaal" 4361 4362#: lazarusidestrconsts.fdmselectall 4363msgctxt "lazarusidestrconsts.fdmselectall" 4364msgid "Select All" 4365msgstr "Selecteer Alles" 4366 4367#: lazarusidestrconsts.fdmsizemenu 4368msgid "Size ..." 4369msgstr "" 4370 4371#: lazarusidestrconsts.fdmsizeword 4372msgid "Size" 4373msgstr "Grootte" 4374 4375#: lazarusidestrconsts.fdmsnaptogridoption 4376msgid "Option: Snap to grid" 4377msgstr "Optie: Snap to grid" 4378 4379#: lazarusidestrconsts.fdmsnaptoguidelinesoption 4380msgid "Option: Snap to guide lines" 4381msgstr "Optie: snap naar guide lijnen" 4382 4383#: lazarusidestrconsts.fdmzorder 4384msgid "Z-order" 4385msgstr "" 4386 4387#: lazarusidestrconsts.gldhighlightbothsidesofcursor 4388msgid "On Both Sides" 4389msgstr "" 4390 4391#: lazarusidestrconsts.histdlgbtnclearhint 4392msgid "Clear all snapshots" 4393msgstr "" 4394 4395#: lazarusidestrconsts.histdlgbtnenablehint 4396msgid "Toggle view snapshot or current" 4397msgstr "" 4398 4399#: lazarusidestrconsts.histdlgbtnmakesnaphint 4400msgid "Take Snapshot" 4401msgstr "" 4402 4403#: lazarusidestrconsts.histdlgbtnpowerhint 4404msgid "Switch on/off automatic snapshots" 4405msgstr "" 4406 4407#: lazarusidestrconsts.histdlgbtnremovehint 4408msgid "Remove selected entry" 4409msgstr "" 4410 4411#: lazarusidestrconsts.histdlgbtnshowhisthint 4412msgid "View history" 4413msgstr "" 4414 4415#: lazarusidestrconsts.histdlgbtnshowsnaphint 4416msgid "View Snapshots" 4417msgstr "" 4418 4419#: lazarusidestrconsts.histdlgcolumnloc 4420msgctxt "lazarusidestrconsts.histdlgcolumnloc" 4421msgid "Location" 4422msgstr "" 4423 4424#: lazarusidestrconsts.histdlgcolumntime 4425msgid "Time" 4426msgstr "" 4427 4428#: lazarusidestrconsts.histdlgformname 4429msgctxt "lazarusidestrconsts.histdlgformname" 4430msgid "History" 4431msgstr "" 4432 4433#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi 4434msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..." 4435msgstr "" 4436 4437#: lazarusidestrconsts.lisa2paddfiles 4438msgid "Add Files" 4439msgstr "Bestanden toevoegen" 4440 4441#: lazarusidestrconsts.lisa2pambiguousancestortype 4442msgid "Ambiguous Ancestor Type" 4443msgstr "Dubbelzinnig ancestor type" 4444 4445#: lazarusidestrconsts.lisa2pambiguousclassname 4446msgid "Ambiguous Class Name" 4447msgstr "Dubbelzinnige klasse naam" 4448 4449#: lazarusidestrconsts.lisa2pambiguousunitname 4450msgid "Ambiguous Unit Name" 4451msgstr "Dubbelzinnige unit naam" 4452 4453#: lazarusidestrconsts.lisa2pancestortype 4454#, fuzzy 4455#| msgid "Ancestor Type" 4456msgid "Ancestor type" 4457msgstr "Ancestor Type" 4458 4459#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas 4460#, fuzzy 4461#| msgid "A pascal unit must have the extension .pp or .pas" 4462msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas" 4463msgid "A Pascal unit must have the extension .pp or .pas" 4464msgstr "Een Pascal-unit dient op .pp of .pas te eindigen." 4465 4466#: lazarusidestrconsts.lisa2pbrokendependencies 4467msgid "Broken Dependencies" 4468msgstr "Gebroken Afhankelijkheden" 4469 4470#: lazarusidestrconsts.lisa2pclassnamealreadyexists 4471msgid "Class Name already exists" 4472msgstr "Klassenaam bestaat reeds" 4473 4474#: lazarusidestrconsts.lisa2pcreatenewcomp 4475msgid "Create New Component" 4476msgstr "" 4477 4478#: lazarusidestrconsts.lisa2pcreatenewfile 4479#, fuzzy 4480#| msgid "Create new file" 4481msgid "Create New File" 4482msgstr "Maak een nieuw bestand" 4483 4484#: lazarusidestrconsts.lisa2pcreatenewreq 4485msgid "Create New Requirement" 4486msgstr "" 4487 4488#: lazarusidestrconsts.lisa2pdependency 4489msgid "Dependency" 4490msgstr "Afhankelijkheid" 4491 4492#: lazarusidestrconsts.lisa2pdirectoryforunitfile 4493msgid "Directory for unit file:" 4494msgstr "" 4495 4496#: lazarusidestrconsts.lisa2pexistingfile2 4497#, object-pascal-format 4498msgid "Existing file: \"%s\"" 4499msgstr "" 4500 4501#: lazarusidestrconsts.lisa2pfilealreadyexists 4502msgid "File already exists" 4503msgstr "Bestand bestaat reeds" 4504 4505#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage 4506#, object-pascal-format 4507msgid "File \"%s\" already exists in the package." 4508msgstr "" 4509 4510#: lazarusidestrconsts.lisa2pfileisused 4511msgid "File is used" 4512msgstr "Bestand wordt gebruikt" 4513 4514#: lazarusidestrconsts.lisa2pfilename2 4515#, fuzzy 4516#| msgid "Filename" 4517msgid "Filename/URL" 4518msgstr "Bestandsnaam" 4519 4520#: lazarusidestrconsts.lisa2pfilenotunit 4521msgid "File not unit" 4522msgstr "Bestand is geen unit" 4523 4524#: lazarusidestrconsts.lisa2picon24x24 4525msgid "Icon 24x24:" 4526msgstr "" 4527 4528#: lazarusidestrconsts.lisa2picon36x36 4529msgid "Icon 36x36:" 4530msgstr "" 4531 4532#: lazarusidestrconsts.lisa2picon48x48 4533msgid "Icon 48x48:" 4534msgstr "" 4535 4536#: lazarusidestrconsts.lisa2pinvalidancestortype 4537msgid "Invalid Ancestor Type" 4538msgstr "Ongeldige Ancestor Type" 4539 4540#: lazarusidestrconsts.lisa2pinvalidcirculardependency 4541msgid "Invalid Circular Dependency" 4542msgstr "" 4543 4544#: lazarusidestrconsts.lisa2pinvalidclassname 4545msgid "Invalid Class Name" 4546msgstr "Ongeldige Class naam" 4547 4548#: lazarusidestrconsts.lisa2pinvalidfile 4549msgid "Invalid file" 4550msgstr "Ongeldig bestand" 4551 4552#: lazarusidestrconsts.lisa2pinvalidfilename 4553msgid "Invalid filename" 4554msgstr "Ongeldige bestandsnaam" 4555 4556#: lazarusidestrconsts.lisa2pinvalidunitname 4557msgid "Invalid Unit Name" 4558msgstr "Ongeldige unit naam" 4559 4560#: lazarusidestrconsts.lisa2pisnotavalidunitname 4561#, object-pascal-format, fuzzy 4562#| msgid "%s%s%s is not a valid unit name." 4563msgid "\"%s\" is not a valid unit name." 4564msgstr "\"%s\" is geen geldige unit naam." 4565 4566#: lazarusidestrconsts.lisa2pnewclassname 4567msgid "New class name:" 4568msgstr "Nieuwe Class naam:" 4569 4570#: lazarusidestrconsts.lisa2pnewfile 4571msgid "New File" 4572msgstr "Nieuw bestand" 4573 4574#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting 4575#, object-pascal-format, fuzzy 4576#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." 4577msgid "No package found for dependency \"%s\".%sPlease choose an existing package." 4578msgstr "Geen pakket gevonden voor afhankelijkheid \"%s\".%sKies een bestaand pakket." 4579 4580#: lazarusidestrconsts.lisa2ppackageorproject 4581msgid "Package/Project" 4582msgstr "" 4583 4584#: lazarusidestrconsts.lisa2ppagenametoolong 4585msgid "Page Name too long" 4586msgstr "Naam van pagina te lang" 4587 4588#: lazarusidestrconsts.lisa2ppalettepage 4589#, fuzzy 4590#| msgid "Palette Page:" 4591msgid "Palette page:" 4592msgstr "Palette pagina:" 4593 4594#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas 4595msgid "Pascal units must have the extension .pp or .pas" 4596msgstr "Pascal units moeten de .pp of .pas extensie hebben" 4597 4598#: lazarusidestrconsts.lisa2pshortenorexpandfilename 4599msgid "Shorten or expand filename" 4600msgstr "Verkort of verleng bestandsnaam" 4601 4602#: lazarusidestrconsts.lisa2pshowall 4603msgctxt "lazarusidestrconsts.lisa2pshowall" 4604msgid "Show all" 4605msgstr "Toon alles" 4606 4607#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit 4608#, object-pascal-format, fuzzy 4609#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." 4610msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"." 4611msgstr "Het type van de ancestor \"%s\" heeft dezelfde naam als%sde unit \"%s\"." 4612 4613#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier 4614#, object-pascal-format, fuzzy 4615#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier." 4616msgid "The ancestor type \"%s\" is not a valid Pascal identifier." 4617msgstr "Het type van de ancestor \"%s\" is geen geldige pascal identifier." 4618 4619#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame 4620#, object-pascal-format, fuzzy 4621#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same." 4622msgid "The class name \"%s\" and ancestor type \"%s\" are the same." 4623msgstr "De naam van de klasse \"%s\" en het type van de ancestor \"%s\" zijn gelijk." 4624 4625#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile 4626#, object-pascal-format, fuzzy 4627#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" 4628msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\"" 4629msgstr "De naam van de klasse \"%s\" bestaat al in%sPackage %s%sBestand: \"%s\"" 4630 4631#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit 4632#, object-pascal-format, fuzzy 4633#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." 4634msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"." 4635msgstr "De naam van de klasse \"%s\" is dezelfde als%sde unit \"%s\"." 4636 4637#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier 4638#, object-pascal-format, fuzzy 4639#| msgid "The class name %s%s%s is not a valid Pascal identifier." 4640msgid "The class name \"%s\" is not a valid Pascal identifier." 4641msgstr "De naam van de klasse \"%s\" is geen geldige pascal identifier." 4642 4643#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea 4644#, object-pascal-format, fuzzy 4645#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." 4646msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages." 4647msgstr "Het bestand \"%s\" is onderdeel van het huidige project.%sHet is niet aan te raden bestanden te delen tussen project en packages." 4648 4649#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename 4650#, object-pascal-format, fuzzy 4651#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." 4652msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path." 4653msgstr "De bestandsnaam \"%s\" is onduidelijk, omdat het package geen standaard directorie heeft.%sGeef een bestandsnaam inclusief het pad." 4654 4655#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor 4656#, object-pascal-format, fuzzy 4657msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor" 4658msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4659msgstr "De Maximum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10" 4660 4661#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion 4662#, fuzzy 4663msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion" 4664msgid "The Maximum Version is lower than the Minimim Version." 4665msgstr "De maximum versie is lager dan de minimum versie" 4666 4667#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor 4668#, object-pascal-format, fuzzy 4669msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor" 4670msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 4671msgstr "De Minimum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10" 4672 4673#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe 4674#, object-pascal-format, fuzzy 4675#| msgid "The package already has a dependency on the package %s%s%s." 4676msgid "The package already has a dependency on the package \"%s\"." 4677msgstr "Het package heeft al een afhankelijkheid van package \"%s\"." 4678 4679#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars 4680#, object-pascal-format, fuzzy 4681#| msgid "The page name %s%s%s is too long (max 100 chars)." 4682msgid "The page name \"%s\" is too long (max 100 chars)." 4683msgstr "De naam van de pagina \"%s\" is te lang (max. 100 letters)." 4684 4685#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage 4686#, object-pascal-format, fuzzy 4687#| msgid "The unitname %s%s%s already exists in the package:%s%s" 4688msgid "The unitname \"%s\" already exists in the package:%s%s" 4689msgstr "De unitnaam \"%s\" bestaat al in het package:%s%s" 4690 4691#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage 4692#, object-pascal-format, fuzzy 4693#| msgid "The unitname %s%s%s already exists in this package." 4694msgid "The unitname \"%s\" already exists in this package." 4695msgstr "De unitnaam \"%s\" bestaat al in dit package." 4696 4697#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer 4698#, object-pascal-format, fuzzy 4699#| msgid "The unit name %s%s%s%sand filename %s%s%s differ." 4700msgid "The unit name \"%s\"%sand filename \"%s\" differ." 4701msgstr "De naam van de unit \"%s\"%sen de bestandsnaam \"%s\" verschillen" 4702 4703#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent 4704#, object-pascal-format, fuzzy 4705#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages." 4706msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages." 4707msgstr "De unitnaam \"%s\" is gelijk aan die van een geregistreerd component.%sDit kan tot vreemde foutmeldingen leiden." 4708 4709#: lazarusidestrconsts.lisa2punitname 4710#, fuzzy 4711#| msgid "Unit Name:" 4712msgid "Unit name:" 4713msgstr "Unitnaam:" 4714 4715#: lazarusidestrconsts.lisa2punitnamealreadyexists 4716msgid "Unitname already exists" 4717msgstr "Unitnaam bestaat al" 4718 4719#: lazarusidestrconsts.lisabandonchanges 4720msgid "Abandon changes?" 4721msgstr "" 4722 4723#: lazarusidestrconsts.lisabort 4724#, fuzzy 4725msgctxt "lazarusidestrconsts.lisabort" 4726msgid "Abort" 4727msgstr "Afbreken" 4728 4729#: lazarusidestrconsts.lisabortall 4730msgid "Abort all" 4731msgstr "Alles afbreken" 4732 4733#: lazarusidestrconsts.lisabortallloading 4734msgid "Abort all loading" 4735msgstr "Het laden afbreken" 4736 4737#: lazarusidestrconsts.lisaborted 4738msgid "Aborted" 4739msgstr "" 4740 4741#: lazarusidestrconsts.lisabortloadingproject 4742msgid "Abort loading project" 4743msgstr "Het laden van het project afbreken" 4744 4745#: lazarusidestrconsts.lisabortwholeloading 4746msgid "Abort whole loading" 4747msgstr "" 4748 4749#: lazarusidestrconsts.lisabout 4750#, fuzzy 4751msgctxt "lazarusidestrconsts.lisabout" 4752msgid "About" 4753msgstr "Informatie" 4754 4755#: lazarusidestrconsts.lisabout2 4756#, object-pascal-format 4757msgid "About %s" 4758msgstr "" 4759 4760#: lazarusidestrconsts.lisaboutdocumentation 4761msgid "Documentation:" 4762msgstr "" 4763 4764#: lazarusidestrconsts.lisaboutide 4765msgid "About IDE" 4766msgstr "" 4767 4768#: lazarusidestrconsts.lisaboutlazarus 4769msgid "About Lazarus" 4770msgstr "Informatie over Lazarus" 4771 4772#: lazarusidestrconsts.lisaboutlazarusmsg 4773#, object-pascal-format 4774msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers." 4775msgstr "" 4776 4777#: lazarusidestrconsts.lisaboutnocontributors 4778msgid "Cannot find contributors list." 4779msgstr "Kan de lijst van medewerkers niet vinden." 4780 4781#: lazarusidestrconsts.lisaboutofficial 4782msgid "Official:" 4783msgstr "" 4784 4785#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen 4786#, object-pascal-format, fuzzy 4787#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it." 4788msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it." 4789msgstr "A %s kan geen TControls bevatten.%sU kunt er alleen niet-visuele componenten op plaatsen." 4790 4791#: lazarusidestrconsts.lisacknowledgements 4792msgid "Acknowledgements" 4793msgstr "" 4794 4795#: lazarusidestrconsts.lisaction 4796msgid "Action:" 4797msgstr "" 4798 4799#: lazarusidestrconsts.lisactions 4800msgid "Actions:" 4801msgstr "" 4802 4803#: lazarusidestrconsts.lisactivate 4804msgid "Activate" 4805msgstr "" 4806 4807#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme 4808msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" 4809msgstr "Activeer reguliere-expressiesyntax voor tekst en vervanging" 4810 4811#: lazarusidestrconsts.lisactivateselected 4812msgid "Activate Selected" 4813msgstr "" 4814 4815#: lazarusidestrconsts.lisactive 4816msgid "Active" 4817msgstr "" 4818 4819#: lazarusidestrconsts.lisactivefilter 4820msgid "Active Filter" 4821msgstr "" 4822 4823#: lazarusidestrconsts.lisadd 4824msgctxt "lazarusidestrconsts.lisadd" 4825msgid "Add" 4826msgstr "Toevoegen" 4827 4828#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem 4829msgid "Add a new separator above selected item" 4830msgstr "" 4831 4832#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem 4833msgid "Add a new separator below selected item" 4834msgstr "" 4835 4836#: lazarusidestrconsts.lisadddelphidefine 4837msgid "Add defines simulating Delphi7" 4838msgstr "" 4839 4840#: lazarusidestrconsts.lisadddelphidefinehint 4841msgid "Useful when the code has checks for supported compiler versions" 4842msgstr "" 4843 4844#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource 4845#, object-pascal-format 4846msgid "Added missing object \"%s\" to pascal source." 4847msgstr "" 4848 4849#: lazarusidestrconsts.lisaddedpropertysfors 4850#, object-pascal-format 4851msgid "Added property \"%s\" for %s." 4852msgstr "" 4853 4854#: lazarusidestrconsts.lisaddfcutf8 4855msgid "Add -FcUTF8" 4856msgstr "" 4857 4858#: lazarusidestrconsts.lisaddfcutf8hint 4859msgid "May be needed if source files have non-ansistring literals." 4860msgstr "" 4861 4862#: lazarusidestrconsts.lisaddfilter 4863msgid "Add Filter ..." 4864msgstr "" 4865 4866#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage 4867msgid "Addition does not fit the current message" 4868msgstr "" 4869 4870#: lazarusidestrconsts.lisadditionfitsthecurrentmessage 4871msgid "Addition fits the current message" 4872msgstr "" 4873 4874#: lazarusidestrconsts.lisadditions 4875msgid "Additions" 4876msgstr "" 4877 4878#: lazarusidestrconsts.lisaddkeyworddo 4879msgid "Add keyword \"do\"" 4880msgstr "" 4881 4882#: lazarusidestrconsts.lisaddmodifieroverload 4883msgid "Add modifier \"overload\"" 4884msgstr "" 4885 4886#: lazarusidestrconsts.lisaddmodifieroverride 4887msgid "Add modifier \"override\"" 4888msgstr "" 4889 4890#: lazarusidestrconsts.lisaddmodifierreintroduce 4891msgid "Add modifier \"reintroduce\"" 4892msgstr "" 4893 4894#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom 4895#, object-pascal-format 4896msgid "Add new build mode, copying settings from \"%s\"" 4897msgstr "" 4898 4899#: lazarusidestrconsts.lisaddnewmacro 4900msgid "Add new macro" 4901msgstr "" 4902 4903#: lazarusidestrconsts.lisaddnewset 4904msgid "Add new set" 4905msgstr "" 4906 4907#: lazarusidestrconsts.lisaddpackagerequirement 4908msgid "Add package requirement?" 4909msgstr "" 4910 4911#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui 4912msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)." 4913msgstr "" 4914 4915#: lazarusidestrconsts.lisaddpackagetoproject2 4916msgid "Add package to project" 4917msgstr "" 4918 4919#: lazarusidestrconsts.lisaddparameterbrackets 4920msgid "Add parameter brackets" 4921msgstr "" 4922 4923#: lazarusidestrconsts.lisaddress 4924msgid "Address:" 4925msgstr "" 4926 4927#: lazarusidestrconsts.lisaddressbreakpoint 4928msgctxt "lazarusidestrconsts.lisaddressbreakpoint" 4929msgid "&Address Breakpoint ..." 4930msgstr "" 4931 4932#: lazarusidestrconsts.lisaddtoincludesearchpath 4933msgid "Add to include search path?" 4934msgstr "" 4935 4936#: lazarusidestrconsts.lisaddtoproject 4937#, object-pascal-format 4938msgid "Add %s to project?" 4939msgstr "%s aan het project toevoegen?" 4940 4941#: lazarusidestrconsts.lisaddtostartupcomponents 4942msgid "Add to startup components?" 4943msgstr "" 4944 4945#: lazarusidestrconsts.lisaddtounitsearchpath 4946msgid "Add to unit search path?" 4947msgstr "" 4948 4949#: lazarusidestrconsts.lisaddunitinterfaces 4950msgid "Add unit interfaces" 4951msgstr "" 4952 4953#: lazarusidestrconsts.lisaddunitnotrecommended 4954msgid "Add unit (not recommended)" 4955msgstr "" 4956 4957#: lazarusidestrconsts.lisaddvaluetomacro 4958#, object-pascal-format 4959msgid "Add value to macro %s" 4960msgstr "" 4961 4962#: lazarusidestrconsts.lisaf2paddfiletoapackage 4963#, fuzzy 4964#| msgid "Add file to a package" 4965msgid "Add File to Package" 4966msgstr "Voeg bestand aan pakket toe" 4967 4968#: lazarusidestrconsts.lisaf2pdestinationpackage 4969#, fuzzy 4970#| msgid "Destination Package" 4971msgid "Destination package" 4972msgstr "Doelpakket" 4973 4974#: lazarusidestrconsts.lisaf2pfiletype 4975#, fuzzy 4976#| msgid "File Type" 4977msgid "File type" 4978msgstr "Bestandstype" 4979 4980#: lazarusidestrconsts.lisaf2pinvalidpackage 4981msgid "Invalid Package" 4982msgstr "Ongeldig Package" 4983 4984#: lazarusidestrconsts.lisaf2pinvalidpackageid 4985#, object-pascal-format, fuzzy 4986#| msgid "Invalid package ID: %s%s%s" 4987msgid "Invalid package ID: \"%s\"" 4988msgstr "Ongeldige package ID: \"%s\"" 4989 4990#: lazarusidestrconsts.lisaf2ppackageisreadonly 4991msgid "Package is read only" 4992msgstr "Pakket niet wijzigbaar" 4993 4994#: lazarusidestrconsts.lisaf2ppackagenotfound 4995#, object-pascal-format, fuzzy 4996#| msgid "Package %s%s%s not found." 4997msgid "Package \"%s\" not found." 4998msgstr "Pakket \"%s\" niet gevonden." 4999 5000#: lazarusidestrconsts.lisaf2pshowall 5001#, fuzzy 5002#| msgid "Show All" 5003msgctxt "lazarusidestrconsts.lisaf2pshowall" 5004msgid "Show all" 5005msgstr "Toon alles" 5006 5007#: lazarusidestrconsts.lisaf2pthepackageisreadonly 5008#, object-pascal-format 5009msgid "The package %s is read only." 5010msgstr "Het package %s is niet wijzigbaar" 5011 5012#: lazarusidestrconsts.lisafilealreadyexistsreplaceit 5013#, object-pascal-format, fuzzy 5014#| msgid "A file %s%s%s already exists.%sReplace it?" 5015msgid "A file \"%s\" already exists.%sReplace it?" 5016msgstr "Een bestand \"%s\" bestaat al.%sOverschrijven?" 5017 5018#: lazarusidestrconsts.lisafilterwiththenamealreadyexists 5019#, object-pascal-format 5020msgid "A filter with the name \"%s\" already exists." 5021msgstr "" 5022 5023#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean 5024msgid "After cleaning up (clean all or clean common files), switch to clean automatically" 5025msgstr "" 5026 5027#: lazarusidestrconsts.lisalignment 5028msgid "Alignment" 5029msgstr "Uitlijning" 5030 5031#: lazarusidestrconsts.lisallblockslooksok 5032#, fuzzy 5033#| msgid "All blocks looks ok." 5034msgid "All blocks look ok." 5035msgstr "Alle blokken zien er goed uit" 5036 5037#: lazarusidestrconsts.lisallbuildmodes 5038msgid "<All build modes>" 5039msgstr "" 5040 5041#: lazarusidestrconsts.lisallinheritedoptions 5042msgid "All inherited options" 5043msgstr "" 5044 5045#: lazarusidestrconsts.lisalloptions 5046msgid "All Options" 5047msgstr "" 5048 5049#: lazarusidestrconsts.lisallowfunctio 5050msgid "Allow Function Calls" 5051msgstr "" 5052 5053#: lazarusidestrconsts.lisallowsearchingformultiplelines 5054msgid "Allow searching for multiple lines" 5055msgstr "Sta het zoeken naar meerdere lijnen toe" 5056 5057#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall 5058msgid "All parameters of this function are already set at this call. Nothing to add." 5059msgstr "" 5060 5061#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened 5062#, object-pascal-format 5063msgid "All your modifications to \"%s\"%swill be lost and the file reopened." 5064msgstr "" 5065 5066#: lazarusidestrconsts.lisalpha 5067msgid "Alpha" 5068msgstr "" 5069 5070#: lazarusidestrconsts.lisalternativekey 5071msgid "Alternative key" 5072msgstr "" 5073 5074#: lazarusidestrconsts.lisalternativekeyor2keysequence 5075msgid "Alternative key (or 2 key sequence)" 5076msgstr "" 5077 5078#: lazarusidestrconsts.lisalways 5079msgid "Always" 5080msgstr "" 5081 5082#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase 5083msgid "Always convert suggested default file name to lowercase" 5084msgstr "" 5085 5086#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused 5087msgid "Always draw selected items focused" 5088msgstr "" 5089 5090#: lazarusidestrconsts.lisalwaysignore 5091msgid "Always ignore" 5092msgstr "" 5093 5094#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists 5095msgid "A macro with this name already exists." 5096msgstr "" 5097 5098#: lazarusidestrconsts.lisambiguousfilefound 5099msgid "Ambiguous file found" 5100msgstr "Dubbelzinnig bestand gevonden" 5101 5102#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete 5103#, object-pascal-format, fuzzy 5104#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" 5105msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?" 5106msgstr "Dubbelzinnig bestand gevonden: \"%s\"%sDit bestand kan worden verward met \"%s\"%sHet dubbelzinnige bestand verwijderen?" 5107 5108#: lazarusidestrconsts.lisambiguousfilesfound 5109msgid "Ambiguous files found" 5110msgstr "Dubbelzinnige bestanden gevonden" 5111 5112#: lazarusidestrconsts.lisambiguousunitfound 5113#, fuzzy 5114#| msgid "Ambiguous Unit found" 5115msgid "Ambiguous unit found" 5116msgstr "Dubbelzinnige unit gevonden" 5117 5118#: lazarusidestrconsts.lisanchorbottomtobottomside 5119msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5120msgstr "" 5121 5122#: lazarusidestrconsts.lisanchorbottomtotopside 5123msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5124msgstr "" 5125 5126#: lazarusidestrconsts.lisanchoreditornocontrolselected 5127msgid "Anchor Editor - no control selected" 5128msgstr "Anker bewerker - geen control geselecteerd" 5129 5130#: lazarusidestrconsts.lisanchorenabledhint 5131#, object-pascal-format 5132msgid "Enabled = Include %s in Anchors" 5133msgstr "" 5134 5135#: lazarusidestrconsts.lisanchorlefttoleftside 5136msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5137msgstr "" 5138 5139#: lazarusidestrconsts.lisanchorlefttorightside 5140msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5141msgstr "" 5142 5143#: lazarusidestrconsts.lisanchorrighttoleftside 5144msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5145msgstr "" 5146 5147#: lazarusidestrconsts.lisanchorrighttorightside 5148msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5149msgstr "" 5150 5151#: lazarusidestrconsts.lisanchorsof 5152#, object-pascal-format 5153msgid "Anchors of %s" 5154msgstr "" 5155 5156#: lazarusidestrconsts.lisanchorsofselectedcontrols 5157msgid "Anchors of selected controls" 5158msgstr "Ankers van geselecteerde controls" 5159 5160#: lazarusidestrconsts.lisanchortoptobottomside 5161msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling." 5162msgstr "" 5163 5164#: lazarusidestrconsts.lisanchortoptotopside 5165msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored." 5166msgstr "" 5167 5168#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro 5169#, object-pascal-format, fuzzy 5170#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" 5171msgid "An error occurred at last startup while loading %s!%sLoad this project again?" 5172msgstr "Bij het laden van %s is er laatst een fout opgetreden!%sDit project opnieuw laden?" 5173 5174#: lazarusidestrconsts.lisappearance 5175msgid "Appearance" 5176msgstr "" 5177 5178#: lazarusidestrconsts.lisapplicationclassname 5179msgid "&Application class name" 5180msgstr "" 5181 5182#: lazarusidestrconsts.lisapplicationprogramdescriptor 5183msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI." 5184msgstr "" 5185 5186#: lazarusidestrconsts.lisapply 5187msgctxt "lazarusidestrconsts.lisapply" 5188msgid "Apply" 5189msgstr "Toepassen" 5190 5191#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo 5192msgid "apply build flags (-B) to dependencies too" 5193msgstr "" 5194 5195#: lazarusidestrconsts.lisapplyconventions 5196msgid "Apply conventions" 5197msgstr "" 5198 5199#: lazarusidestrconsts.lisapplyconventionshint 5200msgid "Adjust name extension and character case for platform and file type." 5201msgstr "" 5202 5203#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects 5204msgid "A project unit can not be used by other packages/projects" 5205msgstr "" 5206 5207#: lazarusidestrconsts.lisaroundborderspacehint 5208msgid "Borderspace around the control. The other four borderspaces are added to this value." 5209msgstr "Randruimte rond het control. De andere vier randruimtes worden opgeteld aan deze waarde." 5210 5211#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext 5212msgid "Ask before replacing each found text" 5213msgstr "Vraag voor het vervangen van gevonden tekst" 5214 5215#: lazarusidestrconsts.lisaskbeforesavingprojectssession 5216msgid "Ask before saving project's session" 5217msgstr "" 5218 5219#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform 5220msgid "Ask for component name after putting it on a designer form." 5221msgstr "" 5222 5223#: lazarusidestrconsts.lisaskforfilenameonnewfile 5224msgid "Ask for file name on new file" 5225msgstr "" 5226 5227#: lazarusidestrconsts.lisasknameoncreate 5228msgid "Ask name on create" 5229msgstr "" 5230 5231#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin 5232msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe" 5233msgstr "" 5234 5235#: lazarusidestrconsts.lisautoadjustideheight 5236msgid "Automatically adjust IDE main window height" 5237msgstr "" 5238 5239#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette 5240msgid "Show complete component palette" 5241msgstr "" 5242 5243#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint 5244msgid "If component palette spans over more lines, show them all and not only one." 5245msgstr "" 5246 5247#: lazarusidestrconsts.lisautocompletionoff 5248msgid "Auto completion: off" 5249msgstr "" 5250 5251#: lazarusidestrconsts.lisautocompletionon 5252msgid "Auto completion: on" 5253msgstr "" 5254 5255#: lazarusidestrconsts.lisautocontinueafter 5256msgid "Auto continue after:" 5257msgstr "" 5258 5259#: lazarusidestrconsts.lisautomarkup 5260msgid "Markup and Matches" 5261msgstr "" 5262 5263#: lazarusidestrconsts.lisautomatic 5264msgctxt "lazarusidestrconsts.lisautomatic" 5265msgid "Automatic" 5266msgstr "" 5267 5268#: lazarusidestrconsts.lisautomatically 5269msgid "Automatically" 5270msgstr "" 5271 5272#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs 5273msgid "Automatically convert .lfm files to .lrs resource files" 5274msgstr "" 5275 5276#: lazarusidestrconsts.lisautomaticallyignoreforselection 5277msgid "do not complete selection" 5278msgstr "" 5279 5280#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint 5281msgid "Automatically invoke after point" 5282msgstr "" 5283 5284#: lazarusidestrconsts.lisautomaticallyinvokeontype 5285msgid "Automatically invoke on typing" 5286msgstr "" 5287 5288#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength 5289msgid "Only complete if word is longer or equal" 5290msgstr "" 5291 5292#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend 5293msgid "Only complete when at end of word" 5294msgstr "" 5295 5296#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer 5297msgid "Use completion box delay" 5298msgstr "" 5299 5300#: lazarusidestrconsts.lisautomaticallyonlinebreak 5301msgid "line break" 5302msgstr "" 5303 5304#: lazarusidestrconsts.lisautomaticallyonspace 5305msgid "space" 5306msgstr "" 5307 5308#: lazarusidestrconsts.lisautomaticallyontab 5309msgid "tab" 5310msgstr "" 5311 5312#: lazarusidestrconsts.lisautomaticallyonwordend 5313msgid "word end" 5314msgstr "" 5315 5316#: lazarusidestrconsts.lisautomaticallyremovecharacter 5317msgid "do not add character" 5318msgstr "" 5319 5320#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident 5321msgid "Automatically use single possible identifier" 5322msgstr "" 5323 5324#: lazarusidestrconsts.lisautomaticfeatures 5325#, fuzzy 5326#| msgid "Automatic features" 5327msgid "Completion and Hints" 5328msgstr "Automatische kenmerken" 5329 5330#: lazarusidestrconsts.lisautoshowobjectinspector 5331msgid "Auto show" 5332msgstr "" 5333 5334#: lazarusidestrconsts.lisavailableforinstallation 5335msgid "Available for installation" 5336msgstr "" 5337 5338#: lazarusidestrconsts.lisavailableprojectbuildmodes 5339msgid "Available project build modes:" 5340msgstr "" 5341 5342#: lazarusidestrconsts.lisbackupchangedfiles 5343msgid "Make backup of changed files" 5344msgstr "" 5345 5346#: lazarusidestrconsts.lisbackupfilefailed 5347msgid "Backup file failed" 5348msgstr "Backup bestand gefaald" 5349 5350#: lazarusidestrconsts.lisbackuphint 5351msgid "Creates a Backup directory under project directory" 5352msgstr "" 5353 5354#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies 5355#, object-pascal-format 5356msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." 5357msgstr "Wijzigen van de package naam of de versie verbreekt afhankelijkheden. Moeten deze afhankelijkheden ook worden gewijzigd?%sKies Ja om alle weergegeven afhankelijkheden te wijzigen.%sKies Negeren om de afhankelijkheden te verbreken." 5358 5359#: lazarusidestrconsts.lisbegins 5360msgid "begins" 5361msgstr "begint met" 5362 5363#: lazarusidestrconsts.lisbehindrelated 5364msgid "Behind related" 5365msgstr "" 5366 5367#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes 5368msgid "be less verbose, can be given multiple times" 5369msgstr "" 5370 5371#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes 5372msgid "be more verbose, can be given multiple times" 5373msgstr "" 5374 5375#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip 5376msgid "Best viewed by installing a HTML control like turbopoweriprodsgn" 5377msgstr "" 5378 5379#: lazarusidestrconsts.lisbfalwaysbuildbeforerun 5380msgid "Always build before run" 5381msgstr "" 5382 5383#: lazarusidestrconsts.lisbfbuildcommand 5384msgid "Build Command" 5385msgstr "" 5386 5387#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead 5388msgid "On build project execute the Build File command instead" 5389msgstr "" 5390 5391#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead 5392msgid "On run project execute the Run File command instead" 5393msgstr "" 5394 5395#: lazarusidestrconsts.lisbfruncommand 5396msgid "Run Command" 5397msgstr "Run commando" 5398 5399#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor 5400msgid "When this file is active in source editor" 5401msgstr "" 5402 5403#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath 5404msgid "Working directory (leave empty for file path)" 5405msgstr "" 5406 5407#: lazarusidestrconsts.lisbinary 5408#, fuzzy 5409msgctxt "lazarusidestrconsts.lisbinary" 5410msgid "Binary" 5411msgstr "Binair" 5412 5413#: lazarusidestrconsts.lisboldnondefaultobjectinspector 5414msgid "Bold non default values" 5415msgstr "" 5416 5417#: lazarusidestrconsts.lisborderspace 5418#, fuzzy 5419#| msgid "BorderSpace" 5420msgid "Border space" 5421msgstr "Randruimte" 5422 5423#: lazarusidestrconsts.lisbottom 5424msgctxt "lazarusidestrconsts.lisbottom" 5425msgid "Bottom" 5426msgstr "" 5427 5428#: lazarusidestrconsts.lisbottomborderspacespinedithint 5429msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." 5430msgstr "Bodem randruimte. Deze waarde wordt toegevoegd aan de basis randruimte en gebruikt voor de ruimte onder het control." 5431 5432#: lazarusidestrconsts.lisbottomgroupboxcaption 5433msgid "Bottom anchoring" 5434msgstr "Bodem ankering" 5435 5436#: lazarusidestrconsts.lisbottoms 5437msgid "Bottoms" 5438msgstr "Bodems" 5439 5440#: lazarusidestrconsts.lisbottomsiblingcomboboxhint 5441#, fuzzy 5442#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)." 5443msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 5444msgstr "Dit is het verwante control waaraan de bodemzijde is verankerd. Laat het leeg voor ouders." 5445 5446#: lazarusidestrconsts.lisbottomspaceequally 5447msgid "Bottom space equally" 5448msgstr "Bodem gelijk gespaceerd" 5449 5450#: lazarusidestrconsts.lisbpsdisabled 5451msgctxt "lazarusidestrconsts.lisbpsdisabled" 5452msgid "Disabled" 5453msgstr "" 5454 5455#: lazarusidestrconsts.lisbpsenabled 5456#, fuzzy 5457msgctxt "lazarusidestrconsts.lisbpsenabled" 5458msgid "Enabled" 5459msgstr "Ingeschakeld" 5460 5461#: lazarusidestrconsts.lisbreak 5462msgctxt "lazarusidestrconsts.lisbreak" 5463msgid "Break" 5464msgstr "" 5465 5466#: lazarusidestrconsts.lisbreakpointproperties 5467msgid "Breakpoint Properties" 5468msgstr "" 5469 5470#: lazarusidestrconsts.lisbrowseandselectacompiler 5471msgid "Browse and select a compiler (e.g. ppcx64" 5472msgstr "" 5473 5474#: lazarusidestrconsts.lisbtnadd 5475msgctxt "lazarusidestrconsts.lisbtnadd" 5476msgid "&Add" 5477msgstr "&Toevoegen" 5478 5479#: lazarusidestrconsts.lisbtnclose 5480msgctxt "lazarusidestrconsts.lisbtnclose" 5481msgid "&Close" 5482msgstr "&Sluiten" 5483 5484#: lazarusidestrconsts.lisbtndelete 5485msgctxt "lazarusidestrconsts.lisbtndelete" 5486msgid "&Delete" 5487msgstr "&Verwijderen" 5488 5489#: lazarusidestrconsts.lisbtndlgadd 5490msgid "&Add ..." 5491msgstr "" 5492 5493#: lazarusidestrconsts.lisbtndlgreplace 5494msgctxt "lazarusidestrconsts.lisbtndlgreplace" 5495msgid "&Replace ..." 5496msgstr "" 5497 5498#: lazarusidestrconsts.lisbtnenabled 5499msgctxt "lazarusidestrconsts.lisbtnenabled" 5500msgid "&Enabled" 5501msgstr "&Ingeschakeld" 5502 5503#: lazarusidestrconsts.lisbtnfind 5504msgid "&Find" 5505msgstr "" 5506 5507#: lazarusidestrconsts.lisbtnquit 5508#, fuzzy 5509#| msgid "Quit" 5510msgctxt "lazarusidestrconsts.lisbtnquit" 5511msgid "&Quit" 5512msgstr "Afsluiten" 5513 5514#: lazarusidestrconsts.lisbtnremove 5515msgctxt "lazarusidestrconsts.lisbtnremove" 5516msgid "&Remove" 5517msgstr "" 5518 5519#: lazarusidestrconsts.lisbtnrename 5520msgid "&Rename" 5521msgstr "" 5522 5523#: lazarusidestrconsts.lisbtnreplace 5524msgid "&Replace" 5525msgstr "" 5526 5527#: lazarusidestrconsts.lisbuild 5528msgctxt "lazarusidestrconsts.lisbuild" 5529msgid "Build" 5530msgstr "Bouw" 5531 5532#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide 5533msgid "build all files of project/package/IDE" 5534msgstr "" 5535 5536#: lazarusidestrconsts.lisbuildcaption 5537msgctxt "lazarusidestrconsts.lisbuildcaption" 5538msgid "Build" 5539msgstr "Bouw" 5540 5541#: lazarusidestrconsts.lisbuildide 5542msgid "Build IDE" 5543msgstr "" 5544 5545#: lazarusidestrconsts.lisbuildidewithpackages 5546msgid "build IDE with packages" 5547msgstr "" 5548 5549#: lazarusidestrconsts.lisbuilding 5550msgid "Building" 5551msgstr "" 5552 5553#: lazarusidestrconsts.lisbuildinglazarusfailed 5554msgid "Building Lazarus failed" 5555msgstr "" 5556 5557#: lazarusidestrconsts.lisbuildmode 5558#, object-pascal-format 5559msgid "Build Mode: %s" 5560msgstr "" 5561 5562#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes 5563msgid "Differences between build modes" 5564msgstr "" 5565 5566#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes 5567msgid "Differences from other build modes" 5568msgstr "" 5569 5570#: lazarusidestrconsts.lisbuildmodediffmode 5571msgid "Mode:" 5572msgstr "" 5573 5574#: lazarusidestrconsts.lisbuildmodeintitleinexample 5575msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus" 5576msgstr "" 5577 5578#: lazarusidestrconsts.lisbuildmodes 5579msgid "Build modes" 5580msgstr "" 5581 5582#: lazarusidestrconsts.lisbuildnewproject 5583msgid "Build new project" 5584msgstr "Bouw nieuw project" 5585 5586#: lazarusidestrconsts.lisbuildnumber 5587#, fuzzy 5588#| msgid "Build Number" 5589msgid "Build number" 5590msgstr "Bouw Number" 5591 5592#: lazarusidestrconsts.lisbuildstage 5593msgctxt "lazarusidestrconsts.lisbuildstage" 5594msgid "Build" 5595msgstr "Bouw" 5596 5597#: lazarusidestrconsts.lisbusy 5598msgid "Busy" 5599msgstr "" 5600 5601#: lazarusidestrconsts.lisbyte 5602#, object-pascal-format 5603msgid "%s byte" 5604msgstr "" 5605 5606#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed 5607#, object-pascal-format 5608msgid "Calling %s to create Makefile from %s failed." 5609msgstr "" 5610 5611#: lazarusidestrconsts.liscallstacknotevaluated 5612msgid "Stack not evaluated" 5613msgstr "" 5614 5615#: lazarusidestrconsts.liscancel 5616msgctxt "lazarusidestrconsts.liscancel" 5617msgid "Cancel" 5618msgstr "Annuleren" 5619 5620#: lazarusidestrconsts.liscancelloadingthiscomponent 5621msgid "Cancel loading this component" 5622msgstr "" 5623 5624#: lazarusidestrconsts.liscancelloadingunit 5625msgid "Cancel loading unit" 5626msgstr "Laden van de unit annuleren" 5627 5628#: lazarusidestrconsts.liscancelrenaming 5629msgid "Cancel renaming" 5630msgstr "Hernoemen annuleren" 5631 5632#: lazarusidestrconsts.liscannotcompileproject 5633msgid "Cannot compile project" 5634msgstr "" 5635 5636#: lazarusidestrconsts.liscannotcopytoplevelcomponent 5637#, fuzzy 5638#| msgid "Can not copy top level component." 5639msgid "Cannot copy top level component." 5640msgstr "Kan top-level component niet kopiëren." 5641 5642#: lazarusidestrconsts.liscannotcreatefile 5643#, object-pascal-format, fuzzy 5644#| msgid "Cannot create file %s%s%s" 5645msgid "Cannot create file \"%s\"" 5646msgstr "Kan bestand \"%s\" niet maken" 5647 5648#: lazarusidestrconsts.liscannotdeletelastmode 5649msgid "Cannot delete last mode." 5650msgstr "" 5651 5652#: lazarusidestrconsts.liscannotexecute 5653#, object-pascal-format 5654msgid "cannot execute \"%s\"" 5655msgstr "" 5656 5657#: lazarusidestrconsts.liscannotfind 5658#, object-pascal-format 5659msgid "Cannot find %s" 5660msgstr "" 5661 5662#: lazarusidestrconsts.liscannotfindexecutable 5663#, object-pascal-format 5664msgid "cannot find executable \"%s\"" 5665msgstr "" 5666 5667#: lazarusidestrconsts.liscannotfindlazarusstarter 5668#, object-pascal-format, fuzzy 5669#| msgid "Cannot find lazarus starter:%s%s" 5670msgid "Cannot find Lazarus starter:%s%s" 5671msgstr "Kan Lazarus Starter niet vinden:%s%s" 5672 5673#: lazarusidestrconsts.liscannotfindunit 5674#, object-pascal-format 5675msgid "Cannot find unit %s" 5676msgstr "" 5677 5678#: lazarusidestrconsts.liscannotopenform 5679#, object-pascal-format 5680msgid "Cannot open form \"%s\"." 5681msgstr "" 5682 5683#: lazarusidestrconsts.liscannotsaveform 5684#, object-pascal-format 5685msgid "Cannot save form \"%s\"." 5686msgstr "" 5687 5688#: lazarusidestrconsts.liscannotsubstitutemacros 5689#, object-pascal-format 5690msgid "Cannot substitute macro \"%s\"." 5691msgstr "" 5692 5693#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling 5694msgid "Cannot test the compiler while debugging or compiling." 5695msgstr "" 5696 5697#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents 5698msgid "Can only change the class of TComponents." 5699msgstr "Alleen the class van TComponents kan gewijzigd worden." 5700 5701#: lazarusidestrconsts.liscantfindavalidppu 5702#, object-pascal-format 5703msgid "Can't find a valid %s.ppu" 5704msgstr "" 5705 5706#: lazarusidestrconsts.liscaptioncomparefiles 5707msgid "Compare files (not for creating patches)" 5708msgstr "" 5709 5710#: lazarusidestrconsts.liscbpfiles 5711#, object-pascal-format 5712msgid "%s (%s files)" 5713msgstr "" 5714 5715#: lazarusidestrconsts.liscbpreallydeletesourcefiles 5716#, object-pascal-format 5717msgid "Really delete %s source files%s%s" 5718msgstr "" 5719 5720#: lazarusidestrconsts.lisccdchangeclassof 5721#, object-pascal-format 5722msgid "Change Class of %s" 5723msgstr "" 5724 5725#: lazarusidestrconsts.lisccdnoclass 5726msgid "no class" 5727msgstr "" 5728 5729#: lazarusidestrconsts.lisccoambiguouscompiler 5730msgid "Ambiguous compiler" 5731msgstr "" 5732 5733#: lazarusidestrconsts.lisccochecktestdir 5734#, object-pascal-format 5735msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects" 5736msgstr "" 5737 5738#: lazarusidestrconsts.lisccocompilernotanexe 5739#, object-pascal-format 5740msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" 5741msgstr "" 5742 5743#: lazarusidestrconsts.lisccocontains 5744msgid "contains " 5745msgstr "" 5746 5747#: lazarusidestrconsts.lisccocopyoutputtocliboard 5748msgid "Copy output to clipboard" 5749msgstr "" 5750 5751#: lazarusidestrconsts.lisccodatesdiffer 5752#, object-pascal-format 5753msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" 5754msgstr "" 5755 5756#: lazarusidestrconsts.lisccoerrorcaption 5757msgctxt "lazarusidestrconsts.lisccoerrorcaption" 5758msgid "Error" 5759msgstr "Fout" 5760 5761#: lazarusidestrconsts.lisccoerrormsg 5762msgid "ERROR: " 5763msgstr "" 5764 5765#: lazarusidestrconsts.lisccofpcunitpathhassource 5766msgid "FPC unit path contains a source: " 5767msgstr "" 5768 5769#: lazarusidestrconsts.lisccohasnewline 5770msgid "new line symbols" 5771msgstr "" 5772 5773#: lazarusidestrconsts.lisccohintmsg 5774msgid "HINT: " 5775msgstr "" 5776 5777#: lazarusidestrconsts.lisccoinvalidcompiler 5778msgid "Invalid compiler" 5779msgstr "" 5780 5781#: lazarusidestrconsts.lisccoinvalidsearchpath 5782msgid "Invalid search path" 5783msgstr "" 5784 5785#: lazarusidestrconsts.lisccoinvalidtestdir 5786msgid "Invalid Test Directory" 5787msgstr "" 5788 5789#: lazarusidestrconsts.lisccomissingunit 5790msgid "Missing unit" 5791msgstr "" 5792 5793#: lazarusidestrconsts.lisccomsgrtlunitnotfound 5794#, object-pascal-format 5795msgid "RTL unit not found: %s" 5796msgstr "" 5797 5798#: lazarusidestrconsts.lisccomultiplecfgfound 5799msgid "multiple compiler configs found: " 5800msgstr "" 5801 5802#: lazarusidestrconsts.liscconocfgfound 5803msgid "no fpc.cfg found" 5804msgstr "" 5805 5806#: lazarusidestrconsts.lisccononascii 5807msgid "non ASCII" 5808msgstr "" 5809 5810#: lazarusidestrconsts.lisccoppuexiststwice 5811#, object-pascal-format 5812msgid "ppu exists twice: %s, %s" 5813msgstr "" 5814 5815#: lazarusidestrconsts.lisccoppuolderthancompiler 5816#, object-pascal-format 5817msgid "There is a .ppu file older than the compiler itself:%s%s" 5818msgstr "" 5819 5820#: lazarusidestrconsts.lisccortlunitnotfounddetailed 5821#, object-pascal-format 5822msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken." 5823msgstr "" 5824 5825#: lazarusidestrconsts.lisccoseveralcompilers 5826#, object-pascal-format 5827msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" 5828msgstr "" 5829 5830#: lazarusidestrconsts.lisccoskip 5831msgid "Skip" 5832msgstr "" 5833 5834#: lazarusidestrconsts.lisccospecialcharacters 5835msgid "special characters" 5836msgstr "" 5837 5838#: lazarusidestrconsts.lisccotestssuccess 5839msgid "All tests succeeded." 5840msgstr "" 5841 5842#: lazarusidestrconsts.lisccounabletocreatetestfile 5843msgid "Unable to create Test File" 5844msgstr "" 5845 5846#: lazarusidestrconsts.lisccounabletocreatetestpascalfile 5847#, object-pascal-format 5848msgid "Unable to create Test Pascal file \"%s\"." 5849msgstr "" 5850 5851#: lazarusidestrconsts.lisccounusualchars 5852msgid "unusual characters" 5853msgstr "" 5854 5855#: lazarusidestrconsts.lisccowarningcaption 5856msgctxt "lazarusidestrconsts.lisccowarningcaption" 5857msgid "Warning" 5858msgstr "" 5859 5860#: lazarusidestrconsts.lisccowarningmsg 5861msgid "WARNING: " 5862msgstr "" 5863 5864#: lazarusidestrconsts.lisccowrongpathdelimiter 5865msgid "wrong path delimiter" 5866msgstr "" 5867 5868#: lazarusidestrconsts.liscecategories 5869msgid "Categories" 5870msgstr "" 5871 5872#: lazarusidestrconsts.liscecomplexitygroup 5873msgid "Complexity" 5874msgstr "" 5875 5876#: lazarusidestrconsts.lisceconstants 5877msgid "Constants" 5878msgstr "" 5879 5880#: lazarusidestrconsts.lisceemptyblocks 5881msgid "Empty blocks" 5882msgstr "" 5883 5884#: lazarusidestrconsts.lisceemptyclasssections 5885msgid "Empty class sections" 5886msgstr "" 5887 5888#: lazarusidestrconsts.lisceemptygroup 5889msgid "Empty constructs" 5890msgstr "" 5891 5892#: lazarusidestrconsts.lisceemptyprocedures 5893msgid "Empty procedures" 5894msgstr "" 5895 5896#: lazarusidestrconsts.liscefilter 5897#, fuzzy 5898#| msgid "(Filter)" 5899msgid "(filter)" 5900msgstr "(Filter)" 5901 5902#: lazarusidestrconsts.liscefollowcursor 5903msgid "Follow cursor" 5904msgstr "Volg cursor" 5905 5906#: lazarusidestrconsts.liscein 5907#, object-pascal-format 5908msgctxt "lazarusidestrconsts.liscein" 5909msgid "%s in %s" 5910msgstr "" 5911 5912#: lazarusidestrconsts.lisceisarootcontrol 5913msgid "Is a root control" 5914msgstr "" 5915 5916#: lazarusidestrconsts.liscelongparamlistcount 5917msgid "Parameters count treated as \"many\"" 5918msgstr "" 5919 5920#: lazarusidestrconsts.liscelongprocedures 5921msgid "Long procedures" 5922msgstr "" 5923 5924#: lazarusidestrconsts.liscelongproclinecount 5925msgid "Line count of procedure treated as \"long\"" 5926msgstr "" 5927 5928#: lazarusidestrconsts.liscemanynestedprocedures 5929msgid "Many nested procedures" 5930msgstr "" 5931 5932#: lazarusidestrconsts.liscemanyparameters 5933msgid "Many parameters" 5934msgstr "" 5935 5936#: lazarusidestrconsts.liscemodeshowcategories 5937msgid "Show Categories" 5938msgstr "" 5939 5940#: lazarusidestrconsts.liscemodeshowsourcenodes 5941msgid "Show Source Nodes" 5942msgstr "" 5943 5944#: lazarusidestrconsts.liscenestedproccount 5945msgid "Nested procedures count treated as \"many\"" 5946msgstr "" 5947 5948#: lazarusidestrconsts.liscenteralostwindow 5949msgid "Center a lost window" 5950msgstr "" 5951 5952#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling 5953msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored." 5954msgstr "" 5955 5956#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling 5957msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored." 5958msgstr "" 5959 5960#: lazarusidestrconsts.liscenterform 5961msgid "Center Form" 5962msgstr "" 5963 5964#: lazarusidestrconsts.liscenterinwindow 5965msgid "Center in window" 5966msgstr "Centreer in window" 5967 5968#: lazarusidestrconsts.liscenters 5969msgid "Centers" 5970msgstr "Middenpunten" 5971 5972#: lazarusidestrconsts.lisceomode 5973msgid "Preferred exhibition mode" 5974msgstr "" 5975 5976#: lazarusidestrconsts.lisceomodecategory 5977msgctxt "lazarusidestrconsts.lisceomodecategory" 5978msgid "Category" 5979msgstr "" 5980 5981#: lazarusidestrconsts.lisceomodesource 5982msgctxt "lazarusidestrconsts.lisceomodesource" 5983msgid "Source" 5984msgstr "" 5985 5986#: lazarusidestrconsts.lisceoneveronlymanually 5987msgid "Never, only manually" 5988msgstr "Nooit, alleen handmatig" 5989 5990#: lazarusidestrconsts.lisceonlyusedincategorymode 5991msgid "Only used in category mode" 5992msgstr "" 5993 5994#: lazarusidestrconsts.lisceoonidle 5995msgid "On idle" 5996msgstr "On idle" 5997 5998#: lazarusidestrconsts.lisceorefreshautomatically 5999msgid "Refresh automatically" 6000msgstr "Automatisch verversen" 6001 6002#: lazarusidestrconsts.lisceothergroup 6003msgctxt "lazarusidestrconsts.lisceothergroup" 6004msgid "Other" 6005msgstr "Ander" 6006 6007#: lazarusidestrconsts.lisceoupdate 6008msgid "Update" 6009msgstr "Update" 6010 6011#: lazarusidestrconsts.lisceowhenswitchingfile 6012msgid "When switching file in source editor" 6013msgstr "Bij het wisselen van bestand in de bewerker" 6014 6015#: lazarusidestrconsts.lisceprocedures 6016msgid "Procedures" 6017msgstr "" 6018 6019#: lazarusidestrconsts.lisceproperties 6020msgctxt "lazarusidestrconsts.lisceproperties" 6021msgid "Properties" 6022msgstr "" 6023 6024#: lazarusidestrconsts.liscepublishedpropertywithoutdefault 6025msgid "Published properties without default" 6026msgstr "" 6027 6028#: lazarusidestrconsts.lisceshowcodeobserver 6029msgid "Show observations about" 6030msgstr "" 6031 6032#: lazarusidestrconsts.liscestylegroup 6033msgctxt "lazarusidestrconsts.liscestylegroup" 6034msgid "Style" 6035msgstr "" 6036 6037#: lazarusidestrconsts.liscesurrounding 6038msgid "Surrounding" 6039msgstr "" 6040 6041#: lazarusidestrconsts.liscetodos 6042msgid "ToDos" 6043msgstr "" 6044 6045#: lazarusidestrconsts.liscetypes 6046msgid "Types" 6047msgstr "" 6048 6049#: lazarusidestrconsts.lisceunnamedconstants 6050msgid "Unnamed constants" 6051msgstr "" 6052 6053#: lazarusidestrconsts.lisceunsortedmembers 6054msgid "Unsorted members" 6055msgstr "" 6056 6057#: lazarusidestrconsts.lisceunsortedvisibility 6058msgid "Unsorted visibility" 6059msgstr "" 6060 6061#: lazarusidestrconsts.lisceuses 6062msgctxt "lazarusidestrconsts.lisceuses" 6063msgid "Uses" 6064msgstr "" 6065 6066#: lazarusidestrconsts.liscevariables 6067msgid "Variables" 6068msgstr "" 6069 6070#: lazarusidestrconsts.liscewrongindentation 6071msgid "Wrong indentation" 6072msgstr "" 6073 6074#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof 6075#, object-pascal-format 6076msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s" 6077msgstr "" 6078 6079#: lazarusidestrconsts.liscfecancelloadingthisresource 6080msgid "Cancel loading this resource" 6081msgstr "" 6082 6083#: lazarusidestrconsts.liscfeclassnotfound 6084#, object-pascal-format 6085msgid "%s%sClass \"%s\" not found." 6086msgstr "" 6087 6088#: lazarusidestrconsts.liscfecomponent 6089#, object-pascal-format 6090msgid "%s%sComponent: %s:%s" 6091msgstr "" 6092 6093#: lazarusidestrconsts.liscfecomponentclass 6094#, object-pascal-format 6095msgid "%s%sComponent Class: %s" 6096msgstr "" 6097 6098#: lazarusidestrconsts.liscfecontinueloading 6099msgid "Continue loading" 6100msgstr "" 6101 6102#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection 6103msgid "Do not know how to copy this form editing selection" 6104msgstr "" 6105 6106#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection 6107msgid "Do not know how to cut this form editing selection" 6108msgstr "" 6109 6110#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection 6111msgid "Do not know how to delete this form editing selection" 6112msgstr "" 6113 6114#: lazarusidestrconsts.liscfeerrorcreatingcomponent 6115msgid "Error creating component" 6116msgstr "" 6117 6118#: lazarusidestrconsts.liscfeerrorcreatingcomponent2 6119#, object-pascal-format 6120msgid "Error creating component: %s%s%s" 6121msgstr "" 6122 6123#: lazarusidestrconsts.liscfeerrordestroyingcomponent 6124msgid "Error destroying component" 6125msgstr "" 6126 6127#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit 6128#, object-pascal-format 6129msgid "Error destroying component of type %s of unit %s:%s%s" 6130msgstr "" 6131 6132#: lazarusidestrconsts.liscfeerrordestroyingmediator 6133msgid "Error destroying mediator" 6134msgstr "" 6135 6136#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit 6137#, object-pascal-format 6138msgid "Error destroying mediator %s of unit %s:%s%s" 6139msgstr "" 6140 6141#: lazarusidestrconsts.liscfeerrorreading 6142#, object-pascal-format 6143msgid "Error reading %s" 6144msgstr "" 6145 6146#: lazarusidestrconsts.liscfeinfile 6147#, object-pascal-format 6148msgid "In file %s" 6149msgstr "" 6150 6151#: lazarusidestrconsts.liscfeinvalidcomponentowner 6152msgid "Invalid component owner" 6153msgstr "" 6154 6155#: lazarusidestrconsts.liscferoot 6156#, object-pascal-format 6157msgid "%sRoot=%s:%s" 6158msgstr "" 6159 6160#: lazarusidestrconsts.liscfestopallloading 6161msgid "Stop all loading" 6162msgstr "" 6163 6164#: lazarusidestrconsts.liscfestream 6165#, object-pascal-format 6166msgid "%sStream=%s" 6167msgstr "" 6168 6169#: lazarusidestrconsts.liscfestreamposition 6170#, object-pascal-format 6171msgid "%s%sStream position: %s" 6172msgstr "" 6173 6174#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists 6175msgid "TCustomFormEditor.CreateNonFormForm already exists" 6176msgstr "" 6177 6178#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype 6179#, object-pascal-format 6180msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s" 6181msgstr "" 6182 6183#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn 6184#, object-pascal-format 6185msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s" 6186msgstr "" 6187 6188#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre 6189#, object-pascal-format 6190msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s" 6191msgstr "" 6192 6193#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror 6194#, object-pascal-format 6195msgid "The component editor of class \"%s\"has created the error:%s\"%s\"" 6196msgstr "" 6197 6198#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto 6199#, object-pascal-format 6200msgid "The component of type %s failed to set its owner to %s:%s" 6201msgstr "" 6202 6203#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection 6204#, object-pascal-format 6205msgid "Unable to clear the form editing selection%s%s" 6206msgstr "" 6207 6208#: lazarusidestrconsts.lischange 6209msgctxt "lazarusidestrconsts.lischange" 6210msgid "Change" 6211msgstr "Wijzig" 6212 6213#: lazarusidestrconsts.lischangebuildmode 6214msgid "Change build mode" 6215msgstr "" 6216 6217#: lazarusidestrconsts.lischangeclass 6218msgid "Change Class" 6219msgstr "Wijzig Class" 6220 6221#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides 6222#, object-pascal-format 6223msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s." 6224msgstr "" 6225 6226#: lazarusidestrconsts.lischangeencoding 6227msgid "Change Encoding" 6228msgstr "" 6229 6230#: lazarusidestrconsts.lischangefile 6231msgid "Change file" 6232msgstr "" 6233 6234#: lazarusidestrconsts.lischangeparent 6235msgid "Change Parent" 6236msgstr "" 6237 6238#: lazarusidestrconsts.lischangeswerenotsaved 6239msgid "Changes were not saved" 6240msgstr "" 6241 6242#: lazarusidestrconsts.lischangetounix 6243msgid "Change to Unix /" 6244msgstr "" 6245 6246#: lazarusidestrconsts.lischangetowindows 6247msgid "Change to Windows \\" 6248msgstr "" 6249 6250#: lazarusidestrconsts.lischaracter 6251msgid "Character" 6252msgstr "" 6253 6254#: lazarusidestrconsts.lischaractermap 6255msgid "Character Map" 6256msgstr "Karakter tabel" 6257 6258#: lazarusidestrconsts.lischeckall 6259msgid "Check All" 6260msgstr "" 6261 6262#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent 6263msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent" 6264msgid "Check for disk file changes via content rather than timestamp" 6265msgstr "" 6266 6267#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil 6268#, object-pascal-format 6269msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source." 6270msgstr "" 6271 6272#: lazarusidestrconsts.lischeckifpackageisinthedependencies 6273#, object-pascal-format 6274msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies" 6275msgid ". Check if package %s is in the dependencies" 6276msgstr "" 6277 6278#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl 6279msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"." 6280msgstr "" 6281 6282#: lazarusidestrconsts.lischeckoptions 6283msgid "Check options" 6284msgstr "" 6285 6286#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme 6287#, object-pascal-format 6288msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme" 6289msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections." 6290msgstr "" 6291 6292#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded 6293msgid "Check the next token in source and add a semicolon if needed." 6294msgstr "" 6295 6296#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco 6297#, object-pascal-format 6298msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project." 6299msgstr "" 6300 6301#: lazarusidestrconsts.lischeckuncheckall 6302msgid "Check/uncheck all" 6303msgstr "" 6304 6305#: lazarusidestrconsts.lischooseadifferentname 6306msgid "Choose a different name" 6307msgstr "Kies een andere naam" 6308 6309#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates 6310msgid "Choose a file with CodeTools templates" 6311msgstr "" 6312 6313#: lazarusidestrconsts.lischooseafpdoclink 6314msgid "Choose a FPDoc link" 6315msgstr "" 6316 6317#: lazarusidestrconsts.lischooseakey 6318msgid "Choose a key ..." 6319msgstr "" 6320 6321#: lazarusidestrconsts.lischooseanameforthecomponent 6322msgid "Choose a name for the component" 6323msgstr "" 6324 6325#: lazarusidestrconsts.lischooseanexamplefile 6326msgid "Choose an example file" 6327msgstr "" 6328 6329#: lazarusidestrconsts.lischooseanfpcmessagefile 6330msgid "Choose an FPC message file" 6331msgstr "" 6332 6333#: lazarusidestrconsts.lischooseapascalfileforindentationexamples 6334msgid "Choose a Pascal file for indentation examples" 6335msgstr "" 6336 6337#: lazarusidestrconsts.lischoosecompilerexecutable 6338#, object-pascal-format 6339msgid "Choose compiler executable (%s)" 6340msgstr "" 6341 6342#: lazarusidestrconsts.lischoosecompilermessages 6343msgid "Choose compiler messages file" 6344msgstr "" 6345 6346#: lazarusidestrconsts.lischoosedebuggerexecutable 6347msgid "Choose debugger executable" 6348msgstr "" 6349 6350#: lazarusidestrconsts.lischoosedelphipackage 6351msgid "Choose Delphi package (*.dpk)" 6352msgstr "" 6353 6354#: lazarusidestrconsts.lischoosedelphiproject 6355msgid "Choose Delphi project (*.dpr)" 6356msgstr "" 6357 6358#: lazarusidestrconsts.lischoosedelphiunit 6359msgid "Choose Delphi unit (*.pas)" 6360msgstr "Kies Delphi-unit (*.pas)" 6361 6362#: lazarusidestrconsts.lischoosedirectory 6363msgid "Choose directory" 6364msgstr "Kies directory" 6365 6366#: lazarusidestrconsts.lischooseexecutable 6367msgid "Choose an executable" 6368msgstr "" 6369 6370#: lazarusidestrconsts.lischoosefpcsourcedir 6371msgid "Choose FPC source directory" 6372msgstr "Kies FPC-directory" 6373 6374#: lazarusidestrconsts.lischooselazarussourcedirectory 6375msgid "Choose Lazarus Directory" 6376msgstr "Kies Lazarus-directory" 6377 6378#: lazarusidestrconsts.lischoosemakeexecutable 6379msgid "Choose \"make\" executable" 6380msgstr "" 6381 6382#: lazarusidestrconsts.lischoosenameandtext 6383msgid "Choose name and text" 6384msgstr "" 6385 6386#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile 6387msgid "Choose one of these items to create a new File" 6388msgstr "Kies een van deze items om een nieuw bestand te maken" 6389 6390#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage 6391msgid "Choose one of these items to create a new Package" 6392msgstr "Kies een van deze items om een nieuw Package te maken" 6393 6394#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject 6395msgid "Choose one of these items to create a new Project" 6396msgstr "Kies een van deze items om een nieuw Project te maken" 6397 6398#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone 6399msgid "Choose one of these items to inherit from an existing one" 6400msgstr "" 6401 6402#: lazarusidestrconsts.lischooseprogramsourcepppaslpr 6403msgid "Choose program source (*.pp,*.pas,*.lpr)" 6404msgstr "Kies programmabroncode (*.pp, *.pas, *.lpr)" 6405 6406#: lazarusidestrconsts.lischoosestructuretoencloseselection 6407msgid "Choose structure to enclose selection" 6408msgstr "Kies structuur om selectie te omsluiten" 6409 6410#: lazarusidestrconsts.lischoosetestbuilddir 6411msgid "Choose the directory for tests" 6412msgstr "" 6413 6414#: lazarusidestrconsts.liscirculardependencydetected 6415msgid "Circular dependency detected" 6416msgstr "" 6417 6418#: lazarusidestrconsts.lisclass 6419msgid "&Class" 6420msgstr "" 6421 6422#: lazarusidestrconsts.lisclasscompletion 6423msgid "Class Completion" 6424msgstr "" 6425 6426#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked 6427msgid "Classes and properties exist. Values were not checked." 6428msgstr "" 6429 6430#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste 6431#, object-pascal-format, fuzzy 6432#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste." 6433msgid "Class \"%s\" is not a registered component class.%sUnable to paste." 6434msgstr "Class \"%s\" is geen geregistreerde componentklasse.%sKan niet plakken." 6435 6436#: lazarusidestrconsts.lisclassnotfound 6437msgid "Class not found" 6438msgstr "Klasse niet gevonden" 6439 6440#: lazarusidestrconsts.lisclassnotfoundat 6441#, object-pascal-format 6442msgid "Class %s not found at %s(%s,%s)" 6443msgstr "" 6444 6445#: lazarusidestrconsts.lisclassofmethodnotfound 6446#, object-pascal-format 6447msgid "Class \"%s\" of method \"%s\" not found." 6448msgstr "" 6449 6450#: lazarusidestrconsts.liscldirclean 6451msgid "Clean" 6452msgstr "" 6453 6454#: lazarusidestrconsts.liscldircleandirectory 6455msgid "Clean Directory" 6456msgstr "Maak directory schoon" 6457 6458#: lazarusidestrconsts.liscldircleansubdirectories 6459msgid "Clean sub directories" 6460msgstr "Maak sub directory schoon" 6461 6462#: lazarusidestrconsts.liscldirkeepalltextfiles 6463msgid "Keep all text files" 6464msgstr "Behoud alle Tekst bestanden" 6465 6466#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter 6467msgid "Keep files matching filter" 6468msgstr "Bewaar bestanden die aan het filter voldoen" 6469 6470#: lazarusidestrconsts.liscldirremovefilesmatchingfilter 6471msgid "Remove files matching filter" 6472msgstr "Overeenkomende bestanden verwijderen" 6473 6474#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof 6475msgid "Simple Syntax (e.g. * instead of .*)" 6476msgstr "Eenvoudige syntax (* i.p.v. .*)" 6477 6478#: lazarusidestrconsts.liscleanall 6479msgid "Clean all" 6480msgstr "" 6481 6482#: lazarusidestrconsts.liscleancommonfiles 6483msgid "Clean common files" 6484msgstr "" 6485 6486#: lazarusidestrconsts.liscleanlazarussource 6487msgid "Clean Lazarus Source" 6488msgstr "Maak Lazarus-broncode schoon" 6489 6490#: lazarusidestrconsts.liscleanonlyonce 6491msgid "Switch after building to automatically" 6492msgstr "" 6493 6494#: lazarusidestrconsts.liscleanup 6495msgid "Clean up" 6496msgstr "" 6497 6498#: lazarusidestrconsts.liscleanupandbuild 6499msgctxt "lazarusidestrconsts.liscleanupandbuild" 6500msgid "Clean up and build" 6501msgstr "" 6502 6503#: lazarusidestrconsts.liscleanupandbuildproject 6504msgid "Clean up and build project" 6505msgstr "" 6506 6507#: lazarusidestrconsts.liscleanuppackage 6508#, object-pascal-format 6509msgid "Clean up package \"%s\"." 6510msgstr "" 6511 6512#: lazarusidestrconsts.liscleanupunitpath 6513msgid "Clean up unit path?" 6514msgstr "Unit pad opschonen?" 6515 6516#: lazarusidestrconsts.lisclear 6517msgctxt "lazarusidestrconsts.lisclear" 6518msgid "Clear" 6519msgstr "Maak schoon" 6520 6521#: lazarusidestrconsts.liscleardirectory 6522msgid "Clear Directory?" 6523msgstr "" 6524 6525#: lazarusidestrconsts.lisclearthefilterforoptions 6526msgid "Clear the filter for options" 6527msgstr "" 6528 6529#: lazarusidestrconsts.lisclickheretobrowsethefilehint 6530msgid "Click here to browse the file" 6531msgstr "" 6532 6533#: lazarusidestrconsts.lisclicktoseethechoices 6534msgid "Click to see the choices" 6535msgstr "" 6536 6537#: lazarusidestrconsts.lisclicktoselectpalettepage 6538msgid "Click to Select Palette Page" 6539msgstr "" 6540 6541#: lazarusidestrconsts.lisclone 6542msgid "Clone" 6543msgstr "" 6544 6545#: lazarusidestrconsts.lisclose 6546#, fuzzy 6547#| msgid "&Close" 6548msgctxt "lazarusidestrconsts.lisclose" 6549msgid "Close" 6550msgstr "&Sluiten" 6551 6552#: lazarusidestrconsts.liscloseall 6553msgctxt "lazarusidestrconsts.liscloseall" 6554msgid "Close All" 6555msgstr "Sluit alles" 6556 6557#: lazarusidestrconsts.liscloseallchecked 6558msgid "Close All Checked" 6559msgstr "" 6560 6561#: lazarusidestrconsts.lisclosealltabsclose 6562msgid "Close files" 6563msgstr "" 6564 6565#: lazarusidestrconsts.lisclosealltabshide 6566msgctxt "lazarusidestrconsts.lisclosealltabshide" 6567msgid "Hide window" 6568msgstr "" 6569 6570#: lazarusidestrconsts.lisclosealltabsquestion 6571msgid "Closing a Source Editor Window. Do you want close all files or hide the window?" 6572msgstr "" 6573 6574#: lazarusidestrconsts.lisclosealltabstitle 6575msgid "Close Source Editor Window" 6576msgstr "" 6577 6578#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions 6579msgid "LCL Interface specific options:" 6580msgstr "LCL Interface specifieke opties:" 6581 6582#: lazarusidestrconsts.liscmparameter 6583msgid "Parameter" 6584msgstr "Parameter" 6585 6586#: lazarusidestrconsts.liscmplstcomponents 6587msgctxt "lazarusidestrconsts.liscmplstcomponents" 6588msgid "Components" 6589msgstr "" 6590 6591#: lazarusidestrconsts.liscmplstinheritance 6592msgid "Inheritance" 6593msgstr "" 6594 6595#: lazarusidestrconsts.liscmplstlist 6596msgid "List" 6597msgstr "" 6598 6599#: lazarusidestrconsts.liscmplstpalette 6600msgid "Palette" 6601msgstr "" 6602 6603#: lazarusidestrconsts.liscmppages 6604msgid "Pages" 6605msgstr "" 6606 6607#: lazarusidestrconsts.liscmppalettevisible 6608msgid "Palette is &visible" 6609msgstr "" 6610 6611#: lazarusidestrconsts.liscmprestoredefaults 6612msgid "&Restore defaults" 6613msgstr "" 6614 6615#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile 6616msgid "Ambiguous additional compiler config file" 6617msgstr "Dubbelzinnige, extra compiler configuratie bestand" 6618 6619#: lazarusidestrconsts.liscocallon 6620msgid "Call on:" 6621msgstr "Aanroepen bij:" 6622 6623#: lazarusidestrconsts.liscoclickokifaresuretodothat 6624#, object-pascal-format, fuzzy 6625#| msgid "%s%sClick OK if you are sure to do that." 6626msgid "%s%sClick OK if you definitely want to do that." 6627msgstr "%s%sKlik op OK als je zeker weet dat je dat wilt doen." 6628 6629#: lazarusidestrconsts.liscocommand 6630msgctxt "lazarusidestrconsts.liscocommand" 6631msgid "Command:" 6632msgstr "Opdracht:" 6633 6634#: lazarusidestrconsts.liscode 6635msgid "Code" 6636msgstr "" 6637 6638#: lazarusidestrconsts.liscodebrowser 6639msgctxt "lazarusidestrconsts.liscodebrowser" 6640msgid "Code Browser" 6641msgstr "" 6642 6643#: lazarusidestrconsts.liscodecreationdialogcaption 6644msgid "Code creation options" 6645msgstr "" 6646 6647#: lazarusidestrconsts.liscodecreationdialogclasssection 6648msgid "Class section" 6649msgstr "" 6650 6651#: lazarusidestrconsts.liscodecreationdialoglocation 6652msgctxt "lazarusidestrconsts.liscodecreationdialoglocation" 6653msgid "Location" 6654msgstr "" 6655 6656#: lazarusidestrconsts.liscodegenerationoptions 6657msgid "Code generation options" 6658msgstr "" 6659 6660#: lazarusidestrconsts.liscodehelpaddpathbutton 6661msgid "Add path" 6662msgstr "Pad toevoegen" 6663 6664#: lazarusidestrconsts.liscodehelpbrowseexamplebutton 6665#, fuzzy 6666msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton" 6667msgid "Browse" 6668msgstr "Blader" 6669 6670#: lazarusidestrconsts.liscodehelpconfirmreplace 6671msgid "Confirm replace" 6672msgstr "" 6673 6674#: lazarusidestrconsts.liscodehelpcreatebutton 6675msgid "Create help item" 6676msgstr "" 6677 6678#: lazarusidestrconsts.liscodehelpdeletepathbutton 6679msgid "Remove path" 6680msgstr "Verwijder pad" 6681 6682#: lazarusidestrconsts.liscodehelpdescrtag 6683msgctxt "lazarusidestrconsts.liscodehelpdescrtag" 6684msgid "Description" 6685msgstr "" 6686 6687#: lazarusidestrconsts.liscodehelperrorstag 6688#, fuzzy 6689msgctxt "lazarusidestrconsts.liscodehelperrorstag" 6690msgid "Errors" 6691msgstr "Fouten" 6692 6693#: lazarusidestrconsts.liscodehelpexampletag 6694msgid "Example" 6695msgstr "Voorbeeld" 6696 6697#: lazarusidestrconsts.liscodehelpgroupbox 6698msgid "FPDoc settings" 6699msgstr "" 6700 6701#: lazarusidestrconsts.liscodehelphintboldformat 6702msgid "Insert bold formatting tag" 6703msgstr "" 6704 6705#: lazarusidestrconsts.liscodehelphintinsertcodetag 6706msgid "Insert code formatting tag" 6707msgstr "Voeg \"code\" opmaak-tag in" 6708 6709#: lazarusidestrconsts.liscodehelphintitalicformat 6710msgid "Insert italic formatting tag" 6711msgstr "Voeg \"schuin\" opmaak-tag in" 6712 6713#: lazarusidestrconsts.liscodehelphintremarktag 6714msgid "Insert remark formatting tag" 6715msgstr "Voeg opmerking opmaak-tag in" 6716 6717#: lazarusidestrconsts.liscodehelphintunderlineformat 6718msgid "Insert underline formatting tag" 6719msgstr "Voeg \"onderstreep\" opmaak-tag in" 6720 6721#: lazarusidestrconsts.liscodehelphintvartag 6722msgid "Insert var formatting tag" 6723msgstr "Voeg var opmaak-tag in" 6724 6725#: lazarusidestrconsts.liscodehelpinherited 6726msgctxt "lazarusidestrconsts.liscodehelpinherited" 6727msgid "Inherited" 6728msgstr "Overerfd" 6729 6730#: lazarusidestrconsts.liscodehelpinsertalink 6731msgid "Insert a link ..." 6732msgstr "" 6733 6734#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag 6735msgid "Insert paragraph formatting tag" 6736msgstr "" 6737 6738#: lazarusidestrconsts.liscodehelpmainformcaption 6739msgctxt "lazarusidestrconsts.liscodehelpmainformcaption" 6740msgid "FPDoc Editor" 6741msgstr "" 6742 6743#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound 6744msgid "(no inherited description found)" 6745msgstr "" 6746 6747#: lazarusidestrconsts.liscodehelpnotagcaption 6748msgid "<NONE>" 6749msgstr "<GEEN>" 6750 6751#: lazarusidestrconsts.liscodehelpseealsotag 6752msgid "See also" 6753msgstr "Zie ook" 6754 6755#: lazarusidestrconsts.liscodehelpshortdescriptionof 6756msgid "Short description of" 6757msgstr "" 6758 6759#: lazarusidestrconsts.liscodehelpshorttag 6760msgid "Short" 6761msgstr "Kort" 6762 6763#: lazarusidestrconsts.liscodeobignoreconstinfuncs 6764msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs" 6765msgid "Ignore constants in next functions" 6766msgstr "" 6767 6768#: lazarusidestrconsts.liscodeobscharconst 6769msgctxt "lazarusidestrconsts.liscodeobscharconst" 6770msgid "Search for unnamed char constants" 6771msgstr "" 6772 6773#: lazarusidestrconsts.liscodeobserver 6774msgid "Code Observer" 6775msgstr "" 6776 6777#: lazarusidestrconsts.liscodeobsignoreeconstants 6778msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants" 6779msgid "Ignore next unnamed constants" 6780msgstr "" 6781 6782#: lazarusidestrconsts.liscodetempladd 6783#, fuzzy 6784#| msgid "Add" 6785msgctxt "lazarusidestrconsts.liscodetempladd" 6786msgid "Add template" 6787msgstr "Toevoegen" 6788 6789#: lazarusidestrconsts.liscodetempladdcodetemplate 6790msgid "Add code template" 6791msgstr "Codesjabloon toevoegen" 6792 6793#: lazarusidestrconsts.liscodetemplatokenalreadyexists 6794#, object-pascal-format, fuzzy 6795#| msgid " A token %s%s%s already exists! " 6796msgid " A token \"%s\" already exists! " 6797msgstr " Het teken \"%s\" bestaat al !" 6798 6799#: lazarusidestrconsts.liscodetemplautocompleteon 6800msgid "Auto complete on" 6801msgstr "" 6802 6803#: lazarusidestrconsts.liscodetemplchange 6804msgctxt "lazarusidestrconsts.liscodetemplchange" 6805msgid "Change" 6806msgstr "Wijzig" 6807 6808#: lazarusidestrconsts.liscodetemplcomment 6809msgid "Comment:" 6810msgstr "Commentaar:" 6811 6812#: lazarusidestrconsts.liscodetempleditcodetemplate 6813msgid "Edit code template" 6814msgstr "Bewerk code template" 6815 6816#: lazarusidestrconsts.liscodetemplerror 6817msgctxt "lazarusidestrconsts.liscodetemplerror" 6818msgid "Error" 6819msgstr "Fout" 6820 6821#: lazarusidestrconsts.liscodetempltoken 6822msgid "Token:" 6823msgstr "Teken:" 6824 6825#: lazarusidestrconsts.liscodetoolsdefsaction 6826#, object-pascal-format 6827msgid "Action: %s" 6828msgstr "Actie: %s" 6829 6830#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly 6831#, object-pascal-format, fuzzy 6832#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." 6833msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes." 6834msgstr "Automatisch gemaakte nodes kunnen niet bewerkt worden,%stevens kunnen ze geen automatisch gemaakte Child nodes bevatten." 6835 6836#: lazarusidestrconsts.liscodetoolsdefsautogenerated 6837#, object-pascal-format 6838msgid "%s, auto generated" 6839msgstr "%s, automatisch gegenereerd" 6840 6841#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited 6842#, fuzzy 6843#| msgid "Auto generated nodes can not be edited." 6844msgid "Auto generated nodes cannot be edited." 6845msgstr "Automatisch gegenereerde nodes kunnen niet bewerkt worden." 6846 6847#: lazarusidestrconsts.liscodetoolsdefsblock 6848msgid "Block" 6849msgstr "Blok" 6850 6851#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor 6852msgid "CodeTools Defines Editor" 6853msgstr "Editor voor codeerhulpmiddelendefinities" 6854 6855#: lazarusidestrconsts.liscodetoolsdefscompilerpath 6856#, fuzzy 6857#| msgid "compiler path" 6858msgid "Compiler path" 6859msgstr "Pad naar compiler" 6860 6861#: lazarusidestrconsts.liscodetoolsdefsconvertnode 6862msgid "Convert node" 6863msgstr "Converteer node" 6864 6865#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory 6866#, object-pascal-format 6867msgid "Create Defines for %s Directory" 6868msgstr "Maak definities voor %s folder" 6869 6870#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler 6871msgid "Create Defines for Free Pascal Compiler" 6872msgstr "Maak definities voor Free Pascal Compiler" 6873 6874#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources 6875#, fuzzy 6876#| msgid "Create Defines for Free Pascal SVN Sources" 6877msgid "Create Defines for Free Pascal Git Sources" 6878msgstr "Maak definities voor Free Pascal SVN broncode" 6879 6880#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject 6881#, object-pascal-format 6882msgid "Create Defines for %s Project" 6883msgstr "Maak definities voor %s Project" 6884 6885#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory 6886msgid "Create FPC Macros and paths for a fpc project directory" 6887msgstr "Maak FPC-macro's en paden voor een fpc-projectfolder" 6888 6889#: lazarusidestrconsts.liscodetoolsdefsdefine 6890msgid "Define" 6891msgstr "Definieer" 6892 6893#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse 6894msgid "Define Recurse" 6895msgstr "Definieer recursief" 6896 6897#: lazarusidestrconsts.liscodetoolsdefsdeletenode 6898msgid "Delete node" 6899msgstr "Verwijder node" 6900 6901#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc 6902#, object-pascal-format 6903msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" 6904msgstr "The %s hoofddirectory,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld C:/Program Files/Borland/Delphi%s" 6905 6906#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject 6907#, object-pascal-format 6908msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" 6909msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: C:/Program Files/Borland/Delphi%s" 6910 6911#: lazarusidestrconsts.liscodetoolsdefsdescription 6912msgid "Description:" 6913msgstr "Beschrijving:" 6914 6915#: lazarusidestrconsts.liscodetoolsdefsdirectory 6916#, object-pascal-format 6917msgid "%s directory" 6918msgstr "%s directory" 6919 6920#: lazarusidestrconsts.liscodetoolsdefselse 6921msgid "Else" 6922msgstr "Else" 6923 6924#: lazarusidestrconsts.liscodetoolsdefselseif 6925msgid "ElseIf" 6926msgstr "ElseIf" 6927 6928#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave 6929msgid "Exit without Save" 6930msgstr "Verlaat zonder Opslaan" 6931 6932#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory 6933#, fuzzy 6934#| msgid "FPC SVN source directory" 6935msgid "FPC Git source directory" 6936msgstr "FPC SVN broncode directory" 6937 6938#: lazarusidestrconsts.liscodetoolsdefsif 6939msgid "If" 6940msgstr "If" 6941 6942#: lazarusidestrconsts.liscodetoolsdefsifdef 6943msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef" 6944msgid "IfDef" 6945msgstr "IfDef" 6946 6947#: lazarusidestrconsts.liscodetoolsdefsifndef 6948msgid "IfNDef" 6949msgstr "IfNDef" 6950 6951#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory 6952msgid "Directory" 6953msgstr "Folder" 6954 6955#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp 6956msgid "Insert Delphi 5 Compiler Template" 6957msgstr "Delphi 5 Compiler Template invoegen" 6958 6959#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem 6960msgid "Insert Delphi 5 Directory Template" 6961msgstr "Delphi 5 Directorie Template invoegen" 6962 6963#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl 6964msgid "Insert Delphi 5 Project Template" 6965msgstr "Delphi 5 Project Template invoegen" 6966 6967#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp 6968msgid "Insert Delphi 6 Compiler Template" 6969msgstr "Delphi 6 Compiler Template invoegen" 6970 6971#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem 6972msgid "Insert Delphi 6 Directory Template" 6973msgstr "Delphi 6 Directorie Template invoegen" 6974 6975#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl 6976msgid "Insert Delphi 6 Project Template" 6977msgstr "Delphi 6 Project Template invoegen" 6978 6979#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp 6980msgid "Insert Delphi 7 Compiler Template" 6981msgstr "Delphi 7 Compiler Template invoegen" 6982 6983#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem 6984msgid "Insert Delphi 7 Directory Template" 6985msgstr "Delphi 7 Directorie Template invoegen" 6986 6987#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl 6988msgid "Insert Delphi 7 Project Template" 6989msgstr "Delphi 7 Project Template invoegen" 6990 6991#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert 6992msgid "Insert Free Pascal Compiler Template" 6993msgstr "Invoegen FP Compiler Template" 6994 6995#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte 6996msgid "Insert Free Pascal Project Template" 6997msgstr "Invoegen FP project Template" 6998 6999#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource 7000#, fuzzy 7001#| msgid "Insert Free Pascal SVN Source Template" 7002msgid "Insert Free Pascal Git Source Template" 7003msgstr "Voeg Free Pascal SVN broncode template in" 7004 7005#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp 7006msgid "Insert Kylix 3 Compiler Template" 7007msgstr "Kylix 3 Compiler template invoegen" 7008 7009#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem 7010msgid "Insert Kylix 3 Directory Template" 7011msgstr "Kylix 3 Directorie template invoegen" 7012 7013#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl 7014msgid "Insert Kylix 3 Project Template" 7015msgstr "Kylix 3 Project template invoegen" 7016 7017#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild 7018msgid "Insert node as child" 7019msgstr "Node als \"child\" invoegen" 7020 7021#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow 7022msgid "Insert node below" 7023msgstr "Node onder invoegen" 7024 7025#: lazarusidestrconsts.liscodetoolsdefsinserttemplate 7026msgid "Insert Template" 7027msgstr "Invoegen Template" 7028 7029#: lazarusidestrconsts.liscodetoolsdefsinvalidparent 7030msgid "Invalid parent" 7031msgstr "Ongeldige parent" 7032 7033#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode 7034msgid "Invalid parent node" 7035msgstr "Ongeldige parent node" 7036 7037#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode 7038msgid "Invalid previous node" 7039msgstr "Vorige node is ongeldig" 7040 7041#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc 7042#, object-pascal-format 7043msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" 7044msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld: /home/user/kylis%s" 7045 7046#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject 7047#, object-pascal-format 7048msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" 7049msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: /home/user/kylis%s" 7050 7051#: lazarusidestrconsts.liscodetoolsdefsmovenodedown 7052msgid "Move node down" 7053msgstr "Verplaats node omlaag" 7054 7055#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown 7056msgid "Move node one level down" 7057msgstr "Verplaats node een level omlaag" 7058 7059#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup 7060msgid "Move node one level up" 7061msgstr "Verplaats node een level omhoog" 7062 7063#: lazarusidestrconsts.liscodetoolsdefsmovenodeup 7064msgid "Move node up" 7065msgstr "Verplaats node omhoog" 7066 7067#: lazarusidestrconsts.liscodetoolsdefsname 7068msgctxt "lazarusidestrconsts.liscodetoolsdefsname" 7069msgid "Name:" 7070msgstr "Naam:" 7071 7072#: lazarusidestrconsts.liscodetoolsdefsnewnode 7073msgid "NewNode" 7074msgstr "NieuweNode" 7075 7076#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly 7077msgid "Node is readonly" 7078msgstr "Node is niet wijzigbaar" 7079 7080#: lazarusidestrconsts.liscodetoolsdefsnoneselected 7081msgid "none selected" 7082msgstr "geen geselecteerd" 7083 7084#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch 7085#, fuzzy 7086#| msgid "Parent node can not contain child nodes." 7087msgid "Parent node cannot contain child nodes." 7088msgstr "Parent node kan geen child nodes bevatten." 7089 7090#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes 7091msgid "Previous node can not contain child nodes." 7092msgstr "Vorige node kan geen child nodes bevatten" 7093 7094#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory 7095#, fuzzy 7096msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory" 7097msgid "Project directory" 7098msgstr "Project directory" 7099 7100#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 7101#, object-pascal-format 7102msgid "%s project directory" 7103msgstr "%s projectdirectory" 7104 7105#: lazarusidestrconsts.liscodetoolsdefsreaderror 7106msgid "Read error" 7107msgstr "Leesfout" 7108 7109#: lazarusidestrconsts.liscodetoolsdefssaveandexit 7110msgid "Save and Exit" 7111msgstr "Opslaan en Afsluiten" 7112 7113#: lazarusidestrconsts.liscodetoolsdefsselectednode 7114msgid "Selected Node:" 7115msgstr "Geselecteerde node:" 7116 7117#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory 7118#, fuzzy 7119#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." 7120msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging." 7121msgstr "De Free Pascal SVN-broncode directory. Niet verplicht. Het verbetert het declaraties zoeken en debuggen." 7122 7123#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory 7124msgid "The Free Pascal project directory." 7125msgstr "De Free Pascal project directorie." 7126 7127#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir 7128#, fuzzy 7129#| msgid "The Free Pascal SVN source directory." 7130msgid "The Free Pascal Git source directory." 7131msgstr "De Free Pascal SVN-broncode directory." 7132 7133#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample 7134#, object-pascal-format, fuzzy 7135#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 7136msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 7137msgstr "Het pad naar de Free Pascal compiler.%s Bijv: %s/usr/bin/%s -n%s of %s/usr/local/bin/fpc @/etc/fpc.cfg%s." 7138 7139#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject 7140#, fuzzy 7141#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." 7142msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros." 7143msgstr "Het pad naar de free pascal compiler voor dit project. Alleen nodig als je de bron FPC SVN hieronder zet. Wordt gebuikt om automatisch macros te maken." 7144 7145#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa 7146#, object-pascal-format 7147msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros." 7148msgstr "" 7149 7150#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory 7151#, object-pascal-format 7152msgid "The %s project directory,%swhich contains the .dpr, dpk file." 7153msgstr "De %s project directorie,%swaar de .dpr, .dpk bestanden staan." 7154 7155#: lazarusidestrconsts.liscodetoolsdefsundefine 7156msgid "Undefine" 7157msgstr "Ondefinieer" 7158 7159#: lazarusidestrconsts.liscodetoolsdefsundefineall 7160msgid "Undefine All" 7161msgstr "Ondefinieer alles" 7162 7163#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse 7164msgid "Undefine Recurse" 7165msgstr "Ondefinieer recursie" 7166 7167#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths 7168msgid "Value as File Paths" 7169msgstr "" 7170 7171#: lazarusidestrconsts.liscodetoolsdefsvalueastext 7172msgid "Value as Text" 7173msgstr "Waarde als tekst" 7174 7175#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid 7176#, object-pascal-format 7177msgid "%s:%svalue \"%s\" is invalid." 7178msgstr "" 7179 7180#: lazarusidestrconsts.liscodetoolsdefsvariable 7181msgid "Variable:" 7182msgstr "Variabele:" 7183 7184#: lazarusidestrconsts.liscodetoolsdefswriteerror 7185msgid "Write error" 7186msgstr "Schrijffout" 7187 7188#: lazarusidestrconsts.liscodetoolsoptsat 7189msgid "At" 7190msgstr "Bij" 7191 7192#: lazarusidestrconsts.liscodetoolsoptsbracket 7193msgid "Bracket" 7194msgstr "" 7195 7196#: lazarusidestrconsts.liscodetoolsoptscaret 7197msgid "Caret (^)" 7198msgstr "" 7199 7200#: lazarusidestrconsts.liscodetoolsoptscolon 7201msgid "Colon" 7202msgstr "Dubbele punt" 7203 7204#: lazarusidestrconsts.liscodetoolsoptscomma 7205msgid "Comma" 7206msgstr "Komma" 7207 7208#: lazarusidestrconsts.liscodetoolsoptsidentifier 7209msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier" 7210msgid "Identifier" 7211msgstr "Identifier" 7212 7213#: lazarusidestrconsts.liscodetoolsoptskeyword 7214msgid "Keyword" 7215msgstr "Sleutelwoord" 7216 7217#: lazarusidestrconsts.liscodetoolsoptsnewline 7218msgid "Newline" 7219msgstr "Nieuwe regel" 7220 7221#: lazarusidestrconsts.liscodetoolsoptsnone 7222msgctxt "lazarusidestrconsts.liscodetoolsoptsnone" 7223msgid "None" 7224msgstr "Geen" 7225 7226#: lazarusidestrconsts.liscodetoolsoptsnumber 7227msgid "Number" 7228msgstr "Nummer" 7229 7230#: lazarusidestrconsts.liscodetoolsoptspoint 7231msgid "Point" 7232msgstr "Punt" 7233 7234#: lazarusidestrconsts.liscodetoolsoptssemicolon 7235msgid "Semicolon" 7236msgstr "Puntkomma" 7237 7238#: lazarusidestrconsts.liscodetoolsoptsspace 7239msgctxt "lazarusidestrconsts.liscodetoolsoptsspace" 7240msgid "Space" 7241msgstr "Spatie" 7242 7243#: lazarusidestrconsts.liscodetoolsoptsstringconst 7244msgid "String constant" 7245msgstr "String constante" 7246 7247#: lazarusidestrconsts.liscodetoolsoptssymbol 7248msgid "Symbol" 7249msgstr "Symbool" 7250 7251#: lazarusidestrconsts.liscoexecuteafter 7252msgid "Execute after" 7253msgstr "Voer uit Na" 7254 7255#: lazarusidestrconsts.liscoexecutebefore 7256msgid "Execute before" 7257msgstr "Voer uit Voor" 7258 7259#: lazarusidestrconsts.liscoladdress 7260msgid "Address" 7261msgstr "" 7262 7263#: lazarusidestrconsts.liscolclass 7264msgid "Class" 7265msgstr "" 7266 7267#: lazarusidestrconsts.liscollapseall 7268msgid "Collapse All (/)" 7269msgstr "" 7270 7271#: lazarusidestrconsts.liscollapseallclasses 7272msgid "Collapse all classes" 7273msgstr "" 7274 7275#: lazarusidestrconsts.liscollapseallpackages 7276msgid "Collapse all packages" 7277msgstr "" 7278 7279#: lazarusidestrconsts.liscollapseallunits 7280msgid "Collapse all units" 7281msgstr "" 7282 7283#: lazarusidestrconsts.liscolreturns 7284msgid "Returns" 7285msgstr "" 7286 7287#: lazarusidestrconsts.liscolvisibility 7288msgid "Visibility" 7289msgstr "" 7290 7291#: lazarusidestrconsts.liscomboboxes 7292msgid "Combo Boxes" 7293msgstr "" 7294 7295#: lazarusidestrconsts.liscommandlineparameters 7296msgctxt "lazarusidestrconsts.liscommandlineparameters" 7297msgid "Command line parameters" 7298msgstr "" 7299 7300#: lazarusidestrconsts.liscommandlineparamsofprogram 7301msgid "Command line parameters of program" 7302msgstr "Command line parameters van het programma" 7303 7304#: lazarusidestrconsts.liscompile 7305msgctxt "lazarusidestrconsts.liscompile" 7306msgid "Compile" 7307msgstr "Compileren" 7308 7309#: lazarusidestrconsts.liscompileanddonotaskagain 7310msgid "Compile and do not ask again" 7311msgstr "" 7312 7313#: lazarusidestrconsts.liscompilefollowingmodes 7314msgid "Compile the following modes" 7315msgstr "" 7316 7317#: lazarusidestrconsts.liscompileproject 7318msgid "Compile Project" 7319msgstr "" 7320 7321#: lazarusidestrconsts.liscompiler 7322msgid "Compiler" 7323msgstr "Compiler" 7324 7325#: lazarusidestrconsts.liscompilercfgismissing 7326#, object-pascal-format 7327msgid "%s is missing." 7328msgstr "" 7329 7330#: lazarusidestrconsts.liscompilerdoesnotsupporttarget 7331#, object-pascal-format 7332msgid "Compiler \"%s\" does not support target %s-%s" 7333msgstr "" 7334 7335#: lazarusidestrconsts.liscompilererrorinvalidcompiler 7336#, object-pascal-format 7337msgid "Error: invalid compiler: %s" 7338msgstr "Error: ongeldige compiler: %s" 7339 7340#: lazarusidestrconsts.liscompilerfilename 7341msgid "Compiler filename" 7342msgstr "Compilerbestandsnaam" 7343 7344#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath 7345#, fuzzy 7346#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" 7347msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path" 7348msgstr "Hint: u kunt het pad naar de compiler opgeven in Omgeving -> Omgevingsopties -> Bestanden -> Compiler Pad" 7349 7350#: lazarusidestrconsts.liscompilermessagesfilenotfound 7351#, object-pascal-format 7352msgid "Compiler messages file not found:%s%s" 7353msgstr "" 7354 7355#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults 7356msgid "NOTE: codetools config file not found - using defaults" 7357msgstr "Opmerking: Configuratie bestand voor code tools niet gevonden - de standaard wordt gebruikt" 7358 7359#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile 7360msgid "NOTE: loading old codetools options file: " 7361msgstr "Opmerking: Oude configuratie bestand voor code tools wordt geladen: " 7362 7363#: lazarusidestrconsts.liscompilestage 7364msgctxt "lazarusidestrconsts.liscompilestage" 7365msgid "Compile" 7366msgstr "Compileren" 7367 7368#: lazarusidestrconsts.liscompilewithprojectsettings 7369msgid "Compile with project settings" 7370msgstr "" 7371 7372#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates 7373msgid "Compile with -vd for more details. Check for duplicates." 7374msgstr "" 7375 7376#: lazarusidestrconsts.liscompiling 7377#, object-pascal-format 7378msgid "%s (compiling ...)" 7379msgstr "%s (compileren ...)" 7380 7381#: lazarusidestrconsts.liscompletionlonglinehinttype 7382msgid "Show long line hints" 7383msgstr "" 7384 7385#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft 7386msgid "Extend far left" 7387msgstr "" 7388 7389#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft 7390msgid "Extend some left" 7391msgstr "" 7392 7393#: lazarusidestrconsts.liscompletionlonglinehinttypenone 7394msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone" 7395msgid "Never" 7396msgstr "" 7397 7398#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly 7399msgid "Extend right only" 7400msgstr "" 7401 7402#: lazarusidestrconsts.liscomponentnameisapascalkeyword 7403#, object-pascal-format 7404msgid "Component name \"%s\" is a Pascal keyword." 7405msgstr "" 7406 7407#: lazarusidestrconsts.liscomponentnameiskeyword 7408#, object-pascal-format, fuzzy 7409#| msgid "Component name %s%s%s is keyword" 7410msgid "Component name \"%s\" is keyword" 7411msgstr "Componentnaam \"%s\" is sleutelwoord" 7412 7413#: lazarusidestrconsts.liscomponentnameisnotavalididentifier 7414#, object-pascal-format, fuzzy 7415#| msgid "Component name %s%s%s is not a valid identifier" 7416msgid "Component name \"%s\" is not a valid identifier" 7417msgstr "Component Naam \"%s\" is geen geldige identifier" 7418 7419#: lazarusidestrconsts.liscomppalcomponentlist 7420msgid "View All" 7421msgstr "" 7422 7423#: lazarusidestrconsts.liscomppalopenpackage 7424msgid "Open package" 7425msgstr "Open een Pakket" 7426 7427#: lazarusidestrconsts.liscomppalopenunit 7428msgid "Open unit" 7429msgstr "Open unit" 7430 7431#: lazarusidestrconsts.liscompress 7432msgid "Compress" 7433msgstr "" 7434 7435#: lazarusidestrconsts.liscompresshint 7436msgid "The resulting directory will be compressed into a ZIP file." 7437msgstr "" 7438 7439#: lazarusidestrconsts.liscomptest 7440#, fuzzy 7441#| msgid "Test" 7442msgctxt "lazarusidestrconsts.liscomptest" 7443msgid "&Test" 7444msgstr "Test" 7445 7446#: lazarusidestrconsts.liscondition 7447msgid "Condition" 7448msgstr "" 7449 7450#: lazarusidestrconsts.lisconditionals 7451msgctxt "lazarusidestrconsts.lisconditionals" 7452msgid "Conditionals" 7453msgstr "" 7454 7455#: lazarusidestrconsts.lisconfigdirectory 7456msgid "Lazarus config directory" 7457msgstr "Lazarus configuratie directorie" 7458 7459#: lazarusidestrconsts.lisconfigfileofadditions 7460msgid "Config file of additions:" 7461msgstr "" 7462 7463#: lazarusidestrconsts.lisconfigurebuild 7464#, object-pascal-format 7465msgid "Configure Build %s" 7466msgstr "" 7467 7468#: lazarusidestrconsts.lisconfigurebuildlazarus 7469msgid "Configure \"Build Lazarus\"" 7470msgstr "" 7471 7472#: lazarusidestrconsts.lisconfigureeditortoolbar 7473msgid "Configure Toolbar" 7474msgstr "" 7475 7476#: lazarusidestrconsts.lisconfigurelazaruside 7477msgid "Configure Lazarus IDE" 7478msgstr "" 7479 7480#: lazarusidestrconsts.lisconfirm 7481msgid "Confirm" 7482msgstr "" 7483 7484#: lazarusidestrconsts.lisconfirmation 7485msgid "Confirmation" 7486msgstr "" 7487 7488#: lazarusidestrconsts.lisconfirmbuildallprofiles 7489#, object-pascal-format 7490msgid "Lazarus will be rebuilt with the following profiles:%sContinue?" 7491msgstr "" 7492 7493#: lazarusidestrconsts.lisconfirmchanges 7494msgid "Confirm changes" 7495msgstr "Bevestig wijzigingen" 7496 7497#: lazarusidestrconsts.lisconfirmdelete 7498msgid "Confirm delete" 7499msgstr "" 7500 7501#: lazarusidestrconsts.lisconfirmlazarusrebuild 7502#, object-pascal-format, fuzzy 7503#| msgid "Do you want to rebuild Lazarus with profile: %s ?" 7504msgid "Do you want to rebuild Lazarus with profile: %s?" 7505msgstr "Wil je Lazarus opnieuw bouwen met profiel: %s?" 7506 7507#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide 7508msgid "Confirm new package set for the IDE" 7509msgstr "" 7510 7511#: lazarusidestrconsts.lisconfirmpackageaction 7512msgctxt "lazarusidestrconsts.lisconfirmpackageaction" 7513msgid "Action" 7514msgstr "" 7515 7516#: lazarusidestrconsts.lisconfirmpackagenewpackageset 7517msgid "New package set" 7518msgstr "" 7519 7520#: lazarusidestrconsts.lisconfirmpackageoldpackageset 7521msgid "Old package set" 7522msgstr "" 7523 7524#: lazarusidestrconsts.lisconflict 7525msgid "Conflict" 7526msgstr "" 7527 7528#: lazarusidestrconsts.lisconflictdetected 7529msgid "Conflict detected" 7530msgstr "" 7531 7532#: lazarusidestrconsts.lisconsoleapplication 7533msgid "Console application" 7534msgstr "" 7535 7536#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor 7537msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc." 7538msgstr "" 7539 7540#: lazarusidestrconsts.lisconstructorcode 7541msgid "Constructor code" 7542msgstr "" 7543 7544#: lazarusidestrconsts.liscontains 7545msgid "contains" 7546msgstr "bevat" 7547 7548#: lazarusidestrconsts.liscontents 7549#, fuzzy 7550msgctxt "lazarusidestrconsts.liscontents" 7551msgid "Contents" 7552msgstr "Inhoud" 7553 7554#: lazarusidestrconsts.liscontextsensitive 7555msgid "Context sensitive" 7556msgstr "" 7557 7558#: lazarusidestrconsts.liscontinue 7559msgctxt "lazarusidestrconsts.liscontinue" 7560msgid "Continue" 7561msgstr "Doorgaan" 7562 7563#: lazarusidestrconsts.liscontinueanddonotaskagain 7564msgid "Continue and do not ask again" 7565msgstr "" 7566 7567#: lazarusidestrconsts.liscontinuebuilding 7568msgid "Continue building" 7569msgstr "" 7570 7571#: lazarusidestrconsts.liscontinuewithoutloadingform 7572msgid "Continue without loading form" 7573msgstr "Doorgaan zonder het form te laden" 7574 7575#: lazarusidestrconsts.liscontributors 7576msgid "Contributors" 7577msgstr "Medewerkers" 7578 7579#: lazarusidestrconsts.liscontrolneedsparent 7580msgid "Control needs parent" 7581msgstr "Parent vereist voor control" 7582 7583#: lazarusidestrconsts.lisconvaddcommentafterreplacement 7584msgid "Add comment after replacement" 7585msgstr "" 7586 7587#: lazarusidestrconsts.lisconvaddedmodedelphimodifier 7588msgid "Added MODE Delphi syntax modifier after unit name." 7589msgstr "" 7590 7591#: lazarusidestrconsts.lisconvaddingflagforregister 7592#, object-pascal-format 7593msgid "Adding flag for \"Register\" procedure in unit %s." 7594msgstr "" 7595 7596#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc 7597#, object-pascal-format 7598msgid "\")\" is missing from replacement function: %s" 7599msgstr "" 7600 7601#: lazarusidestrconsts.lisconvbracketnotfound 7602msgid "Bracket not found" 7603msgstr "" 7604 7605#: lazarusidestrconsts.lisconvconvertedfrom 7606#, object-pascal-format 7607msgid " { *Converted from %s* }" 7608msgstr "" 7609 7610#: lazarusidestrconsts.lisconvcoordhint 7611msgid "An offset is added to Top coordinate of controls inside visual containers" 7612msgstr "" 7613 7614#: lazarusidestrconsts.lisconvcoordoffs 7615msgid "Coordinate offsets" 7616msgstr "" 7617 7618#: lazarusidestrconsts.lisconvdeletedfile 7619#, object-pascal-format 7620msgid "Deleted file %s" 7621msgstr "" 7622 7623#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines 7624#, object-pascal-format 7625msgid "Added defines %s in custom options" 7626msgstr "" 7627 7628#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency 7629#, object-pascal-format 7630msgid "Added Package %s as a dependency." 7631msgstr "" 7632 7633#: lazarusidestrconsts.lisconvdelphiaddedunittousessection 7634#, object-pascal-format 7635msgid "Added unit \"%s\" to uses section." 7636msgstr "" 7637 7638#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned 7639msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned" 7640msgid "All sub-directories will be scanned for unit files" 7641msgstr "" 7642 7643#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed 7644msgid "BeginCodeTools failed!" 7645msgstr "" 7646 7647#: lazarusidestrconsts.lisconvdelphicategories 7648msgid "Categories:" 7649msgstr "" 7650 7651#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8 7652#, object-pascal-format 7653msgid "Changed encoding from %s to UTF-8" 7654msgstr "" 7655 7656#: lazarusidestrconsts.lisconvdelphiconversionaborted 7657msgid "Conversion Aborted." 7658msgstr "" 7659 7660#: lazarusidestrconsts.lisconvdelphiconversionready 7661msgid "Conversion Ready." 7662msgstr "" 7663 7664#: lazarusidestrconsts.lisconvdelphiconversiontook 7665#, object-pascal-format 7666msgid "Conversion took: %s" 7667msgstr "" 7668 7669#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage 7670msgid "Convert Delphi package" 7671msgstr "" 7672 7673#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject 7674msgid "Convert Delphi project" 7675msgstr "" 7676 7677#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit 7678msgid "Convert Delphi unit" 7679msgstr "" 7680 7681#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits 7682msgid "*** Converting unit files found during conversion ***" 7683msgstr "" 7684 7685#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits 7686msgid "*** Converting unit files belonging to project/package ***" 7687msgstr "" 7688 7689#: lazarusidestrconsts.lisconvdelphierror 7690#, object-pascal-format 7691msgid "Error=\"%s\"" 7692msgstr "" 7693 7694#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion 7695msgid "Exception happened during unit conversion. Continuing with form files of already converted units..." 7696msgstr "" 7697 7698#: lazarusidestrconsts.lisconvdelphifailedconvertingunit 7699msgid "Failed converting unit" 7700msgstr "" 7701 7702#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit 7703#, object-pascal-format 7704msgid "Failed to convert unit \"%s\"" 7705msgstr "" 7706 7707#: lazarusidestrconsts.lisconvdelphifixedunitcase 7708#, object-pascal-format 7709msgid "Fixed character case of unit \"%s\" to \"%s\"." 7710msgstr "" 7711 7712#: lazarusidestrconsts.lisconvdelphifoundallunitfiles 7713msgid "Found all unit files" 7714msgstr "" 7715 7716#: lazarusidestrconsts.lisconvdelphifunc 7717msgid "Delphi Function" 7718msgstr "" 7719 7720#: lazarusidestrconsts.lisconvdelphimissingincludefile 7721#, object-pascal-format 7722msgid "%s(%s,%s) missing include file" 7723msgstr "" 7724 7725#: lazarusidestrconsts.lisconvdelphiname 7726msgid "Delphi Name" 7727msgstr "" 7728 7729#: lazarusidestrconsts.lisconvdelphipackagenameexists 7730msgid "Package name exists" 7731msgstr "" 7732 7733#: lazarusidestrconsts.lisconvdelphipackagerequired 7734#, object-pascal-format 7735msgid "Package %s is required but not installed in Lazarus! Install it later." 7736msgstr "" 7737 7738#: lazarusidestrconsts.lisconvdelphiprojomittedunit 7739#, object-pascal-format 7740msgid "Omitted unit %s from project" 7741msgstr "" 7742 7743#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection 7744#, object-pascal-format 7745msgid "Removed unit \"%s\" from uses section." 7746msgstr "" 7747 7748#: lazarusidestrconsts.lisconvdelphirepairingformfiles 7749msgid "*** Fixing used units and Repairing form files ***" 7750msgstr "" 7751 7752#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection 7753#, object-pascal-format 7754msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection" 7755msgid "Replaced unit \"%s\" with \"%s\" in uses section." 7756msgstr "" 7757 7758#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa 7759#, object-pascal-format 7760msgid "There is already a package with the name \"%s\"%sPlease close this package first." 7761msgstr "" 7762 7763#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl 7764msgid "Unitname exists in LCL" 7765msgstr "" 7766 7767#: lazarusidestrconsts.lisconvdelphiunitstoreplacein 7768#, object-pascal-format 7769msgid "Units to replace in %s" 7770msgstr "" 7771 7772#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl 7773#, object-pascal-format 7774msgid "LCL already has a unit with name %s. Delete local file %s?" 7775msgstr "" 7776 7777#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet 7778msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages." 7779msgstr "" 7780 7781#: lazarusidestrconsts.lisconversionerror 7782msgid "Conversion error" 7783msgstr "Conversiefout" 7784 7785#: lazarusidestrconsts.lisconvert 7786msgid "Convert" 7787msgstr "" 7788 7789#: lazarusidestrconsts.lisconvertencoding 7790msgid "Convert Encoding" 7791msgstr "" 7792 7793#: lazarusidestrconsts.lisconvertencodingofprojectspackages 7794msgid "Convert encoding of projects/packages" 7795msgstr "" 7796 7797#: lazarusidestrconsts.lisconvertotherhint 7798msgid "Other options affecting the conversion" 7799msgstr "" 7800 7801#: lazarusidestrconsts.lisconvertprojectorpackage 7802msgid "Convert project or package" 7803msgstr "" 7804 7805#: lazarusidestrconsts.lisconverttarget 7806msgid "Target" 7807msgstr "" 7808 7809#: lazarusidestrconsts.lisconverttargetcrossplatform 7810msgid "Cross-platform" 7811msgstr "" 7812 7813#: lazarusidestrconsts.lisconverttargetcrossplatformhint 7814msgid "Cross-platform versus Windows-only" 7815msgstr "" 7816 7817#: lazarusidestrconsts.lisconverttargethint 7818msgid "Converter adds conditional compilation to support different targets" 7819msgstr "" 7820 7821#: lazarusidestrconsts.lisconverttargetsamedfmfile 7822msgid "Use the same DFM form file" 7823msgstr "" 7824 7825#: lazarusidestrconsts.lisconverttargetsamedfmfilehint 7826msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM" 7827msgstr "" 7828 7829#: lazarusidestrconsts.lisconverttargetsupportdelphi 7830msgid "Support Delphi" 7831msgstr "" 7832 7833#: lazarusidestrconsts.lisconverttargetsupportdelphihint 7834msgid "Use conditional compilation to support Delphi" 7835msgstr "" 7836 7837#: lazarusidestrconsts.lisconvfixedunitname 7838#, object-pascal-format 7839msgid "Fixed unit name from %s to %s." 7840msgstr "" 7841 7842#: lazarusidestrconsts.lisconvfuncreplacements 7843msgid "Function Replacements" 7844msgstr "" 7845 7846#: lazarusidestrconsts.lisconvfuncreplhint 7847msgctxt "lazarusidestrconsts.lisconvfuncreplhint" 7848msgid "Some Delphi functions can be replaced with LCL function" 7849msgstr "" 7850 7851#: lazarusidestrconsts.lisconvfuncstoreplace 7852msgid "Functions / procedures to replace" 7853msgstr "" 7854 7855#: lazarusidestrconsts.lisconvleftoff 7856msgid "Left offset" 7857msgstr "" 7858 7859#: lazarusidestrconsts.lisconvnewname 7860msgid "New Name" 7861msgstr "" 7862 7863#: lazarusidestrconsts.lisconvparentcontainer 7864msgid "Parent Container" 7865msgstr "" 7866 7867#: lazarusidestrconsts.lisconvproblemsfindingallunits 7868#, object-pascal-format 7869msgid "Problems when trying to find all units from project file %s" 7870msgstr "" 7871 7872#: lazarusidestrconsts.lisconvproblemsfixingincludefile 7873#, object-pascal-format 7874msgid "Problems when fixing include files in file %s" 7875msgstr "" 7876 7877#: lazarusidestrconsts.lisconvproblemsrepairingformfile 7878#, object-pascal-format 7879msgid "Problems when repairing form file %s" 7880msgstr "" 7881 7882#: lazarusidestrconsts.lisconvrepairingincludefiles 7883msgid "Repairing include files : " 7884msgstr "" 7885 7886#: lazarusidestrconsts.lisconvreplacedcall 7887#, object-pascal-format 7888msgid "Replaced call %s with %s" 7889msgstr "" 7890 7891#: lazarusidestrconsts.lisconvreplfuncparameternum 7892#, object-pascal-format 7893msgid "Replacement function parameter number should be >= 1: %s" 7894msgstr "" 7895 7896#: lazarusidestrconsts.lisconvshouldbefollowedbynumber 7897#, object-pascal-format 7898msgid "\"$\" should be followed by a number: %s" 7899msgstr "" 7900 7901#: lazarusidestrconsts.lisconvstoppedbecausethereispackage 7902msgid "Stopped because there already is a package with the same name" 7903msgstr "" 7904 7905#: lazarusidestrconsts.lisconvthislogwassaved 7906#, object-pascal-format 7907msgid "This log was saved to %s" 7908msgstr "" 7909 7910#: lazarusidestrconsts.lisconvtopoff 7911msgid "Top offset" 7912msgstr "" 7913 7914#: lazarusidestrconsts.lisconvtypereplacements 7915msgid "Type Replacements" 7916msgstr "" 7917 7918#: lazarusidestrconsts.lisconvtypereplhint 7919msgid "Unknown types in form file (DFM/LFM)" 7920msgstr "" 7921 7922#: lazarusidestrconsts.lisconvtypestoreplace 7923msgid "Types to replace" 7924msgstr "" 7925 7926#: lazarusidestrconsts.lisconvunitreplacements 7927msgid "Unit Replacements" 7928msgstr "" 7929 7930#: lazarusidestrconsts.lisconvunitreplhint 7931msgid "Unit names in uses section of a source unit" 7932msgstr "" 7933 7934#: lazarusidestrconsts.lisconvunitstoreplace 7935msgid "Units to replace" 7936msgstr "" 7937 7938#: lazarusidestrconsts.lisconvunknownprops 7939msgid "Unknown properties" 7940msgstr "" 7941 7942#: lazarusidestrconsts.lisconvuserselectedtoendconversion 7943#, object-pascal-format 7944msgid "User selected to end conversion with file %s" 7945msgstr "" 7946 7947#: lazarusidestrconsts.liscoolbaraddconfigdelete 7948msgid "Add/Config/Delete Toolbar(s)" 7949msgstr "" 7950 7951#: lazarusidestrconsts.liscoolbaradddivider 7952msgid "Add Divider" 7953msgstr "" 7954 7955#: lazarusidestrconsts.liscoolbaraddselected 7956msgid "Add selected item to toolbar" 7957msgstr "" 7958 7959#: lazarusidestrconsts.liscoolbaravailablecommands 7960msgid "Available commands" 7961msgstr "" 7962 7963#: lazarusidestrconsts.liscoolbarborderstyle 7964msgid "Toolbars border style" 7965msgstr "" 7966 7967#: lazarusidestrconsts.liscoolbarborderstyleitem0 7968#, fuzzy 7969msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0" 7970msgid "None" 7971msgstr "Geen" 7972 7973#: lazarusidestrconsts.liscoolbarborderstyleitem1 7974msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1" 7975msgid "Single" 7976msgstr "" 7977 7978#: lazarusidestrconsts.liscoolbarcodeexplorer 7979#, fuzzy 7980msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer" 7981msgid "Code Explorer" 7982msgstr "Codeverkenner" 7983 7984#: lazarusidestrconsts.liscoolbarcodetemplates 7985#, fuzzy 7986#| msgid "Code templates" 7987msgctxt "lazarusidestrconsts.liscoolbarcodetemplates" 7988msgid "Code Templates" 7989msgstr "Broncode templates" 7990 7991#: lazarusidestrconsts.liscoolbarconfigure 7992msgid "&Configure" 7993msgstr "" 7994 7995#: lazarusidestrconsts.liscoolbardeletetoolbar 7996msgid "Are you sure you want to delete the selected toolbar?" 7997msgstr "" 7998 7999#: lazarusidestrconsts.liscoolbardeletewarning 8000msgid "There must be at least one toolbar!" 8001msgstr "" 8002 8003#: lazarusidestrconsts.liscoolbardesigner 8004msgid "Designer" 8005msgstr "" 8006 8007#: lazarusidestrconsts.liscoolbargeneralsettings 8008msgid "General Coolbar Settings" 8009msgstr "" 8010 8011#: lazarusidestrconsts.liscoolbargrabstyle 8012msgid "Toolbars grab style" 8013msgstr "" 8014 8015#: lazarusidestrconsts.liscoolbargrabstyleitem0 8016msgid "Simple" 8017msgstr "" 8018 8019#: lazarusidestrconsts.liscoolbargrabstyleitem1 8020msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1" 8021msgid "Double" 8022msgstr "" 8023 8024#: lazarusidestrconsts.liscoolbargrabstyleitem2 8025msgid "HorLines" 8026msgstr "" 8027 8028#: lazarusidestrconsts.liscoolbargrabstyleitem3 8029msgid "VerLines" 8030msgstr "" 8031 8032#: lazarusidestrconsts.liscoolbargrabstyleitem4 8033msgid "Gripper" 8034msgstr "" 8035 8036#: lazarusidestrconsts.liscoolbargrabstyleitem5 8037msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5" 8038msgid "Button" 8039msgstr "" 8040 8041#: lazarusidestrconsts.liscoolbargrabwidth 8042msgid "Grab width" 8043msgstr "" 8044 8045#: lazarusidestrconsts.liscoolbaridemainmenu 8046msgid "IDE Main Menu" 8047msgstr "" 8048 8049#: lazarusidestrconsts.liscoolbarmessages 8050#, fuzzy 8051msgctxt "lazarusidestrconsts.liscoolbarmessages" 8052msgid "Messages" 8053msgstr "Berichten" 8054 8055#: lazarusidestrconsts.liscoolbarmoveselecteddown 8056msgid "Move selected toolbar item down" 8057msgstr "" 8058 8059#: lazarusidestrconsts.liscoolbarmoveselectedup 8060msgid "Move selected toolbar item up" 8061msgstr "" 8062 8063#: lazarusidestrconsts.liscoolbaroptions 8064msgid "IDE CoolBar" 8065msgstr "" 8066 8067#: lazarusidestrconsts.liscoolbarpackageeditor 8068msgid "Package Editor" 8069msgstr "" 8070 8071#: lazarusidestrconsts.liscoolbarpackageeditorfiles 8072msgid "Package Editor Files" 8073msgstr "" 8074 8075#: lazarusidestrconsts.liscoolbarremoveselected 8076msgid "Remove selected item from toolbar" 8077msgstr "" 8078 8079#: lazarusidestrconsts.liscoolbarrestoredefaults 8080msgid "Restore defaults" 8081msgstr "" 8082 8083#: lazarusidestrconsts.liscoolbarselecttoolbar 8084msgid "Please select a toolbar first!" 8085msgstr "" 8086 8087#: lazarusidestrconsts.liscoolbarsourceeditor 8088#, fuzzy 8089msgctxt "lazarusidestrconsts.liscoolbarsourceeditor" 8090msgid "Source Editor" 8091msgstr "Broncode Bewerker" 8092 8093#: lazarusidestrconsts.liscoolbarsourcetab 8094msgid "Source Tab" 8095msgstr "" 8096 8097#: lazarusidestrconsts.liscoolbartoolbarcommands 8098msgid "Toolbar commands" 8099msgstr "" 8100 8101#: lazarusidestrconsts.liscoolbarvisible 8102msgid "Coolbar is &visible" 8103msgstr "" 8104 8105#: lazarusidestrconsts.liscoolbarwidth 8106msgid "Coolbar width" 8107msgstr "" 8108 8109#: lazarusidestrconsts.liscopy 8110msgctxt "lazarusidestrconsts.liscopy" 8111msgid "Copy" 8112msgstr "Kopiëren" 8113 8114#: lazarusidestrconsts.liscopyall 8115msgid "Copy All" 8116msgstr "" 8117 8118#: lazarusidestrconsts.liscopyallitemstoclipboard 8119msgid "Copy All Items to Clipboard" 8120msgstr "" 8121 8122#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard 8123msgid "Copy All/Original Messages to Clipboard" 8124msgstr "" 8125 8126#: lazarusidestrconsts.liscopyalloutputclipboard 8127msgid "Copy all output to clipboard" 8128msgstr "" 8129 8130#: lazarusidestrconsts.liscopyallshownmessagestoclipboard 8131msgid "Copy All Shown Messages to Clipboard" 8132msgstr "" 8133 8134#: lazarusidestrconsts.liscopydescription 8135msgid "Copy description to clipboard" 8136msgstr "" 8137 8138#: lazarusidestrconsts.liscopyerror 8139msgid "Copy Error" 8140msgstr "Kopieerfout" 8141 8142#: lazarusidestrconsts.liscopyerror2 8143msgid "Copy error" 8144msgstr "Kopieerfout" 8145 8146#: lazarusidestrconsts.liscopyfilename 8147#, object-pascal-format 8148msgid "Copy Filename %s" 8149msgstr "" 8150 8151#: lazarusidestrconsts.liscopyfilenametoclipboard 8152msgid "Copy File Name to Clipboard" 8153msgstr "" 8154 8155#: lazarusidestrconsts.liscopyfilesfailed 8156msgid "Copying files failed." 8157msgstr "" 8158 8159#: lazarusidestrconsts.liscopyidentifier 8160#, object-pascal-format 8161msgid "Copy \"%s\" to clipboard" 8162msgstr "" 8163 8164#: lazarusidestrconsts.liscopyingawholeformisnotimplemented 8165msgid "Copying a whole form is not implemented." 8166msgstr "Een geheel formulier kopiëren is niet geimplementeerd." 8167 8168#: lazarusidestrconsts.liscopyitemtoclipboard 8169msgid "Copy Item to Clipboard" 8170msgstr "" 8171 8172#: lazarusidestrconsts.liscopymovefiletodirectory 8173msgid "Copy/Move File to Directory" 8174msgstr "" 8175 8176#: lazarusidestrconsts.liscopyselecteditemtoclipboard 8177msgid "Copy Selected Items to Clipboard" 8178msgstr "" 8179 8180#: lazarusidestrconsts.liscopyselectedmessagestoclipboard 8181#, fuzzy 8182#| msgid "Copy selected messages to clipboard" 8183msgid "Copy Selected Messages to Clipboard" 8184msgstr "Kopieer de geselecteerde boodschap naar het klembord" 8185 8186#: lazarusidestrconsts.liscoscanforfpcmessages 8187msgid "Scan for FPC messages" 8188msgstr "Zoek naar FPC meldingen" 8189 8190#: lazarusidestrconsts.liscoscanformakemessages 8191msgid "Scan for Make messages" 8192msgstr "Zoek naar Make meldingen" 8193 8194#: lazarusidestrconsts.liscoscanformessages 8195msgid "Scan for messages:" 8196msgstr "" 8197 8198#: lazarusidestrconsts.liscoskipcallingcompiler 8199#, fuzzy 8200#| msgid "Skip calling Compiler" 8201msgid "Skip calling compiler" 8202msgstr "Sla compiler aanroep over" 8203 8204#: lazarusidestrconsts.liscouldnotadditomainsource 8205#, object-pascal-format 8206msgid "Could not add \"{$I %s}\" to main source!" 8207msgstr "" 8208 8209#: lazarusidestrconsts.liscouldnotaddrtomainsource 8210#, object-pascal-format 8211msgid "Could not add \"{$R %s}\" to main source!" 8212msgstr "" 8213 8214#: lazarusidestrconsts.liscouldnotaddtomainsource 8215#, object-pascal-format 8216msgid "Could not add \"%s\" to main source!" 8217msgstr "" 8218 8219#: lazarusidestrconsts.liscouldnotremovefrommainsource 8220#, object-pascal-format 8221msgid "Could not remove \"%s\" from main source!" 8222msgstr "" 8223 8224#: lazarusidestrconsts.liscouldnotremoveifrommainsource 8225#, object-pascal-format 8226msgid "Could not remove \"{$I %s}\" from main source!" 8227msgstr "" 8228 8229#: lazarusidestrconsts.liscouldnotremoverfrommainsource 8230#, object-pascal-format 8231msgid "Could not remove \"{$R %s}\" from main source!" 8232msgstr "" 8233 8234#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena 8235#, fuzzy 8236#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." 8237msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." 8238msgstr "Waarschuwing: Het extra compiler configuratie bestand heeft dezelfde naam als een van de standaard configuratie bestanden waar de FreePascal compiler naar zoekt. Dit kan leiden tot het alleen verwerken van het extra configuratie bestand en het overslaan van de standaard configuraite." 8239 8240#: lazarusidestrconsts.liscpopenpackage 8241#, object-pascal-format 8242msgid "Open Package %s" 8243msgstr "Open Pakket %s" 8244 8245#: lazarusidestrconsts.liscpopenunit 8246#, object-pascal-format 8247msgid "Open Unit %s" 8248msgstr "Open unit %s" 8249 8250#: lazarusidestrconsts.liscpu 8251#, object-pascal-format 8252msgid ", CPU: %s" 8253msgstr "" 8254 8255#: lazarusidestrconsts.liscreateaprojectfirst 8256msgid "Create a project first!" 8257msgstr "Maak eerst een project!" 8258 8259#: lazarusidestrconsts.liscreatedebugandreleasemodes 8260msgid "Create Debug and Release modes" 8261msgstr "" 8262 8263#: lazarusidestrconsts.liscreatedirectory 8264msgid "Create directory?" 8265msgstr "" 8266 8267#: lazarusidestrconsts.liscreatefilter 8268msgid "Create Filter" 8269msgstr "" 8270 8271#: lazarusidestrconsts.liscreatefppkgconfig 8272msgid "Restore Fppkg configuration" 8273msgstr "" 8274 8275#: lazarusidestrconsts.liscreatefunction 8276msgid "Create function" 8277msgstr "" 8278 8279#: lazarusidestrconsts.liscreatehelpnode 8280msgid "Create Help node" 8281msgstr "" 8282 8283#: lazarusidestrconsts.liscreateit 8284msgid "Create it" 8285msgstr "" 8286 8287#: lazarusidestrconsts.liscreatelocalvariable 8288#, object-pascal-format 8289msgid "Create local variable \"%s\"" 8290msgstr "" 8291 8292#: lazarusidestrconsts.liscreatenewaddition 8293msgid "Create new addition" 8294msgstr "" 8295 8296#: lazarusidestrconsts.liscreatenewpackage 8297msgid "(Create new package)" 8298msgstr "" 8299 8300#: lazarusidestrconsts.liscreatenewpackagecomponent 8301msgid "Create new package component" 8302msgstr "" 8303 8304#: lazarusidestrconsts.liscreateproject 8305msgid "Create project" 8306msgstr "" 8307 8308#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile 8309msgid "Create/update .po file when saving a lfm file" 8310msgstr "" 8311 8312#: lazarusidestrconsts.liscreatingfileindexoffpcsources 8313#, object-pascal-format 8314msgid "Creating file index of FPC sources %s ..." 8315msgstr "" 8316 8317#: lazarusidestrconsts.liscsbottom 8318msgctxt "lazarusidestrconsts.liscsbottom" 8319msgid "Bottom" 8320msgstr "" 8321 8322#: lazarusidestrconsts.liscstop 8323msgctxt "lazarusidestrconsts.liscstop" 8324msgid "Top" 8325msgstr "" 8326 8327#: lazarusidestrconsts.lisctdefchoosedirectory 8328msgid "Choose Directory" 8329msgstr "Kies directory" 8330 8331#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues 8332msgid "CodeTools Directory Values" 8333msgstr "Codeerhulpmiddelen mappen instellingen" 8334 8335#: lazarusidestrconsts.lisctdefdefinetemplates 8336msgid "Define templates" 8337msgstr "Definieer templates" 8338 8339#: lazarusidestrconsts.lisctdefnovariableselected 8340msgid "<no variable selected>" 8341msgstr "<Geen variabele geselecteerd>" 8342 8343#: lazarusidestrconsts.lisctdefsopenpreview 8344msgid "Open Preview" 8345msgstr "Open voorbeeld" 8346 8347#: lazarusidestrconsts.lisctdefstools 8348msgid "Tools" 8349msgstr "Hulpmiddelen" 8350 8351#: lazarusidestrconsts.lisctdefvariable 8352#, object-pascal-format 8353msgid "Variable: %s" 8354msgstr "Variabele: %s" 8355 8356#: lazarusidestrconsts.lisctdefvariablename 8357msgid "Variable Name" 8358msgstr "Variabelenaam" 8359 8360#: lazarusidestrconsts.lisctdtemplates 8361msgid "Templates" 8362msgstr "Templates" 8363 8364#: lazarusidestrconsts.lisctoupdateallmethodsignatures 8365msgid "Update all method signatures" 8366msgstr "" 8367 8368#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures 8369msgid "Update multiple procedure signatures" 8370msgstr "" 8371 8372#: lazarusidestrconsts.lisctpleaseselectamacro 8373msgid "please select a macro" 8374msgstr "selecteer een macro" 8375 8376#: lazarusidestrconsts.lisctselectcodemacro 8377msgid "Select Code Macro" 8378msgstr "Selecteer Code Macro" 8379 8380#: lazarusidestrconsts.liscurrent 8381msgctxt "lazarusidestrconsts.liscurrent" 8382msgid "Current" 8383msgstr "" 8384 8385#: lazarusidestrconsts.liscurrentlclwidgetset 8386#, object-pascal-format 8387msgid "Current LCL widgetset: \"%s\"" 8388msgstr "" 8389 8390#: lazarusidestrconsts.liscurrentstate 8391msgid "Current state: " 8392msgstr "" 8393 8394#: lazarusidestrconsts.liscursorcolumnincurrenteditor 8395msgid "Cursor column in current editor" 8396msgstr "Cursor kolom in huidige editor" 8397 8398#: lazarusidestrconsts.liscursorrowincurrenteditor 8399msgid "Cursor row in current editor" 8400msgstr "Cursor rij in huidige editor" 8401 8402#: lazarusidestrconsts.liscustomopthint 8403msgid "These options are passed to the compiler after macros are replaced." 8404msgstr "" 8405 8406#: lazarusidestrconsts.liscustomoptions 8407msgid "custom options" 8408msgstr "aanpasbare opties" 8409 8410#: lazarusidestrconsts.liscustomoptions2 8411msgid "Custom options" 8412msgstr "Aanpasbare Opties" 8413 8414#: lazarusidestrconsts.liscustomoptions3 8415msgid "Custom Options" 8416msgstr "" 8417 8418#: lazarusidestrconsts.liscustomprogram 8419msgid "Custom Program" 8420msgstr "Aanpasbaar Programma" 8421 8422#: lazarusidestrconsts.liscustomprogramprogramdescriptor 8423msgid "A Custom Free Pascal program." 8424msgstr "" 8425 8426#: lazarusidestrconsts.liscut 8427msgctxt "lazarusidestrconsts.liscut" 8428msgid "Cut" 8429msgstr "Knippen" 8430 8431#: lazarusidestrconsts.lisdadattach 8432msgid "Attach" 8433msgstr "" 8434 8435#: lazarusidestrconsts.lisdadimagename 8436msgid "Image Name" 8437msgstr "" 8438 8439#: lazarusidestrconsts.lisdadpid 8440msgid "PID" 8441msgstr "" 8442 8443#: lazarusidestrconsts.lisdadrunningprocesses 8444msgid "Running Processes" 8445msgstr "" 8446 8447#: lazarusidestrconsts.lisdatamodule 8448msgid "Data Module" 8449msgstr "" 8450 8451#: lazarusidestrconsts.lisdate 8452msgid "Date" 8453msgstr "Datum" 8454 8455#: lazarusidestrconsts.lisdbgallitemdelete 8456msgctxt "lazarusidestrconsts.lisdbgallitemdelete" 8457msgid "Delete all" 8458msgstr "" 8459 8460#: lazarusidestrconsts.lisdbgallitemdeletehint 8461msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint" 8462msgid "Delete all" 8463msgstr "" 8464 8465#: lazarusidestrconsts.lisdbgallitemdisable 8466msgctxt "lazarusidestrconsts.lisdbgallitemdisable" 8467msgid "Disable all" 8468msgstr "" 8469 8470#: lazarusidestrconsts.lisdbgallitemdisablehint 8471msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint" 8472msgid "Disable all" 8473msgstr "" 8474 8475#: lazarusidestrconsts.lisdbgallitemenable 8476msgctxt "lazarusidestrconsts.lisdbgallitemenable" 8477msgid "Enable all" 8478msgstr "" 8479 8480#: lazarusidestrconsts.lisdbgallitemenablehint 8481msgctxt "lazarusidestrconsts.lisdbgallitemenablehint" 8482msgid "Enable all" 8483msgstr "" 8484 8485#: lazarusidestrconsts.lisdbgasmcopytoclipboard 8486msgid "Copy to Clipboard" 8487msgstr "" 8488 8489#: lazarusidestrconsts.lisdbgbreakpointpropertieshint 8490msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint" 8491msgid "Breakpoint Properties ..." 8492msgstr "" 8493 8494#: lazarusidestrconsts.lisdbgemexpression 8495msgid "&Expression:" 8496msgstr "" 8497 8498#: lazarusidestrconsts.lisdbgemnewvalue 8499msgid "&New value:" 8500msgstr "" 8501 8502#: lazarusidestrconsts.lisdbgemresult 8503msgid "&Result:" 8504msgstr "" 8505 8506#: lazarusidestrconsts.lisdbgenbreakpointevaluation 8507msgid "Breakpoint Evaluation" 8508msgstr "" 8509 8510#: lazarusidestrconsts.lisdbgenbreakpointhit 8511msgid "Breakpoint Hit" 8512msgstr "" 8513 8514#: lazarusidestrconsts.lisdbgenbreakpointmessage 8515msgid "Breakpoint Message" 8516msgstr "" 8517 8518#: lazarusidestrconsts.lisdbgenbreakpointstackdump 8519msgid "Breakpoint Stack Dump" 8520msgstr "" 8521 8522#: lazarusidestrconsts.lisdbgendefaultcolor 8523msgid "Default Color" 8524msgstr "" 8525 8526#: lazarusidestrconsts.lisdbgenexceptionraised 8527msgid "Exception Raised" 8528msgstr "" 8529 8530#: lazarusidestrconsts.lisdbgenmoduleload 8531msgid "Module Load" 8532msgstr "" 8533 8534#: lazarusidestrconsts.lisdbgenmoduleunload 8535msgid "Module Unload" 8536msgstr "" 8537 8538#: lazarusidestrconsts.lisdbgenoutputdebugstring 8539msgid "Output Debug String" 8540msgstr "" 8541 8542#: lazarusidestrconsts.lisdbgenprocessexit 8543msgid "Process Exit" 8544msgstr "" 8545 8546#: lazarusidestrconsts.lisdbgenprocessstart 8547msgid "Process Start" 8548msgstr "" 8549 8550#: lazarusidestrconsts.lisdbgenthreadexit 8551msgid "Thread Exit" 8552msgstr "" 8553 8554#: lazarusidestrconsts.lisdbgenthreadstart 8555msgid "Thread Start" 8556msgstr "" 8557 8558#: lazarusidestrconsts.lisdbgenwindowsmessageposted 8559msgid "Windows Message Posted" 8560msgstr "" 8561 8562#: lazarusidestrconsts.lisdbgenwindowsmessagesent 8563msgid "Windows Message Sent" 8564msgstr "" 8565 8566#: lazarusidestrconsts.lisdbgitemdeletehint 8567msgctxt "lazarusidestrconsts.lisdbgitemdeletehint" 8568msgid "Delete" 8569msgstr "Verwijder" 8570 8571#: lazarusidestrconsts.lisdbgitemdisable 8572msgctxt "lazarusidestrconsts.lisdbgitemdisable" 8573msgid "Disable" 8574msgstr "" 8575 8576#: lazarusidestrconsts.lisdbgitemdisablehint 8577msgctxt "lazarusidestrconsts.lisdbgitemdisablehint" 8578msgid "Disable" 8579msgstr "" 8580 8581#: lazarusidestrconsts.lisdbgitemenable 8582msgctxt "lazarusidestrconsts.lisdbgitemenable" 8583msgid "Enable" 8584msgstr "" 8585 8586#: lazarusidestrconsts.lisdbgitemenablehint 8587msgctxt "lazarusidestrconsts.lisdbgitemenablehint" 8588msgid "Enable" 8589msgstr "" 8590 8591#: lazarusidestrconsts.lisdbgmangnodebuggerspecified 8592msgid "No debugger specified" 8593msgstr "Geen debugger aangegeven" 8594 8595#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway 8596msgid "Set the breakpoint anyway" 8597msgstr "Zet toch een breekpunt" 8598 8599#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno 8600#, object-pascal-format, fuzzy 8601#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." 8602msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu." 8603msgstr "Er is geen debugger ingesteld.%sHet plaatsen van breakpoints heeft geen effect totdat je een debugger hebt aangegeven in de Debugger Instellingen in het menu." 8604 8605#: lazarusidestrconsts.lisdbgterminal 8606msgctxt "lazarusidestrconsts.lisdbgterminal" 8607msgid "Console In/Output" 8608msgstr "" 8609 8610#: lazarusidestrconsts.lisdbgwinpower 8611msgid "On/Off" 8612msgstr "" 8613 8614#: lazarusidestrconsts.lisdbgwinpowerhint 8615msgid "Disable/Enable updates for the entire window" 8616msgstr "" 8617 8618#: lazarusidestrconsts.lisdebug 8619#, fuzzy 8620msgctxt "lazarusidestrconsts.lisdebug" 8621msgid "Debug" 8622msgstr "Debug" 8623 8624#: lazarusidestrconsts.lisdebugger 8625msgctxt "lazarusidestrconsts.lisdebugger" 8626msgid "Debugger" 8627msgstr "" 8628 8629#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate 8630#, object-pascal-format 8631msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." 8632msgstr "Debugger error%sOeps, de debugger is gecrashed%sSla uw werk op!%sKies Stop, en hoop voor het beste!" 8633 8634#: lazarusidestrconsts.lisdebuggerfeedbackerror 8635msgid "Debugger Error" 8636msgstr "" 8637 8638#: lazarusidestrconsts.lisdebuggerfeedbackinformation 8639msgid "Debugger Information" 8640msgstr "" 8641 8642#: lazarusidestrconsts.lisdebuggerfeedbackwarning 8643msgid "Debugger Warning" 8644msgstr "" 8645 8646#: lazarusidestrconsts.lisdebuggerinvalid 8647msgid "Debugger invalid" 8648msgstr "Debugger ongeldig" 8649 8650#: lazarusidestrconsts.lisdebugging 8651#, object-pascal-format 8652msgid "%s (debugging ...)" 8653msgstr "%s (aan het debuggen ...)" 8654 8655#: lazarusidestrconsts.lisdebughintautotypecastclass 8656msgid "Automatic typecast for objects" 8657msgstr "" 8658 8659#: lazarusidestrconsts.lisdebugoptionsfrmaddexception 8660msgid "Add Exception" 8661msgstr "" 8662 8663#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath 8664msgid "Additional search path" 8665msgstr "Additioneel zoekpad" 8666 8667#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls 8668msgid "BETA: Allow function calls in watches (if supported by backend)" 8669msgstr "" 8670 8671#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm 8672msgid "Automatically close the assembler window, after source not found" 8673msgstr "" 8674 8675#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass 8676msgid "Automatically set \"use instance class type\" for new watches" 8677msgstr "" 8678 8679#: lazarusidestrconsts.lisdebugoptionsfrmbackend 8680msgid "Debugger backend" 8681msgstr "" 8682 8683#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint 8684msgid "Breakpoint" 8685msgstr "Breekpunt" 8686 8687#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun 8688msgid "Clear log on run" 8689msgstr "Maak schoon log on run" 8690 8691#: lazarusidestrconsts.lisdebugoptionsfrmdebugger 8692msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger" 8693msgid "Debugger" 8694msgstr "" 8695 8696#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend 8697msgid "Debugger Backend:" 8698msgstr "" 8699 8700#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions 8701msgid "Debugger general options" 8702msgstr "Algemene debugger opties" 8703 8704#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific 8705msgid "Debugger specific options (depends on type of debugger)" 8706msgstr "Specifieke opties debugger (hangt af van het type debugger)" 8707 8708#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname 8709msgid "Duplicate Exception name" 8710msgstr "" 8711 8712#: lazarusidestrconsts.lisdebugoptionsfrmeditclass 8713msgid "Change type" 8714msgstr "" 8715 8716#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn 8717msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type." 8718msgstr "" 8719 8720#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname 8721msgid "Enter the name of the exception" 8722msgstr "" 8723 8724#: lazarusidestrconsts.lisdebugoptionsfrmeventlog 8725msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog" 8726msgid "Event Log" 8727msgstr "" 8728 8729#: lazarusidestrconsts.lisdebugoptionsfrmhandledby 8730msgid "Handled by" 8731msgstr "" 8732 8733#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger 8734msgid "Handled by Debugger" 8735msgstr "" 8736 8737#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram 8738msgid "Handled by Program" 8739msgstr "" 8740 8741#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions 8742msgid "Ignore these exceptions" 8743msgstr "Negeer deze exceptions" 8744 8745#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions 8746msgid "Language Exceptions" 8747msgstr "Taal uitzonderingen" 8748 8749#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto 8750#, fuzzy 8751#| msgid "Limit linecount to" 8752msgid "Limit line count to" 8753msgstr "Beperk regeltelling tot" 8754 8755#: lazarusidestrconsts.lisdebugoptionsfrmmodule 8756msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule" 8757msgid "Module" 8758msgstr "" 8759 8760#: lazarusidestrconsts.lisdebugoptionsfrmname 8761#, fuzzy 8762msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname" 8763msgid "Name:" 8764msgstr "Naam:" 8765 8766#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions 8767msgid "Notify on Exceptions" 8768msgstr "" 8769 8770#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions 8771msgid "OS Exceptions" 8772msgstr "" 8773 8774#: lazarusidestrconsts.lisdebugoptionsfrmoutput 8775msgid "Output" 8776msgstr "" 8777 8778#: lazarusidestrconsts.lisdebugoptionsfrmprocess 8779msgid "Process" 8780msgstr "Proces" 8781 8782#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun 8783msgid "Reset Debugger after each run" 8784msgstr "" 8785 8786#: lazarusidestrconsts.lisdebugoptionsfrmresume 8787msgid "Resume" 8788msgstr "Hervat" 8789 8790#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled 8791msgid "Resume Handled" 8792msgstr "Ga verder" 8793 8794#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled 8795msgid "Resume Unhandled" 8796msgstr "Ga verder met overige" 8797 8798#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop 8799msgid "Show message on stop with Error (Exit-code <> 0)" 8800msgstr "" 8801 8802#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop 8803msgid "Show message on stop" 8804msgstr "Toon meldingen bij stoppen" 8805 8806#: lazarusidestrconsts.lisdebugoptionsfrmsignals 8807msgid "Signals" 8808msgstr "Signalen" 8809 8810#: lazarusidestrconsts.lisdebugoptionsfrmthread 8811msgid "Thread" 8812msgstr "Thread" 8813 8814#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke 8815#, object-pascal-format 8816msgid "Unknown Debugger backend \"%s\"" 8817msgstr "" 8818 8819#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors 8820msgid "Use event log colors" 8821msgstr "" 8822 8823#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger 8824msgid "-- Use IDE default Debugger --" 8825msgstr "" 8826 8827#: lazarusidestrconsts.lisdebugoptionsfrmwindows 8828msgid "Windows" 8829msgstr "" 8830 8831#: lazarusidestrconsts.lisdebugunabletoloadfile 8832msgid "Unable to load file" 8833msgstr "Kan het bestand niet laden" 8834 8835#: lazarusidestrconsts.lisdebugunabletoloadfile2 8836#, object-pascal-format, fuzzy 8837#| msgid "Unable to load file %s%s%s." 8838msgid "Unable to load file \"%s\"." 8839msgstr "Kan het bestand \"%s\" niet laden." 8840 8841#: lazarusidestrconsts.lisdecimal 8842msgctxt "lazarusidestrconsts.lisdecimal" 8843msgid "Decimal" 8844msgstr "" 8845 8846#: lazarusidestrconsts.lisdefault 8847msgctxt "lazarusidestrconsts.lisdefault" 8848msgid "Default" 8849msgstr "Standaard" 8850 8851#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl 8852msgid "Default class visibility section of new methods. For example code completion on OnShow:=" 8853msgstr "" 8854 8855#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse 8856msgid "The default is ComboBox with \"True\" and \"False\" selections" 8857msgstr "" 8858 8859#: lazarusidestrconsts.lisdefaultplaceholder 8860msgid "(default)" 8861msgstr "" 8862 8863#: lazarusidestrconsts.lisdefaultsectionofmethods 8864msgid "Default section of methods" 8865msgstr "" 8866 8867#: lazarusidestrconsts.lisdelayforcompletionbox 8868msgid "Delay for completion box" 8869msgstr "" 8870 8871#: lazarusidestrconsts.lisdelayforcompletionlonglinehint 8872msgid "Delay for long line hints in completion box" 8873msgstr "" 8874 8875#: lazarusidestrconsts.lisdelayforhints 8876msgid "Delay for hints" 8877msgstr "" 8878 8879#: lazarusidestrconsts.lisdelete 8880msgctxt "lazarusidestrconsts.lisdelete" 8881msgid "Delete" 8882msgstr "Verwijder" 8883 8884#: lazarusidestrconsts.lisdelete2 8885msgid "Delete?" 8886msgstr "" 8887 8888#: lazarusidestrconsts.lisdeleteaddition 8889#, object-pascal-format 8890msgid "Delete addition \"%s\"?" 8891msgstr "" 8892 8893#: lazarusidestrconsts.lisdeleteall 8894msgid "&Delete All" 8895msgstr "" 8896 8897#: lazarusidestrconsts.lisdeleteallbreakpoints 8898msgid "Delete all breakpoints?" 8899msgstr "" 8900 8901#: lazarusidestrconsts.lisdeleteallbreakpoints2 8902#, object-pascal-format 8903msgid "Delete all breakpoints in file \"%s\"?" 8904msgstr "" 8905 8906#: lazarusidestrconsts.lisdeleteallinsamesource 8907msgid "Delete All in same source" 8908msgstr "" 8909 8910#: lazarusidestrconsts.lisdeleteallselectedbreakpoints 8911msgid "Delete all selected breakpoints?" 8912msgstr "" 8913 8914#: lazarusidestrconsts.lisdeleteallthesefiles 8915msgid "Delete all these files?" 8916msgstr "Al deze bestanden verwijderen?" 8917 8918#: lazarusidestrconsts.lisdeleteambiguousfile 8919msgid "Delete ambiguous file?" 8920msgstr "Verwijder dubbelzinnig bestand?" 8921 8922#: lazarusidestrconsts.lisdeletebreakpoint 8923msgid "Delete Breakpoint" 8924msgstr "" 8925 8926#: lazarusidestrconsts.lisdeletebreakpointatline 8927#, object-pascal-format 8928msgid "Delete breakpoint at%s\"%s\" line %d?" 8929msgstr "" 8930 8931#: lazarusidestrconsts.lisdeletebreakpointforaddress 8932#, object-pascal-format 8933msgid "Delete breakpoint for address %s?" 8934msgstr "" 8935 8936#: lazarusidestrconsts.lisdeletebreakpointforwatch 8937#, object-pascal-format 8938msgid "Delete watchpoint for \"%s\"?" 8939msgstr "" 8940 8941#: lazarusidestrconsts.lisdeletefilefailed 8942msgid "Delete file failed" 8943msgstr "Verwijderen bestand mislukt" 8944 8945#: lazarusidestrconsts.lisdeletemacro 8946#, object-pascal-format 8947msgid "Delete macro \"%s\"?" 8948msgstr "" 8949 8950#: lazarusidestrconsts.lisdeletemode 8951#, object-pascal-format 8952msgid "Delete mode \"%s\"" 8953msgstr "" 8954 8955#: lazarusidestrconsts.lisdeleteoldfile 8956#, object-pascal-format, fuzzy 8957#| msgid "Delete old file %s%s%s?" 8958msgid "Delete old file \"%s\"?" 8959msgstr "Verwijder oud bestand \"%s\"?" 8960 8961#: lazarusidestrconsts.lisdeleteoldfile2 8962msgid "Delete old file?" 8963msgstr "" 8964 8965#: lazarusidestrconsts.lisdeleteselectedmacro 8966msgid "Delete selected macro?" 8967msgstr "" 8968 8969#: lazarusidestrconsts.lisdeletethisaddition 8970msgid "Delete this addition" 8971msgstr "" 8972 8973#: lazarusidestrconsts.lisdeletevalue 8974#, object-pascal-format 8975msgid "Delete value \"%s\"?" 8976msgstr "" 8977 8978#: lazarusidestrconsts.lisdeletevalue2 8979#, object-pascal-format 8980msgid "Delete value %s" 8981msgstr "" 8982 8983#: lazarusidestrconsts.lisdeletingoffilefailed 8984#, object-pascal-format, fuzzy 8985#| msgid "Deleting of file %s%s%s failed." 8986msgid "Deleting of file \"%s\" failed." 8987msgstr "Verwijderen van bestand \"%s\" mislukt." 8988 8989#: lazarusidestrconsts.lisdelimiterissemicolon 8990msgid "Delimiter is semicolon." 8991msgstr "" 8992 8993#: lazarusidestrconsts.lisdelphicompatibleresources 8994msgid "Delphi compatible resources. Recommended." 8995msgstr "" 8996 8997#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid 8998msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project." 8999msgstr "" 9000 9001#: lazarusidestrconsts.lisdesktops 9002msgid "Desktops ..." 9003msgstr "" 9004 9005#: lazarusidestrconsts.lisdestinationdirectory 9006msgid "Destination directory" 9007msgstr "Doeldirectorie" 9008 9009#: lazarusidestrconsts.lisdestructorcode 9010msgid "Destructor code" 9011msgstr "" 9012 9013#: lazarusidestrconsts.lisdiffdlgcaseinsensitive 9014msgid "Case Insensitive" 9015msgstr "Hoofd/kleine letter ongevoelig" 9016 9017#: lazarusidestrconsts.lisdiffdlgfile1 9018msgid "File1" 9019msgstr "" 9020 9021#: lazarusidestrconsts.lisdiffdlgfile2 9022msgid "File2" 9023msgstr "" 9024 9025#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd 9026msgid "Ignore if empty lines were added or removed" 9027msgstr "Negeer toevoegingen en verwijderingen van lege regels" 9028 9029#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe 9030msgid "Ignore difference in line ends (e.g. #10 = #13#10)" 9031msgstr "Negeer verschillen in regeleinden (bv. #10 = #13#10)" 9032 9033#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd 9034msgid "Ignore amount of space chars" 9035msgstr "Aantal te negeren spaties" 9036 9037#: lazarusidestrconsts.lisdiffdlgignorespaces 9038msgid "Ignore spaces (newline chars not included)" 9039msgstr "Negeer spaties (regelscheiding karakters niet meegeteld)" 9040 9041#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline 9042msgid "Ignore spaces at end of line" 9043msgstr "Negeer spaties aan regeleinde" 9044 9045#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline 9046msgid "Ignore spaces at start of line" 9047msgstr "Negeer spaties aan begin van regel" 9048 9049#: lazarusidestrconsts.lisdiffdlgonlyselection 9050msgid "Only selection" 9051msgstr "Alleen de selectie" 9052 9053#: lazarusidestrconsts.lisdiffdlgopendiffineditor 9054#, fuzzy 9055#| msgid "Open Diff in editor" 9056msgid "Open difference in editor" 9057msgstr "Toon verschillen in bewerker" 9058 9059#: lazarusidestrconsts.lisdifferentunitfoundatnewposition 9060#, object-pascal-format 9061msgid "different unit %s found at new position \"%s\"" 9062msgstr "" 9063 9064#: lazarusidestrconsts.lisdigits 9065msgid "Digits:" 9066msgstr "" 9067 9068#: lazarusidestrconsts.lisdirectives 9069msgid "Directives" 9070msgstr "" 9071 9072#: lazarusidestrconsts.lisdirectivesfornewunit 9073msgid "Directives for new unit" 9074msgstr "" 9075 9076#: lazarusidestrconsts.lisdirectories 9077msgid "Directories" 9078msgstr "" 9079 9080#: lazarusidestrconsts.lisdirectory 9081msgid "Directory: " 9082msgstr "" 9083 9084#: lazarusidestrconsts.lisdirectorynotfound 9085#, object-pascal-format 9086msgid "Directory \"%s\" not found." 9087msgstr "" 9088 9089#: lazarusidestrconsts.lisdirectorynotfound2 9090#, object-pascal-format 9091msgid "directory %s not found" 9092msgstr "" 9093 9094#: lazarusidestrconsts.lisdirectorynotwritable 9095msgid "Directory not writable" 9096msgstr "" 9097 9098#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles 9099msgid "Directory where the IDE puts the .po files" 9100msgstr "" 9101 9102#: lazarusidestrconsts.lisdisableallinsamesource 9103msgid "Disable All in same source" 9104msgstr "" 9105 9106#: lazarusidestrconsts.lisdisablebreakpoint 9107msgid "Disable Breakpoint" 9108msgstr "" 9109 9110#: lazarusidestrconsts.lisdisabled 9111msgctxt "lazarusidestrconsts.lisdisabled" 9112msgid "Disabled" 9113msgstr "" 9114 9115#: lazarusidestrconsts.lisdisablegroups 9116msgid "Disable Groups" 9117msgstr "" 9118 9119#: lazarusidestrconsts.lisdisablei18nforlfm 9120msgid "Disable I18N for LFM" 9121msgstr "" 9122 9123#: lazarusidestrconsts.lisdisableoptionxg 9124msgid "Disable Option -Xg?" 9125msgstr "" 9126 9127#: lazarusidestrconsts.lisdisableoptionxg2 9128msgid "Disable option -Xg" 9129msgstr "" 9130 9131#: lazarusidestrconsts.lisdisassassembler 9132msgctxt "lazarusidestrconsts.lisdisassassembler" 9133msgid "Assembler" 9134msgstr "" 9135 9136#: lazarusidestrconsts.lisdisassgotoaddredittexthint 9137msgid "($address)" 9138msgstr "" 9139 9140#: lazarusidestrconsts.lisdisassgotoaddress 9141msgctxt "lazarusidestrconsts.lisdisassgotoaddress" 9142msgid "Goto Address" 9143msgstr "" 9144 9145#: lazarusidestrconsts.lisdisassgotoaddresshint 9146msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint" 9147msgid "Goto Address" 9148msgstr "" 9149 9150#: lazarusidestrconsts.lisdisassgotocurrentaddress 9151msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress" 9152msgid "Goto Current Address" 9153msgstr "" 9154 9155#: lazarusidestrconsts.lisdisassgotocurrentaddresshint 9156msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint" 9157msgid "Goto Current Address" 9158msgstr "" 9159 9160#: lazarusidestrconsts.lisdiscardchanges 9161msgid "Discard changes" 9162msgstr "Wijzigingen verwerpen" 9163 9164#: lazarusidestrconsts.lisdiscardchangesall 9165msgid "Discard all changes" 9166msgstr "" 9167 9168#: lazarusidestrconsts.lisdiscardchangesandopenproject 9169msgid "Discard changes and open project" 9170msgstr "" 9171 9172#: lazarusidestrconsts.lisdiscardchangesandquit 9173msgid "Discard changes and quit" 9174msgstr "" 9175 9176#: lazarusidestrconsts.lisdiscardchangescreatenewproject 9177msgid "Discard changes, create new project" 9178msgstr "" 9179 9180#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff 9181msgid "Click on one of the above items to see the diff" 9182msgstr "Klik op een van de bovenstaande items om het verschil te zien" 9183 9184#: lazarusidestrconsts.lisdiskdifferrorreadingfile 9185#, object-pascal-format 9186msgid "Error reading file: %s" 9187msgstr "Fout bij lezen bestand: %s" 9188 9189#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges 9190msgid "Ignore all disk changes" 9191msgstr "" 9192 9193#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk 9194msgid "Reload checked files from disk" 9195msgstr "" 9196 9197#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk 9198msgid "Some files have changed on disk:" 9199msgstr "Bepaalde bestanden zijn gewijzigd op schijf:" 9200 9201#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges 9202msgid "Some files have local changes. Either local or external changes will be overwritten." 9203msgstr "" 9204 9205#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda 9206msgid "Distinguish big and small letters e.g. A and a" 9207msgstr "Maak onderscheid tussen hoofd- en kleine letters. Bijv. A en a" 9208 9209#: lazarusidestrconsts.lisdlgadd 9210#, fuzzy 9211#| msgid "Add..." 9212msgctxt "lazarusidestrconsts.lisdlgadd" 9213msgid "Add ..." 9214msgstr "Toevoegen ..." 9215 9216#: lazarusidestrconsts.lisdlgalloptions 9217msgid "All options ..." 9218msgstr "" 9219 9220#: lazarusidestrconsts.lisdlgchangeclass 9221msgid "Change Class ..." 9222msgstr "" 9223 9224#: lazarusidestrconsts.lisdlgdefines 9225msgid "Defines ..." 9226msgstr "" 9227 9228#: lazarusidestrconsts.lisdlgedit 9229#, fuzzy 9230#| msgid "Edit..." 9231msgctxt "lazarusidestrconsts.lisdlgedit" 9232msgid "Edit ..." 9233msgstr "Bewerken ..." 9234 9235#: lazarusidestrconsts.lisdlgexport 9236msgctxt "lazarusidestrconsts.lisdlgexport" 9237msgid "Export ..." 9238msgstr "Exporteer ..." 9239 9240#: lazarusidestrconsts.lisdlgimport 9241msgctxt "lazarusidestrconsts.lisdlgimport" 9242msgid "Import ..." 9243msgstr "" 9244 9245#: lazarusidestrconsts.lisdlgmore 9246msgctxt "lazarusidestrconsts.lisdlgmore" 9247msgid "More ..." 9248msgstr "" 9249 9250#: lazarusidestrconsts.lisdlgopen 9251msgctxt "lazarusidestrconsts.lisdlgopen" 9252msgid "Open ..." 9253msgstr "" 9254 9255#: lazarusidestrconsts.lisdlgsave 9256msgctxt "lazarusidestrconsts.lisdlgsave" 9257msgid "Save ..." 9258msgstr "Opslaan ..." 9259 9260#: lazarusidestrconsts.lisdoesnotexists 9261#, object-pascal-format 9262msgid "%s does not exist: %s" 9263msgstr "" 9264 9265#: lazarusidestrconsts.lisdonotchange 9266msgid "Do not change" 9267msgstr "" 9268 9269#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning 9270#, object-pascal-format 9271msgid "%sDo not check if another IDE instance is already running" 9272msgstr "" 9273 9274#: lazarusidestrconsts.lisdonotclosetheproject 9275msgid "Do not close the project" 9276msgstr "Sluit project niet" 9277 9278#: lazarusidestrconsts.lisdonotcompiledependencies 9279msgid "do not compile dependencies" 9280msgstr "" 9281 9282#: lazarusidestrconsts.lisdonotshowsplashscreen 9283msgid "Do not show splash screen" 9284msgstr "Splashscherm niet tonen" 9285 9286#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject 9287msgid "Do not show this dialog for this project" 9288msgstr "" 9289 9290#: lazarusidestrconsts.lisdonotshowthismessageagain 9291msgid "Do not show this message again" 9292msgstr "" 9293 9294#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild 9295msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured." 9296msgstr "" 9297 9298#: lazarusidestrconsts.lisdonwloadonlinepackages 9299#, object-pascal-format 9300msgid "" 9301"The following package(s) are not available locally: %s.\n" 9302"In order to install it, you must download them first. Download now?" 9303msgstr "" 9304 9305#: lazarusidestrconsts.lisdown 9306msgctxt "lazarusidestrconsts.lisdown" 9307msgid "Down" 9308msgstr "Omlaag" 9309 9310#: lazarusidestrconsts.lisdowngrade 9311msgid "Downgrade" 9312msgstr "" 9313 9314#: lazarusidestrconsts.lisdowngradeconfiguration 9315msgid "Downgrade configuration" 9316msgstr "" 9317 9318#: lazarusidestrconsts.lisdownload 9319msgid "Download" 9320msgstr "" 9321 9322#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject 9323msgid "Do you still want to create the new project?" 9324msgstr "" 9325 9326#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject 9327msgid "Do you still want to open another project?" 9328msgstr "" 9329 9330#: lazarusidestrconsts.lisdoyoustillwanttoquit 9331msgid "Do you still want to quit?" 9332msgstr "" 9333 9334#: lazarusidestrconsts.lisdrawgridlinesobjectinspector 9335msgid "Draw grid lines" 9336msgstr "" 9337 9338#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn 9339msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing." 9340msgstr "" 9341 9342#: lazarusidestrconsts.lisdropdowncount 9343msgid "Drop Down Count" 9344msgstr "" 9345 9346#: lazarusidestrconsts.lisdsgcopycomponents 9347msgid "Copy selected components to clipboard" 9348msgstr "Kopieer geselecteerde componenten naar klipbord" 9349 9350#: lazarusidestrconsts.lisdsgcutcomponents 9351msgid "Cut selected components to clipboard" 9352msgstr "Knip geselecteerde componenten naar klipbord" 9353 9354#: lazarusidestrconsts.lisdsgorderbackone 9355msgid "Move component one back" 9356msgstr "Verplaats component een terug" 9357 9358#: lazarusidestrconsts.lisdsgorderforwardone 9359msgid "Move component one forward" 9360msgstr "Verplaats component een vooruit" 9361 9362#: lazarusidestrconsts.lisdsgordermovetoback 9363msgid "Move component to back" 9364msgstr "Stuur component naar achteren" 9365 9366#: lazarusidestrconsts.lisdsgordermovetofront 9367msgid "Move component to front" 9368msgstr "Breng component naar voren" 9369 9370#: lazarusidestrconsts.lisdsgpastecomponents 9371msgid "Paste selected components from clipboard" 9372msgstr "Plak geselecteerde componenten van het klembord" 9373 9374#: lazarusidestrconsts.lisdsgselectparentcomponent 9375msgid "Select parent component" 9376msgstr "Selecteer het parent component" 9377 9378#: lazarusidestrconsts.lisdsgshownonvisualcomponents 9379msgid "Show nonvisual components" 9380msgstr "" 9381 9382#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents 9383msgid "Toggle showing nonvisual components" 9384msgstr "" 9385 9386#: lazarusidestrconsts.lisduplicate 9387msgid "Duplicate" 9388msgstr "" 9389 9390#: lazarusidestrconsts.lisduplicateentry 9391msgid "Duplicate entry" 9392msgstr "" 9393 9394#: lazarusidestrconsts.lisduplicatefilename 9395msgid "Duplicate File Name" 9396msgstr "" 9397 9398#: lazarusidestrconsts.lisduplicatefoundofvalue 9399#, object-pascal-format 9400msgid "Duplicate found of value \"%s\"." 9401msgstr "" 9402 9403#: lazarusidestrconsts.lisduplicatemodename 9404#, object-pascal-format 9405msgid "Mode \"%s\" is already present in the list." 9406msgstr "" 9407 9408#: lazarusidestrconsts.lisduplicatename 9409msgid "Duplicate Name" 9410msgstr "" 9411 9412#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe 9413#, object-pascal-format 9414msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s" 9415msgstr "" 9416 9417#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths 9418msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9419msgstr "" 9420 9421#: lazarusidestrconsts.lisduplicatesearchpath 9422msgid "Duplicate search path" 9423msgstr "" 9424 9425#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh 9426msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)." 9427msgstr "" 9428 9429#: lazarusidestrconsts.lisduplicateunit 9430msgid "Duplicate Unit" 9431msgstr "" 9432 9433#: lazarusidestrconsts.lisduplicateunitin 9434#, object-pascal-format 9435msgid "Duplicate unit \"%s\" in \"%s\"" 9436msgstr "" 9437 9438#: lazarusidestrconsts.lisdynpkgamounttoscrollin 9439msgid "Amount to scroll in" 9440msgstr "" 9441 9442#: lazarusidestrconsts.lisdynpkgamounttoscrollin2 9443msgid "Amount to scroll in (%)" 9444msgstr "" 9445 9446#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax 9447msgid "Amount to scroll in (Max)" 9448msgstr "" 9449 9450#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa 9451msgid "Auto Scroll on delete past left border" 9452msgstr "" 9453 9454#: lazarusidestrconsts.lisdynpkgautoscrollontypepast 9455msgid "Auto Scroll on type past right border" 9456msgstr "" 9457 9458#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw 9459msgid "Trigger on min chars (% of width)" 9460msgstr "" 9461 9462#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis 9463msgid "Trigger on min chars visible" 9464msgstr "" 9465 9466#: lazarusidestrconsts.lisedit 9467msgctxt "lazarusidestrconsts.lisedit" 9468msgid "Edit" 9469msgstr "Bewerken" 9470 9471#: lazarusidestrconsts.liseditadditionalhelpformessages 9472msgid "Edit additional help for messages" 9473msgstr "" 9474 9475#: lazarusidestrconsts.liseditcontexthelp 9476msgid "Edit context help" 9477msgstr "" 9478 9479#: lazarusidestrconsts.lisedithelp 9480msgid "Edit help" 9481msgstr "" 9482 9483#: lazarusidestrconsts.liseditkey 9484msgid "Edit Key" 9485msgstr "" 9486 9487#: lazarusidestrconsts.liseditorcolors 9488msgid "Editor Colors" 9489msgstr "" 9490 9491#: lazarusidestrconsts.liseditormacros 9492msgid "Editor Macros" 9493msgstr "" 9494 9495#: lazarusidestrconsts.liseditortoolbar 9496msgid "Editor ToolBar" 9497msgstr "" 9498 9499#: lazarusidestrconsts.liseditortoolbarsettings 9500msgid "Editor Toolbar Settings" 9501msgstr "" 9502 9503#: lazarusidestrconsts.liseditortoolbarvisible 9504msgid "Editor Toolbar is &visible" 9505msgstr "" 9506 9507#: lazarusidestrconsts.lisedoptsloadascheme 9508msgid "Load a scheme" 9509msgstr "" 9510 9511#: lazarusidestrconsts.lisedtdefallpackages 9512msgid "All packages" 9513msgstr "Alle pakketten" 9514 9515#: lazarusidestrconsts.lisedtdefcurrentproject 9516msgid "Current Project" 9517msgstr "Huidig project" 9518 9519#: lazarusidestrconsts.lisedtdefsallprojects 9520msgid "All projects" 9521msgstr "Alle projecten" 9522 9523#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi 9524msgid "set FPC mode to DELPHI" 9525msgstr "zet FPC DELPHI-mode aan" 9526 9527#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc 9528msgid "set FPC mode to FPC" 9529msgstr "" 9530 9531#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc 9532msgid "set FPC mode to GPC" 9533msgstr "zet FPC GPC-mode aan" 9534 9535#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas 9536msgid "set FPC mode to MacPas" 9537msgstr "" 9538 9539#: lazarusidestrconsts.lisedtdefsetfpcmodetotp 9540msgid "set FPC mode to TP" 9541msgstr "zet FPC TP-mode aan" 9542 9543#: lazarusidestrconsts.lisedtdefsetiocheckson 9544msgid "set IOCHECKS on" 9545msgstr "zet IO-controles aan" 9546 9547#: lazarusidestrconsts.lisedtdefsetoverflowcheckson 9548msgid "set OVERFLOWCHECKS on" 9549msgstr "zet OVERFLOW controles aan" 9550 9551#: lazarusidestrconsts.lisedtdefsetrangecheckson 9552msgid "set RANGECHECKS on" 9553msgstr "zet RANGE controles aam" 9554 9555#: lazarusidestrconsts.lisedtdefuseheaptrcunit 9556msgid "use HeapTrc unit" 9557msgstr "gebruik HeapTrc-unit" 9558 9559#: lazarusidestrconsts.lisedtdefuselineinfounit 9560msgid "use LineInfo unit" 9561msgstr "gebruik LineInfo-unit" 9562 9563#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename 9564msgid "A valid tool needs at least a title and a filename." 9565msgstr "Een geldige Tool heeft tenminste een titel en een bestandsnaam nodig." 9566 9567#: lazarusidestrconsts.lisedtexttooledittool 9568msgid "Edit Tool" 9569msgstr "Bewerk Tool" 9570 9571#: lazarusidestrconsts.lisedtexttoolkey 9572msgctxt "lazarusidestrconsts.lisedtexttoolkey" 9573msgid "Key" 9574msgstr "Toets" 9575 9576#: lazarusidestrconsts.lisedtexttoolmacros 9577msgctxt "lazarusidestrconsts.lisedtexttoolmacros" 9578msgid "Macros" 9579msgstr "Macros" 9580 9581#: lazarusidestrconsts.lisedtexttoolparameters 9582msgid "Parameters:" 9583msgstr "Parameters:" 9584 9585#: lazarusidestrconsts.lisedtexttoolprogramfilename 9586msgid "Program Filename:" 9587msgstr "Programma bestandsnaam:" 9588 9589#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages 9590#, fuzzy 9591#| msgid "Scan output for Free Pascal Compiler messages" 9592msgid "Scan output for FPC messages" 9593msgstr "Doorzoek output op Free Pascal Compiler meldingen" 9594 9595#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages 9596#, fuzzy 9597#| msgid "Scan output for make messages" 9598msgid "Scan output for \"make\" messages" 9599msgstr "Doorzoek outpput op make meldingen" 9600 9601#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired 9602msgid "Title and Filename required" 9603msgstr "Titel en bestandsnaam nodig" 9604 9605#: lazarusidestrconsts.lisedtexttoolworkingdirectory 9606msgid "Working Directory:" 9607msgstr "Werkdirectory:" 9608 9609#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit 9610msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")" 9611msgstr "" 9612 9613#: lazarusidestrconsts.lisemdall 9614msgctxt "lazarusidestrconsts.lisemdall" 9615msgid "All" 9616msgstr "" 9617 9618#: lazarusidestrconsts.lisemdemptymethods 9619msgctxt "lazarusidestrconsts.lisemdemptymethods" 9620msgid "Empty Methods" 9621msgstr "" 9622 9623#: lazarusidestrconsts.lisemdfoundemptymethods 9624msgid "Found empty methods:" 9625msgstr "" 9626 9627#: lazarusidestrconsts.lisemdnoclass 9628msgid "No class" 9629msgstr "" 9630 9631#: lazarusidestrconsts.lisemdnoclassat 9632#, object-pascal-format 9633msgid "No class at %s(%s,%s)" 9634msgstr "" 9635 9636#: lazarusidestrconsts.lisemdonlypublished 9637msgid "Only published" 9638msgstr "" 9639 9640#: lazarusidestrconsts.lisemdpublic 9641msgid "Public" 9642msgstr "" 9643 9644#: lazarusidestrconsts.lisemdpublished 9645msgid "Published" 9646msgstr "" 9647 9648#: lazarusidestrconsts.lisemdremovemethods 9649msgid "Remove methods" 9650msgstr "" 9651 9652#: lazarusidestrconsts.lisemdsearchintheseclasssections 9653msgid "Search in these class sections:" 9654msgstr "" 9655 9656#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause 9657#, object-pascal-format 9658msgid "Unable to show empty methods of the current class, because%s%s" 9659msgstr "" 9660 9661#: lazarusidestrconsts.lisempty 9662msgid "Empty" 9663msgstr "" 9664 9665#: lazarusidestrconsts.lisemptydestinationforpublishing 9666msgid "Destination directory for publishing is either a relative path or empty." 9667msgstr "" 9668 9669#: lazarusidestrconsts.lisenableall 9670msgid "&Enable All" 9671msgstr "" 9672 9673#: lazarusidestrconsts.lisenableallinsamesource 9674msgid "Enable All in same source" 9675msgstr "" 9676 9677#: lazarusidestrconsts.lisenablebreakpoint 9678msgid "Enable Breakpoint" 9679msgstr "" 9680 9681#: lazarusidestrconsts.lisenabled 9682msgctxt "lazarusidestrconsts.lisenabled" 9683msgid "Enabled" 9684msgstr "Ingeschakeld" 9685 9686#: lazarusidestrconsts.lisenabledonlyforpackages 9687msgid "Enabled only for packages." 9688msgstr "" 9689 9690#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage 9691#, object-pascal-format 9692msgid ". Enable flag \"Use Unit\" of unit %s in package %s" 9693msgstr "" 9694 9695#: lazarusidestrconsts.lisenablegroups 9696msgid "Enable Groups" 9697msgstr "" 9698 9699#: lazarusidestrconsts.lisenablei18nforlfm 9700msgid "Enable I18N for LFM" 9701msgstr "" 9702 9703#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport 9704msgid "Enable internationalization and translation support" 9705msgstr "" 9706 9707#: lazarusidestrconsts.lisenablemacros 9708msgid "Enable Macros" 9709msgstr "Schakel Macro's in" 9710 9711#: lazarusidestrconsts.lisenableoptiondwarf 9712msgid "Enable Dwarf 2 (-gw)?" 9713msgstr "" 9714 9715#: lazarusidestrconsts.lisenableoptiondwarf2 9716msgid "Enable Dwarf 2 (-gw)" 9717msgstr "" 9718 9719#: lazarusidestrconsts.lisenableoptiondwarf2sets 9720msgid "Enable Dwarf 2 with sets" 9721msgstr "" 9722 9723#: lazarusidestrconsts.lisenableoptiondwarf3 9724msgid "Enable Dwarf 3 (-gw3)" 9725msgstr "" 9726 9727#: lazarusidestrconsts.lisenableoptionxg 9728msgid "Enable Option -Xg?" 9729msgstr "" 9730 9731#: lazarusidestrconsts.lisenableoptionxg2 9732msgid "Enable option -Xg" 9733msgstr "" 9734 9735#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix 9736msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier" 9737msgstr "" 9738 9739#: lazarusidestrconsts.lisenclose 9740msgid "Enclose" 9741msgstr "Omsluit" 9742 9743#: lazarusidestrconsts.lisencloseinifdef 9744msgid "Enclose in $IFDEF" 9745msgstr "" 9746 9747#: lazarusidestrconsts.lisencodingnumberoffilesfailed 9748#, object-pascal-format 9749msgid "Number of files failed to convert: %d" 9750msgstr "" 9751 9752#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis 9753#, object-pascal-format 9754msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis" 9755msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s." 9756msgstr "" 9757 9758#: lazarusidestrconsts.lisendlessloopinmacros 9759msgid "Endless loop in macros" 9760msgstr "" 9761 9762#: lazarusidestrconsts.lisenternewnameformacros 9763#, object-pascal-format 9764msgid "Enter new name for Macro \"%s\"" 9765msgstr "" 9766 9767#: lazarusidestrconsts.lisenvironmentvariablenameasparameter 9768msgid "Environment variable, name as parameter" 9769msgstr "" 9770 9771#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound 9772msgid "Directory not found" 9773msgstr "Folder niet gevonden" 9774 9775#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename 9776msgid "Invalid debugger filename" 9777msgstr "Ongeldige debugger bestandsnaam" 9778 9779#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg 9780#, object-pascal-format 9781msgid "The debugger file \"%s\" is not an executable." 9782msgstr "Het debuggerbestand \"%s\" is niet uitvoerbaar." 9783 9784#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg 9785#, object-pascal-format 9786msgid "Test directory \"%s\" not found." 9787msgstr "Test directory \"%s\" niet gevonden." 9788 9789#: lazarusidestrconsts.liserrinvalidoption 9790#, object-pascal-format 9791msgid "Invalid option at position %d: \"%s\"" 9792msgstr "Ongeldige optie op positie %d: \"%s\"" 9793 9794#: lazarusidestrconsts.liserrnooptionallowed 9795#, object-pascal-format 9796msgid "Option at position %d does not allow an argument: %s" 9797msgstr "" 9798 9799#: lazarusidestrconsts.liserroptionneeded 9800#, object-pascal-format 9801msgid "Option at position %d needs an argument : %s" 9802msgstr "" 9803 9804#: lazarusidestrconsts.liserror 9805msgid "Error: " 9806msgstr "Fout:" 9807 9808#: lazarusidestrconsts.liserrorcreatingfile 9809msgid "Error creating file" 9810msgstr "Fout bij maken bestand" 9811 9812#: lazarusidestrconsts.liserrordeletingfile 9813msgid "Error deleting file" 9814msgstr "Fout bij verwijderen bestand" 9815 9816#: lazarusidestrconsts.liserrorin 9817#, object-pascal-format 9818msgid "Error in %s" 9819msgstr "Fout in %s" 9820 9821#: lazarusidestrconsts.liserrorinthecompilerfilename 9822msgid "Error in the compiler file name:" 9823msgstr "" 9824 9825#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother 9826msgid "Error in the custom compiler options (Other):" 9827msgstr "" 9828 9829#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol 9830msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):" 9831msgstr "" 9832 9833#: lazarusidestrconsts.liserrorinthedebuggerpathaddition 9834msgid "Error in the \"Debugger path addition\":" 9835msgstr "" 9836 9837#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles 9838msgid "Error in the search path for \"Include files\":" 9839msgstr "" 9840 9841#: lazarusidestrconsts.liserrorinthesearchpathforlibraries 9842msgid "Error in the search path for \"Libraries\":" 9843msgstr "" 9844 9845#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles 9846msgid "Error in the search path for \"Object files\":" 9847msgstr "" 9848 9849#: lazarusidestrconsts.liserrorinthesearchpathforothersources 9850msgid "Error in the search path for \"Other sources\":" 9851msgstr "" 9852 9853#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles 9854msgid "Error in the search path for \"Other unit files\":" 9855msgstr "" 9856 9857#: lazarusidestrconsts.liserrorintheunitoutputdirectory 9858msgid "Error in the \"unit output directory\":" 9859msgstr "" 9860 9861#: lazarusidestrconsts.liserrorinvalidbuildmode 9862#, object-pascal-format 9863msgid "Error: (lazarus) invalid build mode \"%s\"" 9864msgstr "" 9865 9866#: lazarusidestrconsts.liserrorloadingfile 9867msgid "Error loading file" 9868msgstr "" 9869 9870#: lazarusidestrconsts.liserrorloadingfile2 9871#, object-pascal-format 9872msgid "Error loading file \"%s\":" 9873msgstr "" 9874 9875#: lazarusidestrconsts.liserrorloadingfrom 9876#, object-pascal-format 9877msgid "Error loading %s from%s%s%s%s" 9878msgstr "" 9879 9880#: lazarusidestrconsts.liserrormovingcomponent 9881msgid "Error moving component" 9882msgstr "Fout bij verplaatsen component" 9883 9884#: lazarusidestrconsts.liserrormovingcomponent2 9885#, object-pascal-format 9886msgid "Error moving component %s:%s" 9887msgstr "Fout bij verplaatsen component %s;%s" 9888 9889#: lazarusidestrconsts.liserrornamingcomponent 9890msgid "Error naming component" 9891msgstr "" 9892 9893#: lazarusidestrconsts.liserroropeningcomponent 9894msgid "Error opening component" 9895msgstr "" 9896 9897#: lazarusidestrconsts.liserroropeningform 9898msgid "Error opening form" 9899msgstr "" 9900 9901#: lazarusidestrconsts.liserrorparsinglfmcomponentstream 9902msgid "Error parsing lfm component stream." 9903msgstr "Fout bij het verwerken van de lfm componenten stream." 9904 9905#: lazarusidestrconsts.liserrorreadingpackagelistfromfile 9906#, object-pascal-format 9907msgid "Error reading package list from file%s%s%s%s" 9908msgstr "Error bij lezen pakket lijst uit bestand%s%s%s%s" 9909 9910#: lazarusidestrconsts.liserrorreadingxml 9911msgid "Error reading XML" 9912msgstr "" 9913 9914#: lazarusidestrconsts.liserrorreadingxmlfile 9915#, object-pascal-format 9916msgid "Error reading xml file \"%s\"%s%s" 9917msgstr "" 9918 9919#: lazarusidestrconsts.liserrorrenamingfile 9920msgid "Error renaming file" 9921msgstr "Fout bij herbenoemen bestand" 9922 9923#: lazarusidestrconsts.liserrors 9924msgctxt "lazarusidestrconsts.liserrors" 9925msgid "Errors" 9926msgstr "Fouten" 9927 9928#: lazarusidestrconsts.liserrors2 9929#, object-pascal-format 9930msgid ", Errors: %s" 9931msgstr "" 9932 9933#: lazarusidestrconsts.liserrorsavingform 9934msgid "Error saving form" 9935msgstr "" 9936 9937#: lazarusidestrconsts.liserrorsavingto 9938#, object-pascal-format 9939msgid "Error saving %s to%s%s%s%s" 9940msgstr "" 9941 9942#: lazarusidestrconsts.liserrorsettingthenameofacomponentto 9943#, object-pascal-format 9944msgid "Error setting the name of a component %s to %s" 9945msgstr "" 9946 9947#: lazarusidestrconsts.liserrorwritingfile 9948#, object-pascal-format 9949msgid "Error writing file \"%s\"" 9950msgstr "" 9951 9952#: lazarusidestrconsts.liserrorwritingpackagelisttofile 9953#, object-pascal-format 9954msgid "Error writing package list to file%s%s%s%s" 9955msgstr "Error bij schrijven pakketlijst naar bestand%s%s%s%s" 9956 9957#: lazarusidestrconsts.lisevalexpression 9958msgctxt "lazarusidestrconsts.lisevalexpression" 9959msgid "Eval expression" 9960msgstr "" 9961 9962#: lazarusidestrconsts.lisevaluate 9963msgid "E&valuate" 9964msgstr "" 9965 9966#: lazarusidestrconsts.lisevaluateall 9967msgid "Evaluate all" 9968msgstr "" 9969 9970#: lazarusidestrconsts.lisevaluatemodify 9971msgid "&Evaluate/Modify" 9972msgstr "" 9973 9974#: lazarusidestrconsts.liseventlogclear 9975msgid "Clear Events" 9976msgstr "" 9977 9978#: lazarusidestrconsts.liseventlogoptions 9979msgid "Event Log Options ..." 9980msgstr "" 9981 9982#: lazarusidestrconsts.liseventlogsavetofile 9983msgid "Save Events to File" 9984msgstr "" 9985 9986#: lazarusidestrconsts.liseventslogaddcomment 9987msgid "Add Comment ..." 9988msgstr "" 9989 9990#: lazarusidestrconsts.liseventslogaddcomment2 9991msgid "Add Comment" 9992msgstr "" 9993 9994#: lazarusidestrconsts.liseverynthlinenumber 9995msgid "Every n-th line number" 9996msgstr "" 9997 9998#: lazarusidestrconsts.lisexamplefile 9999msgid "Example file:" 10000msgstr "" 10001 10002#: lazarusidestrconsts.lisexamplesbuildallselected 10003msgid "Build all selected" 10004msgstr "" 10005 10006#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac 10007#, object-pascal-format 10008msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" 10009msgstr "" 10010 10011#: lazarusidestrconsts.lisexamplesopenfirstselected 10012msgid "Open first selected" 10013msgstr "" 10014 10015#: lazarusidestrconsts.lisexceptiondialog 10016msgid "Debugger Exception Notification" 10017msgstr "" 10018 10019#: lazarusidestrconsts.lisexcludedatruntime 10020#, object-pascal-format 10021msgid "%s excluded at run time" 10022msgstr "" 10023 10024#: lazarusidestrconsts.lisexecutableisadirectory 10025#, object-pascal-format 10026msgid "executable \"%s\" is a directory" 10027msgstr "" 10028 10029#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun 10030#, object-pascal-format 10031msgid "executable \"%s\" lacks the permission to run" 10032msgstr "" 10033 10034#: lazarusidestrconsts.lisexecutingcommandafter 10035msgid "Executing command after" 10036msgstr "Voer het commando uit Na" 10037 10038#: lazarusidestrconsts.lisexecutingcommandbefore 10039msgid "Executing command before" 10040msgstr "Voer het commando uit Voor" 10041 10042#: lazarusidestrconsts.lisexecutionstopped 10043msgid "Execution stopped" 10044msgstr "Uitvoering afgebroken" 10045 10046#: lazarusidestrconsts.lisexecutionstoppedexitcode 10047#, object-pascal-format 10048msgid "Execution stopped with exit-code %1:d ($%2:s)" 10049msgstr "" 10050 10051#: lazarusidestrconsts.lisexit 10052msgctxt "lazarusidestrconsts.lisexit" 10053msgid "Exit" 10054msgstr "Verlaat" 10055 10056#: lazarusidestrconsts.lisexitcode 10057#, object-pascal-format 10058msgid "Exit code %s" 10059msgstr "" 10060 10061#: lazarusidestrconsts.lisexpandall 10062msgid "Expand All (*)" 10063msgstr "" 10064 10065#: lazarusidestrconsts.lisexpandallclasses 10066msgid "Expand all classes" 10067msgstr "" 10068 10069#: lazarusidestrconsts.lisexpandallpackages 10070msgid "Expand all packages" 10071msgstr "" 10072 10073#: lazarusidestrconsts.lisexpandallunits 10074msgid "Expand all units" 10075msgstr "" 10076 10077#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor 10078msgid "Expanded filename of current editor file" 10079msgstr "Volledige bestandsnaam van huidige editor bestand" 10080 10081#: lazarusidestrconsts.lisexport 10082#, fuzzy 10083#| msgid "Export ..." 10084msgctxt "lazarusidestrconsts.lisexport" 10085msgid "Export" 10086msgstr "Exporteer ..." 10087 10088#: lazarusidestrconsts.lisexportall 10089msgid "Export all" 10090msgstr "" 10091 10092#: lazarusidestrconsts.lisexportallitemstofile 10093msgid "Export All Items to File" 10094msgstr "" 10095 10096#: lazarusidestrconsts.lisexportenvironmentoptions 10097msgctxt "lazarusidestrconsts.lisexportenvironmentoptions" 10098msgid "Export environment options" 10099msgstr "" 10100 10101#: lazarusidestrconsts.lisexporthtml 10102msgid "Export as HTML" 10103msgstr "" 10104 10105#: lazarusidestrconsts.lisexportimport 10106msgid "Export / Import" 10107msgstr "" 10108 10109#: lazarusidestrconsts.lisexportlist 10110msgid "Export list" 10111msgstr "Export lijst" 10112 10113#: lazarusidestrconsts.lisexportpackagelistxml 10114msgid "Export package list (*.xml)" 10115msgstr "" 10116 10117#: lazarusidestrconsts.lisexportselected 10118msgid "Export selected" 10119msgstr "" 10120 10121#: lazarusidestrconsts.lisexportsub 10122msgid "Export >>" 10123msgstr "" 10124 10125#: lazarusidestrconsts.lisexpression 10126msgid "Expression:" 10127msgstr "" 10128 10129#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith 10130#, object-pascal-format 10131msgid "Extend include file search path of package \"%s\" with%s\"%s\"?" 10132msgstr "" 10133 10134#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith 10135#, object-pascal-format 10136msgid "Extend include files search path of project with%s\"%s\"?" 10137msgstr "" 10138 10139#: lazarusidestrconsts.lisextendincludepath 10140msgid "Extend include path?" 10141msgstr "" 10142 10143#: lazarusidestrconsts.lisextendunitpath 10144msgid "Extend unit path?" 10145msgstr "Unit path uitbreiden?" 10146 10147#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith 10148#, object-pascal-format 10149msgid "Extend unit search path of package \"%s\" with%s\"%s\"?" 10150msgstr "" 10151 10152#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith 10153#, object-pascal-format 10154msgid "Extend unit search path of project with%s\"%s\"?" 10155msgstr "" 10156 10157#: lazarusidestrconsts.lisextract 10158msgid "Extract" 10159msgstr "Destilleer" 10160 10161#: lazarusidestrconsts.lisextractprocedure 10162#, fuzzy 10163#| msgid "Extract procedure" 10164msgctxt "lazarusidestrconsts.lisextractprocedure" 10165msgid "Extract Procedure" 10166msgstr "Destilleer procedure" 10167 10168#: lazarusidestrconsts.lisextremelyverbose 10169msgid "Extremely Verbose" 10170msgstr "" 10171 10172#: lazarusidestrconsts.lisexttoolexternaltools 10173#, fuzzy 10174#| msgid "External tools" 10175msgid "External Tools" 10176msgstr "Externe gereedschappen" 10177 10178#: lazarusidestrconsts.lisexttoolmaximumtoolsreached 10179msgid "Maximum Tools reached" 10180msgstr "Maximum aantal Hulpmiddelen bereikt" 10181 10182#: lazarusidestrconsts.lisexttoolthereisamaximumoftools 10183#, object-pascal-format 10184msgid "There is a maximum of %s tools." 10185msgstr "Er is een maximum van %s hulpmiddelen" 10186 10187#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources 10188#, object-pascal-format 10189msgid "Failed to add %d not unique resource(s)" 10190msgstr "" 10191 10192#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor 10193#, object-pascal-format 10194msgid "Failed to create Application Bundle for \"%s\"" 10195msgstr "" 10196 10197#: lazarusidestrconsts.lisfailedtoloadfoldstat 10198msgid "Failed to load fold state" 10199msgstr "" 10200 10201#: lazarusidestrconsts.lisfailedtoresolvemacros 10202msgid "failed to resolve macros" 10203msgstr "" 10204 10205#: lazarusidestrconsts.lisfailedtosavefile 10206msgid "Failed to save file." 10207msgstr "" 10208 10209#: lazarusidestrconsts.lisfatal 10210msgctxt "lazarusidestrconsts.lisfatal" 10211msgid "Fatal" 10212msgstr "" 10213 10214#: lazarusidestrconsts.lisfile 10215msgctxt "lazarusidestrconsts.lisfile" 10216msgid "File" 10217msgstr "Bestand" 10218 10219#: lazarusidestrconsts.lisfile2 10220msgid "File: " 10221msgstr "" 10222 10223#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway 10224#, object-pascal-format, fuzzy 10225#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" 10226msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway" 10227msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?" 10228msgstr "Bestand \"%s\"%slijkt niet op een tekst bestand.%sToch openen?" 10229 10230#: lazarusidestrconsts.lisfileextensionofprograms 10231msgid "File extension of programs" 10232msgstr "" 10233 10234#: lazarusidestrconsts.lisfilefilter 10235msgid "File filter" 10236msgstr "" 10237 10238#: lazarusidestrconsts.lisfilefilters 10239msgid "File Filters" 10240msgstr "" 10241 10242#: lazarusidestrconsts.lisfilefiltersaddrow 10243msgid "Add Row" 10244msgstr "" 10245 10246#: lazarusidestrconsts.lisfilefiltersdeleterow 10247msgid "Delete Row" 10248msgstr "" 10249 10250#: lazarusidestrconsts.lisfilefiltersinsertrow 10251msgid "Insert Row" 10252msgstr "" 10253 10254#: lazarusidestrconsts.lisfilefiltersmask 10255msgid "File mask" 10256msgstr "" 10257 10258#: lazarusidestrconsts.lisfilefilterssetdefaults 10259msgid "Set defaults" 10260msgstr "" 10261 10262#: lazarusidestrconsts.lisfilefilterstitle 10263msgid "These are file filters that will appear in all File Open dialogs" 10264msgstr "" 10265 10266#: lazarusidestrconsts.lisfilefound 10267msgid "File found" 10268msgstr "" 10269 10270#: lazarusidestrconsts.lisfilehaschangedsave 10271#, object-pascal-format 10272msgid "File \"%s\" has changed. Save?" 10273msgstr "" 10274 10275#: lazarusidestrconsts.lisfilehasnoproject 10276msgid "File has no project" 10277msgstr "" 10278 10279#: lazarusidestrconsts.lisfileisdirectory 10280msgid "File is directory" 10281msgstr "" 10282 10283#: lazarusidestrconsts.lisfileisnotanexecutable 10284msgid "File is not an executable" 10285msgstr "" 10286 10287#: lazarusidestrconsts.lisfileisnotwritable 10288msgid "File is not writable" 10289msgstr "Bestand is niet wijzigbaar" 10290 10291#: lazarusidestrconsts.lisfileissymlink 10292msgid "File is symlink" 10293msgstr "" 10294 10295#: lazarusidestrconsts.lisfileisvirtual 10296#, object-pascal-format, fuzzy 10297#| msgid "File %s%s%s is virtual." 10298msgid "File \"%s\" is virtual." 10299msgstr "Bestand \"%s\" is Virtual." 10300 10301#: lazarusidestrconsts.lisfilelinkerror 10302msgid "File link error" 10303msgstr "" 10304 10305#: lazarusidestrconsts.lisfilenameaddress 10306msgid "Filename/Address" 10307msgstr "" 10308 10309#: lazarusidestrconsts.lisfilenamestyle 10310msgid "Filename Style" 10311msgstr "" 10312 10313#: lazarusidestrconsts.lisfilenotfound 10314msgid "File not found" 10315msgstr "Bestand niet gevonden" 10316 10317#: lazarusidestrconsts.lisfilenotfound2 10318#, object-pascal-format, fuzzy 10319#| msgid "File %s%s%s not found.%s" 10320msgctxt "lazarusidestrconsts.lisfilenotfound2" 10321msgid "File \"%s\" not found." 10322msgstr "Bestand \"%s\" niet gevonden." 10323 10324#: lazarusidestrconsts.lisfilenotfound3 10325#, object-pascal-format 10326msgid "file %s not found" 10327msgstr "" 10328 10329#: lazarusidestrconsts.lisfilenotfound4 10330msgid "file not found" 10331msgstr "" 10332 10333#: lazarusidestrconsts.lisfilenotfound5 10334#, object-pascal-format 10335msgid "File not found:%s%s" 10336msgstr "" 10337 10338#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit 10339#, object-pascal-format, fuzzy 10340#| msgid "File %s%s%s not found.%sDo you want to create it?%s" 10341msgid "File \"%s\" not found.%sDo you want to create it?" 10342msgstr "Bestand \"%s\" niet gevonden.%sWilt u het bestand maken?" 10343 10344#: lazarusidestrconsts.lisfilenotlowercase 10345msgid "File not lowercase" 10346msgstr "Bestand niet met kleine letters" 10347 10348#: lazarusidestrconsts.lisfilenottext 10349msgid "File not text" 10350msgstr "Bestand is geen tekst" 10351 10352#: lazarusidestrconsts.lisfilescountconvertedtotextformat 10353#, object-pascal-format 10354msgid "%d files were converted to text format." 10355msgstr "" 10356 10357#: lazarusidestrconsts.lisfilesettings 10358msgid "File Settings" 10359msgstr "" 10360 10361#: lazarusidestrconsts.lisfileshasincorrectsyntax 10362#, object-pascal-format 10363msgid "File %s has incorrect syntax." 10364msgstr "" 10365 10366#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection 10367#, object-pascal-format 10368msgid "Files: %s, has Register procedure: %s, in package uses section: %s" 10369msgstr "" 10370 10371#: lazarusidestrconsts.lisfileshaverightencoding 10372msgid "*** All found files already have the right encoding ***" 10373msgstr "" 10374 10375#: lazarusidestrconsts.lisfilesinasciiorutf8encoding 10376msgid "Files in ASCII or UTF-8 encoding" 10377msgstr "" 10378 10379#: lazarusidestrconsts.lisfilesisconvertedtotextformat 10380#, object-pascal-format 10381msgid "File %s was converted to text format." 10382msgstr "" 10383 10384#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding 10385msgid "Files not in ASCII nor UTF-8 encoding" 10386msgstr "" 10387 10388#: lazarusidestrconsts.lisfilewheredebugoutputiswritten 10389#, fuzzy 10390#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." 10391msgid "file where debug output is written to. If it is not specified, debug output is written to the console." 10392msgstr "bestand, waar de debug uitvoer naar geschreven wordt. Als dit niet wordt gegeven, wordt de uitvoer naar de console geschreven." 10393 10394#: lazarusidestrconsts.lisfilter 10395msgid "Filter" 10396msgstr "" 10397 10398#: lazarusidestrconsts.lisfilter3 10399#, object-pascal-format 10400msgid "Filter: %s" 10401msgstr "" 10402 10403#: lazarusidestrconsts.lisfilterallmessagesofcertaintype 10404msgid "Filter all messages of certain type" 10405msgstr "" 10406 10407#: lazarusidestrconsts.lisfilterallmessagesoftype 10408#, object-pascal-format 10409msgid "Filter all messages of type %s" 10410msgstr "" 10411 10412#: lazarusidestrconsts.lisfilteralreadyexists 10413msgid "Filter already exists" 10414msgstr "" 10415 10416#: lazarusidestrconsts.lisfilterdebugmessagesandbelow 10417msgid "Filter Debug Messages and below" 10418msgstr "" 10419 10420#: lazarusidestrconsts.lisfilterhintsandbelow 10421msgid "Filter Hints and below" 10422msgstr "" 10423 10424#: lazarusidestrconsts.lisfilterhintswithoutsourceposition 10425msgid "Filter Hints without Source Position" 10426msgstr "" 10427 10428#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency 10429msgid "Filter None, do not filter by urgency" 10430msgstr "" 10431 10432#: lazarusidestrconsts.lisfilternonurgentmessages 10433msgid "Filter non urgent Messages" 10434msgstr "" 10435 10436#: lazarusidestrconsts.lisfilternotesandbelow 10437msgid "Filter Notes and below" 10438msgstr "" 10439 10440#: lazarusidestrconsts.lisfiltersets 10441msgid "Filter Sets" 10442msgstr "" 10443 10444#: lazarusidestrconsts.lisfiltertheavailableoptionslist 10445msgid "Filter the available options list" 10446msgstr "" 10447 10448#: lazarusidestrconsts.lisfilterverbosemessagesandbelow 10449msgid "Filter Verbose Messages and below" 10450msgstr "" 10451 10452#: lazarusidestrconsts.lisfilterwarningsandbelow 10453msgid "Filter Warnings and below" 10454msgstr "" 10455 10456#: lazarusidestrconsts.lisfind 10457msgid "Find ..." 10458msgstr "" 10459 10460#: lazarusidestrconsts.lisfinddeclarationof 10461#, object-pascal-format 10462msgid "Find Declaration of %s" 10463msgstr "" 10464 10465#: lazarusidestrconsts.lisfindfiledirectories 10466msgid "D&irectories" 10467msgstr "" 10468 10469#: lazarusidestrconsts.lisfindfilefilemask 10470msgid "Fi&le mask" 10471msgstr "" 10472 10473#: lazarusidestrconsts.lisfindfileincludesubdirectories 10474#, fuzzy 10475#| msgid "Include sub directories" 10476msgid "Include &sub directories" 10477msgstr "Include sub directories" 10478 10479#: lazarusidestrconsts.lisfindfilemultilinepattern 10480msgid "&Multiline pattern" 10481msgstr "" 10482 10483#: lazarusidestrconsts.lisfindfilesearchallfilesinproject 10484msgid "search all files in &project" 10485msgstr "" 10486 10487#: lazarusidestrconsts.lisfindfilesearchallopenfiles 10488msgid "search all &open files" 10489msgstr "" 10490 10491#: lazarusidestrconsts.lisfindfilesearchinactivefile 10492msgid "search in &active file" 10493msgstr "" 10494 10495#: lazarusidestrconsts.lisfindfilesearchindirectories 10496msgid "search in &directories" 10497msgstr "" 10498 10499#: lazarusidestrconsts.lisfindfilessearchinprojectgroup 10500msgid "search in project &group" 10501msgstr "" 10502 10503#: lazarusidestrconsts.lisfindfilewhere 10504msgid "Where" 10505msgstr "Waar" 10506 10507#: lazarusidestrconsts.lisfindkeycombination 10508msgid "Find key combination" 10509msgstr "" 10510 10511#: lazarusidestrconsts.lisfindmissingunit 10512msgid "Find missing unit" 10513msgstr "" 10514 10515#: lazarusidestrconsts.lisfirst 10516msgid "First" 10517msgstr "" 10518 10519#: lazarusidestrconsts.lisfirsttest 10520msgid "&First test" 10521msgstr "" 10522 10523#: lazarusidestrconsts.lisfixlfmfile 10524msgid "Fix LFM file" 10525msgstr "Repareer .lfm-bestand" 10526 10527#: lazarusidestrconsts.lisfloatingpoin 10528msgid "Floating Point" 10529msgstr "" 10530 10531#: lazarusidestrconsts.lisfocushint 10532msgid "Focus hint" 10533msgstr "" 10534 10535#: lazarusidestrconsts.lisforcerenaming 10536msgid "Force renaming" 10537msgstr "Hernoemen afdwingen" 10538 10539#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers 10540msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units" 10541msgstr "" 10542 10543#: lazarusidestrconsts.lisform 10544msgid "Form" 10545msgstr "" 10546 10547#: lazarusidestrconsts.lisformacosdarwin 10548msgid "For macOS (Darwin)" 10549msgstr "" 10550 10551#: lazarusidestrconsts.lisformaterror 10552msgid "Format error" 10553msgstr "Formatteerfout" 10554 10555#: lazarusidestrconsts.lisforwindows 10556msgid "For Windows" 10557msgstr "" 10558 10559#: lazarusidestrconsts.lisfoundversionexpected 10560#, object-pascal-format 10561msgid "Found version %s, expected %s" 10562msgstr "" 10563 10564#: lazarusidestrconsts.lisfpcfullversioneg20701 10565msgid "FPC version as one number (e.g. 20701)" 10566msgstr "" 10567 10568#: lazarusidestrconsts.lisfpcmakefailed 10569msgid "fpcmake failed" 10570msgstr "" 10571 10572#: lazarusidestrconsts.lisfpcmessagefile2 10573msgid "FPC message file:" 10574msgstr "" 10575 10576#: lazarusidestrconsts.lisfpcmessagesappendix 10577msgid "FPC messages: Appendix" 10578msgstr "" 10579 10580#: lazarusidestrconsts.lisfpcresources 10581msgid "FPC resources (.res)" 10582msgstr "" 10583 10584#: lazarusidestrconsts.lisfpcsources 10585msgid "FPC sources" 10586msgstr "" 10587 10588#: lazarusidestrconsts.lisfpctooold 10589msgid "FPC too old" 10590msgstr "" 10591 10592#: lazarusidestrconsts.lisfpcversion 10593msgid "FPC Version: " 10594msgstr "" 10595 10596#: lazarusidestrconsts.lisfpcversioneg222 10597msgid "FPC Version (e.g. 2.2.2)" 10598msgstr "" 10599 10600#: lazarusidestrconsts.lisfpdoceditor 10601msgctxt "lazarusidestrconsts.lisfpdoceditor" 10602msgid "FPDoc Editor" 10603msgstr "" 10604 10605#: lazarusidestrconsts.lisfpdocerrorwriting 10606#, object-pascal-format 10607msgid "Error writing \"%s\"%s%s" 10608msgstr "" 10609 10610#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror 10611msgid "FPDoc syntax error" 10612msgstr "" 10613 10614#: lazarusidestrconsts.lisfpdocpackagename 10615msgid "FPDoc package name:" 10616msgstr "" 10617 10618#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename 10619msgid "FPDoc package name. Default is project file name." 10620msgstr "" 10621 10622#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement 10623#, object-pascal-format 10624msgid "There is a syntax error in the fpdoc element \"%s\":%s%s" 10625msgstr "" 10626 10627#: lazarusidestrconsts.lisfppkgcompilernotexecutable 10628#, object-pascal-format 10629msgid "The compiler [%s] configured for Fppkg is not an executable." 10630msgstr "" 10631 10632#: lazarusidestrconsts.lisfppkgcompilernotexists 10633#, object-pascal-format 10634msgid "The compiler [%s] configured for Fppkg does not exist." 10635msgstr "" 10636 10637#: lazarusidestrconsts.lisfppkgcompilernotfound 10638#, object-pascal-format 10639msgid "Could not find the compiler [%s] configured for Fppkg." 10640msgstr "" 10641 10642#: lazarusidestrconsts.lisfppkgcompilerproblem 10643msgid "there is a problem with the Free Pascal compiler executable, " 10644msgstr "" 10645 10646#: lazarusidestrconsts.lisfppkgconfgenproblems 10647msgid "Warnings have to be resolved first" 10648msgstr "" 10649 10650#: lazarusidestrconsts.lisfppkgconfiguration 10651msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default." 10652msgstr "" 10653 10654#: lazarusidestrconsts.lisfppkgcreatefilefailed 10655#, object-pascal-format 10656msgid "Failed to generate the configuration file \"%s\": %s" 10657msgstr "" 10658 10659#: lazarusidestrconsts.lisfppkgfilestobewritten 10660msgid "Files to be written:" 10661msgstr "" 10662 10663#: lazarusidestrconsts.lisfppkgfixconfiguration 10664msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually." 10665msgstr "" 10666 10667#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed 10668msgid "Failed to retrieve the version of the fpcmkcfg configuration tool." 10669msgstr "" 10670 10671#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing 10672msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files." 10673msgstr "" 10674 10675#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded 10676msgid "An up-to-date version is needed to create the configuration files." 10677msgstr "" 10678 10679#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold 10680msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold" 10681msgid "It is probably too old to create the configuration files." 10682msgstr "" 10683 10684#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold 10685#, object-pascal-format 10686msgid "The fpcmkcfg configuration tool it too old [%s]." 10687msgstr "" 10688 10689#: lazarusidestrconsts.lisfppkginstallationpath 10690#, object-pascal-format 10691msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\"" 10692msgstr "" 10693 10694#: lazarusidestrconsts.lisfppkglibprefix 10695#, object-pascal-format 10696msgid "Fpc library prefix: %s" 10697msgstr "" 10698 10699#: lazarusidestrconsts.lisfppkgprefix 10700#, object-pascal-format 10701msgid "Fpc prefix: %s" 10702msgstr "" 10703 10704#: lazarusidestrconsts.lisfppkgproblem 10705msgid "Problem with Fppkg configuration" 10706msgstr "" 10707 10708#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded 10709msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable." 10710msgstr "" 10711 10712#: lazarusidestrconsts.lisfppkgrtlnotfound 10713msgid "Fppkg reports that the RTL is not installed." 10714msgstr "" 10715 10716#: lazarusidestrconsts.lisfppkgwriteconfexception 10717#, object-pascal-format 10718msgid "A problem occurred while trying to create a new Fppkg configuration: %s" 10719msgstr "" 10720 10721#: lazarusidestrconsts.lisfppkgwriteconffailed 10722#, object-pascal-format 10723msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal." 10724msgstr "" 10725 10726#: lazarusidestrconsts.lisfppkgwriteconfigfile 10727msgid "Write new configuration files" 10728msgstr "" 10729 10730#: lazarusidestrconsts.lisframe 10731msgid "Frame" 10732msgstr "" 10733 10734#: lazarusidestrconsts.lisfrbackwardsearch 10735msgid "&Backward search" 10736msgstr "" 10737 10738#: lazarusidestrconsts.lisfreeingbufferlines 10739#, object-pascal-format 10740msgid "freeing buffer lines: %s" 10741msgstr "" 10742 10743#: lazarusidestrconsts.lisfreepascalcompilermessages 10744msgid "Free Pascal Compiler messages" 10745msgstr "" 10746 10747#: lazarusidestrconsts.lisfreepascalprefix 10748msgid "Free Pascal compiler prefix" 10749msgstr "" 10750 10751#: lazarusidestrconsts.lisfreepascalsourcedirectory 10752#, fuzzy 10753#| msgid "Freepascal source directory" 10754msgid "Free Pascal source directory" 10755msgstr "FreePascal bronnen directory" 10756 10757#: lazarusidestrconsts.lisfrforwardsearch 10758msgid "Forwar&d search" 10759msgstr "" 10760 10761#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp 10762msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" 10763msgstr "Additionele bestanden om te zoeken (d.w.z. /pad/*.pas, /pad2/*.pp)" 10764 10765#: lazarusidestrconsts.lisfrifindorrenameidentifier 10766msgid "Find or Rename Identifier" 10767msgstr "Vind of hernoem identifier" 10768 10769#: lazarusidestrconsts.lisfrifindreferences 10770msgid "Find References" 10771msgstr "Zoek referenties" 10772 10773#: lazarusidestrconsts.lisfriidentifier 10774#, object-pascal-format 10775msgid "Identifier: %s" 10776msgstr "Identifier: %s" 10777 10778#: lazarusidestrconsts.lisfriinallopenpackagesandprojects 10779msgid "in all open packages and projects" 10780msgstr "in alle geopende packages en projecten" 10781 10782#: lazarusidestrconsts.lisfriincurrentunit 10783msgid "in current unit" 10784msgstr "in huidige unit" 10785 10786#: lazarusidestrconsts.lisfriinmainproject 10787msgid "in main project" 10788msgstr "in hoofd project" 10789 10790#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit 10791msgid "in project/package owning current unit" 10792msgstr "in het project/package waar de huidige unit toebehoort" 10793 10794#: lazarusidestrconsts.lisfriinvalididentifier 10795msgid "Invalid Identifier" 10796msgstr "Ongeldige Identifier" 10797 10798#: lazarusidestrconsts.lisfrirenameallreferences 10799msgid "Rename all References" 10800msgstr "Hernoem alle referenties" 10801 10802#: lazarusidestrconsts.lisfrirenaming 10803msgid "Renaming" 10804msgstr "" 10805 10806#: lazarusidestrconsts.lisfrisearch 10807msgid "Search" 10808msgstr "" 10809 10810#: lazarusidestrconsts.lisfrisearchincommentstoo 10811msgid "Search in comments too" 10812msgstr "Zoek ook in commentaar" 10813 10814#: lazarusidestrconsts.lisfull 10815msgid "Full" 10816msgstr "" 10817 10818#: lazarusidestrconsts.lisfunction 10819msgctxt "lazarusidestrconsts.lisfunction" 10820msgid "Function" 10821msgstr "" 10822 10823#: lazarusidestrconsts.lisgeneral 10824msgctxt "lazarusidestrconsts.lisgeneral" 10825msgid "General" 10826msgstr "Algemeen" 10827 10828#: lazarusidestrconsts.lisgeneratefppkgcfg 10829#, object-pascal-format 10830msgid "Fppkg configuration: %s" 10831msgstr "" 10832 10833#: lazarusidestrconsts.lisgeneratefppkgcompcfg 10834#, object-pascal-format 10835msgid "Fppkg compiler configuration: %s" 10836msgstr "" 10837 10838#: lazarusidestrconsts.lisgeneratefppkgconfiguration 10839msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool." 10840msgstr "" 10841 10842#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption 10843msgid "Generate new Fppkg configuration files" 10844msgstr "" 10845 10846#: lazarusidestrconsts.lisgetwordatcurrentcursorposition 10847msgid "get word at current cursor position" 10848msgstr "" 10849 10850#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2 10851msgid "Get word at current cursor position." 10852msgstr "" 10853 10854#: lazarusidestrconsts.lisglobalsettings 10855msgid "Global settings" 10856msgstr "" 10857 10858#: lazarusidestrconsts.lisgotoline 10859msgid "Goto Line" 10860msgstr "" 10861 10862#: lazarusidestrconsts.lisgotoselected 10863msgid "Goto selected" 10864msgstr "" 10865 10866#: lazarusidestrconsts.lisgplnotice 10867msgid "" 10868"<description>\n" 10869"\n" 10870"Copyright (C) <year> <name of author> <contact>\n" 10871"\n" 10872"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 10873"\n" 10874"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n" 10875"\n" 10876"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 10877msgstr "" 10878 10879#: lazarusidestrconsts.lisgroup 10880msgid "Group" 10881msgstr "" 10882 10883#: lazarusidestrconsts.lisgroupassignexisting 10884#, object-pascal-format 10885msgid "Assign to existing \"%s\" group?" 10886msgstr "" 10887 10888#: lazarusidestrconsts.lisgroupemptydelete 10889#, object-pascal-format 10890msgid "No more breakpoints are assigned to group \"%s\", delete it?" 10891msgstr "" 10892 10893#: lazarusidestrconsts.lisgroupemptydeletemore 10894#, object-pascal-format 10895msgid "%sThere are %d more empty groups, delete all?" 10896msgstr "" 10897 10898#: lazarusidestrconsts.lisgrouplocalvariables 10899msgid "Group automatically defined local variables" 10900msgstr "" 10901 10902#: lazarusidestrconsts.lisgroupnameemptyclearinstead 10903msgid "The group name cannot be empty. Clear breakpoints' group(s)?" 10904msgstr "" 10905 10906#: lazarusidestrconsts.lisgroupnameinput 10907msgid "Group name:" 10908msgstr "" 10909 10910#: lazarusidestrconsts.lisgroupnameinvalid 10911msgid "BreakpointGroup name must be a valid Pascal identifier name." 10912msgstr "" 10913 10914#: lazarusidestrconsts.lisgroupsetnew 10915msgid "Set new group ..." 10916msgstr "" 10917 10918#: lazarusidestrconsts.lisgroupsetnone 10919msgid "Clear group(s)" 10920msgstr "" 10921 10922#: lazarusidestrconsts.lisgroupsfordebugoutput 10923msgid "Enable or Disable groups of debug output. Valid Options are:" 10924msgstr "" 10925 10926#: lazarusidestrconsts.lisgrowtolarges 10927msgid "Grow to Largest" 10928msgstr "" 10929 10930#: lazarusidestrconsts.lishashelp 10931msgid "Has Help" 10932msgstr "" 10933 10934#: lazarusidestrconsts.lisheadercolors 10935msgid "Header colors" 10936msgstr "" 10937 10938#: lazarusidestrconsts.lisheadercommentforclass 10939msgid "Header comment for class" 10940msgstr "Header commentaar voor klasse" 10941 10942#: lazarusidestrconsts.lishelp 10943msgctxt "lazarusidestrconsts.lishelp" 10944msgid "Help" 10945msgstr "Help" 10946 10947#: lazarusidestrconsts.lishelpentries 10948msgid "Help entries" 10949msgstr "" 10950 10951#: lazarusidestrconsts.lishelpselectordialog 10952msgid "Help selector" 10953msgstr "Help selecteren" 10954 10955#: lazarusidestrconsts.lishexadecimal 10956msgid "Hexadecimal" 10957msgstr "" 10958 10959#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage 10960msgid "Help for Free Pascal Compiler message" 10961msgstr "" 10962 10963#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh 10964msgid "Hide all hints and warnings by inserting IDE directives {%H-}" 10965msgstr "" 10966 10967#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh 10968msgid "Hide message at %s by inserting IDE directive {%H-}" 10969msgstr "" 10970 10971#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh 10972msgid "Hide message by inserting IDE directive {%H-}" 10973msgstr "" 10974 10975#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit 10976#, object-pascal-format 10977msgid "Hide message by inserting {$warn %s off} to unit \"%s\"" 10978msgstr "" 10979 10980#: lazarusidestrconsts.lishidesearch 10981msgid "Hide Search" 10982msgstr "" 10983 10984#: lazarusidestrconsts.lishidewindow 10985msgctxt "lazarusidestrconsts.lishidewindow" 10986msgid "Hide window" 10987msgstr "" 10988 10989#: lazarusidestrconsts.lishidewithpackageoptionvm 10990#, object-pascal-format 10991msgid "Hide with package option (-vm%s)" 10992msgstr "" 10993 10994#: lazarusidestrconsts.lishidewithprojectoptionvm 10995#, object-pascal-format 10996msgid "Hide with project option (-vm%s)" 10997msgstr "" 10998 10999#: lazarusidestrconsts.lishint 11000msgctxt "lazarusidestrconsts.lishint" 11001msgid "Hint" 11002msgstr "" 11003 11004#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals 11005msgid "Hint: A default value can be defined in the conditionals." 11006msgstr "" 11007 11008#: lazarusidestrconsts.lishintatpropertysnameshowsdescription 11009msgid "A hint at property's name shows its description." 11010msgstr "" 11011 11012#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename 11013msgid "Hint: Check if two packages contain a unit with the same name." 11014msgstr "" 11015 11016#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths 11017msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from." 11018msgstr "" 11019 11020#: lazarusidestrconsts.lishints 11021#, object-pascal-format 11022msgid ", Hints: %s" 11023msgstr "" 11024 11025#: lazarusidestrconsts.lishintsaveall 11026msgid "Save all" 11027msgstr "Alles Opslaan" 11028 11029#: lazarusidestrconsts.lishintstepinto 11030msgid "Step Into" 11031msgstr "Step Into" 11032 11033#: lazarusidestrconsts.lishintstepout 11034msgid "Run until function returns" 11035msgstr "" 11036 11037#: lazarusidestrconsts.lishintstepover 11038msgid "Step Over" 11039msgstr "Step Over" 11040 11041#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon 11042#, object-pascal-format 11043msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." 11044msgstr "" 11045 11046#: lazarusidestrconsts.lishinttoggleformunit 11047msgid "Toggle Form/Unit" 11048msgstr "Schakel tussen Form/Unit" 11049 11050#: lazarusidestrconsts.lishintviewforms 11051msgid "View Forms" 11052msgstr "Toon Forms" 11053 11054#: lazarusidestrconsts.lishintviewunits 11055msgid "View Units" 11056msgstr "Toon Units" 11057 11058#: lazarusidestrconsts.lishitcount 11059msgid "Hitcount" 11060msgstr "" 11061 11062#: lazarusidestrconsts.lishlpoptsdatabases 11063msgid "Databases" 11064msgstr "Databases" 11065 11066#: lazarusidestrconsts.lishlpoptshelpoptions 11067msgid "Help Options" 11068msgstr "Help Opties" 11069 11070#: lazarusidestrconsts.lishlpoptsproperties 11071msgid "Properties:" 11072msgstr "Properties" 11073 11074#: lazarusidestrconsts.lishlpoptsviewers 11075msgid "Viewers" 11076msgstr "Viewers" 11077 11078#: lazarusidestrconsts.lishofpcdochtmlpath 11079msgid "FPC Doc HTML Path" 11080msgstr "FPC Doc HTML pad" 11081 11082#: lazarusidestrconsts.lishorizontal 11083msgid "Horizontal" 11084msgstr "Horizontaal" 11085 11086#: lazarusidestrconsts.lishorizontallinesbetweenproperties 11087msgid "Horizontal lines between properties." 11088msgstr "" 11089 11090#: lazarusidestrconsts.lisid 11091msgctxt "lazarusidestrconsts.lisid" 11092msgid "ID" 11093msgstr "" 11094 11095#: lazarusidestrconsts.lisidcaddition 11096msgid "Addition" 11097msgstr "" 11098 11099#: lazarusidestrconsts.lisidcopening 11100msgid "Opening" 11101msgstr "" 11102 11103#: lazarusidestrconsts.liside 11104msgid "IDE" 11105msgstr "" 11106 11107#: lazarusidestrconsts.lisidebuildoptions 11108msgid "IDE build options" 11109msgstr "" 11110 11111#: lazarusidestrconsts.lisidecompileandrestart 11112msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages." 11113msgstr "" 11114 11115#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus 11116#, object-pascal-format 11117msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s" 11118msgstr "" 11119 11120#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage 11121#, object-pascal-format 11122msgid "Creating Makefile for package %s" 11123msgstr "" 11124 11125#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage 11126#, object-pascal-format 11127msgid "Error: running 'compile after' tool failed for package %s" 11128msgstr "" 11129 11130#: lazarusidestrconsts.lisideinfoinformationabouttheide 11131msgid "Information about the IDE" 11132msgstr "" 11133 11134#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage 11135#, object-pascal-format 11136msgid "WARNING: unit name invalid %s, package=%s" 11137msgstr "" 11138 11139#: lazarusidestrconsts.lisidemacros 11140msgid "IDE Macros" 11141msgstr "" 11142 11143#: lazarusidestrconsts.lisidemaintainsscaledinmainunit 11144msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit." 11145msgstr "" 11146 11147#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit 11148msgid "The IDE maintains the title in main unit." 11149msgstr "" 11150 11151#: lazarusidestrconsts.lisidentifier 11152msgid "identifier" 11153msgstr "" 11154 11155#: lazarusidestrconsts.lisidentifierbeginswith 11156msgid "Identifier begins with ..." 11157msgstr "" 11158 11159#: lazarusidestrconsts.lisidentifiercontains 11160msgid "Identifier contains ..." 11161msgstr "" 11162 11163#: lazarusidestrconsts.lisideoptions 11164msgid "IDE Options:" 11165msgstr "IDE opties:" 11166 11167#: lazarusidestrconsts.lisidetitleshowsbuildmode 11168msgid "IDE title shows selected build mode" 11169msgstr "" 11170 11171#: lazarusidestrconsts.lisidetitleshowsprojectdir 11172msgid "IDE title shows project directory" 11173msgstr "" 11174 11175#: lazarusidestrconsts.lisidetitlestartswithprojectname 11176msgid "IDE title starts with project name" 11177msgstr "" 11178 11179#: lazarusidestrconsts.lisiecoallbuildmodes 11180msgid "All build modes" 11181msgstr "" 11182 11183#: lazarusidestrconsts.lisiecocompileroptionsof 11184msgid "Compiler options of" 11185msgstr "" 11186 11187#: lazarusidestrconsts.lisiecocurrentbuildmode 11188msgid "Current build mode" 11189msgstr "" 11190 11191#: lazarusidestrconsts.lisiecoerroropeningxml 11192msgid "Error opening XML" 11193msgstr "" 11194 11195#: lazarusidestrconsts.lisiecoerroropeningxmlfile 11196#, object-pascal-format 11197msgid "Error opening XML file \"%s\":%s%s" 11198msgstr "" 11199 11200#: lazarusidestrconsts.lisiecoexportcompileroptions 11201msgid "Export Compiler Options" 11202msgstr "" 11203 11204#: lazarusidestrconsts.lisiecoexportfileexists 11205msgid "Export file exists" 11206msgstr "" 11207 11208#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti 11209#, object-pascal-format 11210msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" 11211msgstr "" 11212 11213#: lazarusidestrconsts.lisiecoimportcompileroptions 11214msgid "Import Compiler Options" 11215msgstr "" 11216 11217#: lazarusidestrconsts.lisiecoloadfromfile 11218msgid "Load from file" 11219msgstr "Laad van bestand" 11220 11221#: lazarusidestrconsts.lisieconocompileroptionsinfile 11222#, object-pascal-format 11223msgid "File \"%s\" does not contain compiler options." 11224msgstr "" 11225 11226#: lazarusidestrconsts.lisiecorecentfiles 11227msgid "Recent files" 11228msgstr "Recente bestanden" 11229 11230#: lazarusidestrconsts.lisiecosavetofile 11231msgid "Save to file" 11232msgstr "Sla bestand op" 11233 11234#: lazarusidestrconsts.lisifnotchecked 11235msgid "If not checked:" 11236msgstr "" 11237 11238#: lazarusidestrconsts.lisifonlysessioninfochangedthenask 11239msgid "If only the session info changed, ask about saving it." 11240msgstr "" 11241 11242#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst 11243#, object-pascal-format 11244msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:" 11245msgstr "" 11246 11247#: lazarusidestrconsts.lisignore 11248#, fuzzy 11249msgctxt "lazarusidestrconsts.lisignore" 11250msgid "Ignore" 11251msgstr "Negeren" 11252 11253#: lazarusidestrconsts.lisignoreall 11254msgid "Ignore all" 11255msgstr "" 11256 11257#: lazarusidestrconsts.lisignoreandcontinue 11258msgid "Ignore and continue" 11259msgstr "" 11260 11261#: lazarusidestrconsts.lisignoreexceptiontype 11262msgid "Ignore this exception type" 11263msgstr "" 11264 11265#: lazarusidestrconsts.lisignoreuseasancestor 11266#, object-pascal-format 11267msgid "Ignore, use %s as ancestor" 11268msgstr "" 11269 11270#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage 11271msgid "Imitate indentation of current unit, project or package" 11272msgstr "" 11273 11274#: lazarusidestrconsts.lisimplementationcommentforclass 11275msgid "Implementation comment for class" 11276msgstr "" 11277 11278#: lazarusidestrconsts.lisimport 11279msgctxt "lazarusidestrconsts.lisimport" 11280msgid "Import" 11281msgstr "" 11282 11283#: lazarusidestrconsts.lisimportant 11284msgctxt "lazarusidestrconsts.lisimportant" 11285msgid "Important" 11286msgstr "" 11287 11288#: lazarusidestrconsts.lisimportenvironmentoptions 11289msgctxt "lazarusidestrconsts.lisimportenvironmentoptions" 11290msgid "Import environment options" 11291msgstr "" 11292 11293#: lazarusidestrconsts.lisimportfromfile 11294msgid "Import from File" 11295msgstr "" 11296 11297#: lazarusidestrconsts.lisimportingbuildmodesnotsupported 11298msgid "Importing BuildModes is not supported for packages." 11299msgstr "" 11300 11301#: lazarusidestrconsts.lisimportlist 11302msgid "Import list" 11303msgstr "Import lijst" 11304 11305#: lazarusidestrconsts.lisimportpackagelistxml 11306msgid "Import package list (*.xml)" 11307msgstr "" 11308 11309#: lazarusidestrconsts.lisimpossible 11310msgid "Impossible" 11311msgstr "" 11312 11313#: lazarusidestrconsts.lisinasourcedirectoryofthepackage 11314#, object-pascal-format 11315msgid "In a source directory of the package \"%s\"." 11316msgstr "" 11317 11318#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates 11319msgid "In a source directory of the project. Check for duplicates." 11320msgstr "" 11321 11322#: lazarusidestrconsts.lisincludeallsubdirectories 11323msgid "Include all subdirectories" 11324msgstr "" 11325 11326#: lazarusidestrconsts.lisincludefilter 11327#, fuzzy 11328#| msgid "Include Filter" 11329msgid "Include filter" 11330msgstr "Include filter" 11331 11332#: lazarusidestrconsts.lisincludepath 11333msgid "include path" 11334msgstr "pad gebruiken" 11335 11336#: lazarusidestrconsts.lisincludepaths 11337msgid "Include paths" 11338msgstr "Include pad" 11339 11340#: lazarusidestrconsts.lisincludesubdirectories 11341msgid "Include subdirectories" 11342msgstr "" 11343 11344#: lazarusidestrconsts.lisincompatibleppu 11345#, object-pascal-format 11346msgid ", incompatible ppu=%s" 11347msgstr "" 11348 11349#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound 11350msgid "Incorrect configuration directory found" 11351msgstr "" 11352 11353#: lazarusidestrconsts.lisincorrectfppkgconfiguration 11354#, object-pascal-format 11355msgid "there is a problem with the Fppkg configuration. (%s)" 11356msgstr "" 11357 11358#: lazarusidestrconsts.lisindentationforpascalsources 11359msgid "Indentation for Pascal sources" 11360msgstr "" 11361 11362#: lazarusidestrconsts.lisindex 11363msgid "Index" 11364msgstr "" 11365 11366#: lazarusidestrconsts.lisinformation 11367msgid "Information" 11368msgstr "" 11369 11370#: lazarusidestrconsts.lisinformationaboutunit 11371#, object-pascal-format 11372msgid "Information about %s" 11373msgstr "Informatie over %s" 11374 11375#: lazarusidestrconsts.lisinformationaboutusedfpc 11376msgid "Information about used FPC" 11377msgstr "" 11378 11379#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag 11380msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation." 11381msgstr "" 11382 11383#: lazarusidestrconsts.lisinfrontofrelated 11384msgid "In front of related" 11385msgstr "" 11386 11387#: lazarusidestrconsts.lisinheriteditem 11388msgid "Inherited Item" 11389msgstr "" 11390 11391#: lazarusidestrconsts.lisinheritedparameters 11392msgid "Inherited parameters" 11393msgstr "" 11394 11395#: lazarusidestrconsts.lisinheritedprojectcomponent 11396msgid "Inherited project component" 11397msgstr "" 11398 11399#: lazarusidestrconsts.lisinitializelocalvariable 11400msgid "Initialize Local Variable" 11401msgstr "" 11402 11403#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil 11404#, object-pascal-format 11405msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?" 11406msgstr "" 11407 11408#: lazarusidestrconsts.lisinsert 11409msgctxt "lazarusidestrconsts.lisinsert" 11410msgid "Insert" 11411msgstr "Invoegen" 11412 11413#: lazarusidestrconsts.lisinsertassignment 11414#, object-pascal-format 11415msgid "Insert Assignment %s := ..." 11416msgstr "" 11417 11418#: lazarusidestrconsts.lisinsertdate 11419msgid "insert date" 11420msgstr "" 11421 11422#: lazarusidestrconsts.lisinsertdateandtime 11423msgid "insert date and time" 11424msgstr "" 11425 11426#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring 11427msgid "Insert date and time. Optional: format string." 11428msgstr "" 11429 11430#: lazarusidestrconsts.lisinsertdateoptionalformatstring 11431msgid "Insert date. Optional: format string." 11432msgstr "" 11433 11434#: lazarusidestrconsts.lisinsertendifneeded 11435msgid "insert end if needed" 11436msgstr "" 11437 11438#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure 11439msgid "" 11440"Insert header of current procedure.\n" 11441"\n" 11442"Optional Parameters (comma separated):\n" 11443"WithStart, // proc keyword e.g. 'function', 'class procedure'\n" 11444"WithoutClassKeyword,// without 'class' proc keyword\n" 11445"AddClassName, // extract/add ClassName.\n" 11446"WithoutClassName, // skip classname\n" 11447"WithoutName, // skip function name\n" 11448"WithoutParamList, // skip param list\n" 11449"WithVarModifiers, // extract 'var', 'out', 'const'\n" 11450"WithParameterNames, // extract parameter names\n" 11451"WithoutParamTypes, // skip colon, param types and default values\n" 11452"WithDefaultValues, // extract default values\n" 11453"WithResultType, // extract colon + result type\n" 11454"WithOfObject, // extract 'of object'\n" 11455"WithCallingSpecs, // extract cdecl; inline;\n" 11456"WithProcModifiers, // extract forward; alias; external;\n" 11457"WithComments, // extract comments and spaces\n" 11458"InUpperCase, // turn to uppercase\n" 11459"CommentsToSpace, // replace comments with a single space\n" 11460" // (default is to skip unnecessary space,\n" 11461" // e.g 'Do ;' normally becomes 'Do;'\n" 11462" // with this option you get 'Do ;')\n" 11463"WithoutBrackets, // skip start- and end-bracket of parameter list\n" 11464"WithoutSemicolon, // skip semicolon at end\n" 11465msgstr "" 11466 11467#: lazarusidestrconsts.lisinsertmacro 11468msgctxt "lazarusidestrconsts.lisinsertmacro" 11469msgid "Insert Macro" 11470msgstr "Macro invoegen" 11471 11472#: lazarusidestrconsts.lisinsertnameofcurrentprocedure 11473msgid "Insert name of current procedure." 11474msgstr "" 11475 11476#: lazarusidestrconsts.lisinsertprintshorttag 11477msgid "Insert PrintShort tag" 11478msgstr "" 11479 11480#: lazarusidestrconsts.lisinsertprintshorttag2 11481msgid "Insert printshort tag" 11482msgstr "" 11483 11484#: lazarusidestrconsts.lisinsertprocedurehead 11485msgid "insert procedure head" 11486msgstr "" 11487 11488#: lazarusidestrconsts.lisinsertprocedurename 11489msgid "insert procedure name" 11490msgstr "" 11491 11492#: lazarusidestrconsts.lisinsertsemicolonifneeded 11493msgid "Insert semicolon if needed" 11494msgstr "" 11495 11496#: lazarusidestrconsts.lisinserttime 11497msgid "insert time" 11498msgstr "" 11499 11500#: lazarusidestrconsts.lisinserttimeoptionalformatstring 11501msgid "Insert time. Optional: format string." 11502msgstr "" 11503 11504#: lazarusidestrconsts.lisinserturltag 11505msgid "Insert url tag" 11506msgstr "" 11507 11508#: lazarusidestrconsts.lisinsession 11509msgid "In session" 11510msgstr "" 11511 11512#: lazarusidestrconsts.lisinspect 11513msgid "&Inspect" 11514msgstr "" 11515 11516#: lazarusidestrconsts.lisinspectaddwatch 11517msgctxt "lazarusidestrconsts.lisinspectaddwatch" 11518msgid "Add watch" 11519msgstr "" 11520 11521#: lazarusidestrconsts.lisinspectclassinherit 11522#, object-pascal-format 11523msgid "%s: class %s inherits from %s" 11524msgstr "" 11525 11526#: lazarusidestrconsts.lisinspectdata 11527msgid "Data" 11528msgstr "" 11529 11530#: lazarusidestrconsts.lisinspectdialog 11531msgid "Debug Inspector" 11532msgstr "" 11533 11534#: lazarusidestrconsts.lisinspectmethods 11535msgid "Methods" 11536msgstr "" 11537 11538#: lazarusidestrconsts.lisinspectpointerto 11539#, object-pascal-format 11540msgid "Pointer to %s" 11541msgstr "" 11542 11543#: lazarusidestrconsts.lisinspectproperties 11544msgctxt "lazarusidestrconsts.lisinspectproperties" 11545msgid "Properties" 11546msgstr "" 11547 11548#: lazarusidestrconsts.lisinspectshowcolclass 11549msgid "Show class column" 11550msgstr "" 11551 11552#: lazarusidestrconsts.lisinspectshowcoltype 11553msgid "Show type column" 11554msgstr "" 11555 11556#: lazarusidestrconsts.lisinspectshowcolvisibility 11557msgid "Show visibility column" 11558msgstr "" 11559 11560#: lazarusidestrconsts.lisinspectunavailableerror 11561#, object-pascal-format 11562msgid "%s: unavailable (error: %s)" 11563msgstr "" 11564 11565#: lazarusidestrconsts.lisinspectuseinstance 11566msgid "Instance" 11567msgstr "" 11568 11569#: lazarusidestrconsts.lisinspectuseinstancehint 11570msgid "Use instance class" 11571msgstr "" 11572 11573#: lazarusidestrconsts.lisinstallationfailed 11574msgid "Installation failed" 11575msgstr "Installatie mislukt" 11576 11577#: lazarusidestrconsts.lisinstalled 11578msgid "installed" 11579msgstr "" 11580 11581#: lazarusidestrconsts.lisinstallitilikethefat 11582msgid "Install it, I like the fat" 11583msgstr "" 11584 11585#: lazarusidestrconsts.lisinstallpackagesmsg 11586#, object-pascal-format 11587msgid "" 11588"The following packages are not installed, but available in the main repository: %s.\n" 11589"Do you wish to install missing packages?" 11590msgstr "" 11591 11592#: lazarusidestrconsts.lisinstallselection 11593msgid "Install selection" 11594msgstr "Installeer selectie" 11595 11596#: lazarusidestrconsts.lisinstalluninstallpackages 11597msgctxt "lazarusidestrconsts.lisinstalluninstallpackages" 11598msgid "Install/Uninstall Packages" 11599msgstr "" 11600 11601#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile 11602msgid "Instead of compile package create a simple Makefile." 11603msgstr "" 11604 11605#: lazarusidestrconsts.lisinsufficientencoding 11606msgid "Insufficient encoding" 11607msgstr "" 11608 11609#: lazarusidestrconsts.lisinteractive 11610msgid "Interactive" 11611msgstr "" 11612 11613#: lazarusidestrconsts.lisinternalerror 11614#, object-pascal-format 11615msgid "internal error: %s" 11616msgstr "" 11617 11618#: lazarusidestrconsts.lisinvaliddelete 11619msgid "Invalid delete" 11620msgstr "Ongeldige verwijdering" 11621 11622#: lazarusidestrconsts.lisinvalidexecutable 11623msgid "Invalid Executable" 11624msgstr "" 11625 11626#: lazarusidestrconsts.lisinvalidexecutablemessagetext 11627#, object-pascal-format 11628msgid "The file \"%s\" is not executable." 11629msgstr "" 11630 11631#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction 11632#, object-pascal-format 11633msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." 11634msgstr "Ongeldige expressie.%sHint: De \"Make Resourcestring\" Functie verwacht een string in een enkel bestand. Selecteer de expressie en probeer het opnieuw." 11635 11636#: lazarusidestrconsts.lisinvalidfilename 11637msgid "Invalid file name" 11638msgstr "" 11639 11640#: lazarusidestrconsts.lisinvalidfilter 11641msgid "Invalid filter" 11642msgstr "" 11643 11644#: lazarusidestrconsts.lisinvalidlinecolumninmessage 11645#, object-pascal-format 11646msgid "Invalid line, column in message%s%s" 11647msgstr "" 11648 11649#: lazarusidestrconsts.lisinvalidmacrosin 11650#, object-pascal-format 11651msgid "Invalid macros in \"%s\"" 11652msgstr "" 11653 11654#: lazarusidestrconsts.lisinvalidmacrosinexternaltool 11655#, object-pascal-format 11656msgid "Invalid macros \"%s\" in external tool \"%s\"" 11657msgstr "" 11658 11659#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie 11660#, object-pascal-format 11661msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier." 11662msgstr "" 11663 11664#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword 11665#, object-pascal-format 11666msgid "Invalid macro name \"%s\". The name is a keyword." 11667msgstr "" 11668 11669#: lazarusidestrconsts.lisinvalidmask 11670msgid "Invalid Mask" 11671msgstr "" 11672 11673#: lazarusidestrconsts.lisinvalidmode 11674#, object-pascal-format 11675msgid "Invalid mode %s" 11676msgstr "" 11677 11678#: lazarusidestrconsts.lisinvalidmultiselection 11679msgid "Invalid multiselection" 11680msgstr "Ongeldige meervoudige selectie" 11681 11682#: lazarusidestrconsts.lisinvalidoff 11683msgid "Invalid (Off)" 11684msgstr "" 11685 11686#: lazarusidestrconsts.lisinvalidon 11687msgid "Invalid (On)" 11688msgstr "" 11689 11690#: lazarusidestrconsts.lisinvalidpascalidentifiercap 11691msgid "Invalid Pascal Identifier" 11692msgstr "Ongeldige Pascal Identifier" 11693 11694#: lazarusidestrconsts.lisinvalidpascalidentifiername 11695#, object-pascal-format 11696msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?" 11697msgstr "" 11698 11699#: lazarusidestrconsts.lisinvalidprocname 11700msgid "Invalid proc name" 11701msgstr "Ongeldige proc naam" 11702 11703#: lazarusidestrconsts.lisinvalidprojectfilename 11704msgid "Invalid project filename" 11705msgstr "Ongeldige project bestandsnaam" 11706 11707#: lazarusidestrconsts.lisinvalidpublishingdirectory 11708msgid "Invalid publishing Directory" 11709msgstr "" 11710 11711#: lazarusidestrconsts.lisinvalidselection 11712msgid "Invalid selection" 11713msgstr "Ongeldige selectie" 11714 11715#: lazarusidestrconsts.lisinvalidversionin 11716#, object-pascal-format 11717msgid "invalid version in %s" 11718msgstr "" 11719 11720#: lazarusidestrconsts.lisisalreadypartoftheproject 11721#, object-pascal-format 11722msgid "%s is already part of the Project." 11723msgstr "%s is al deel van het project." 11724 11725#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject 11726#, object-pascal-format, fuzzy 11727#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" 11728msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)" 11729msgstr "\"%s\" is geen geldige projectnaam.%s(Geldig is bijvoorbeeld: project1.lpi)" 11730 11731#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed 11732#, object-pascal-format 11733msgid "%s is a %s.%sThis circular dependency is not allowed." 11734msgstr "" 11735 11736#: lazarusidestrconsts.lisisddirectorynotfound 11737msgid "directory not found" 11738msgstr "" 11739 11740#: lazarusidestrconsts.lisissues 11741msgid "Issues" 11742msgstr "" 11743 11744#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe 11745#, object-pascal-format 11746msgid "I wonder how you did that. Error in the %s:" 11747msgstr "" 11748 11749#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory 11750msgid "I wonder how you did that: Error in the base directory:" 11751msgstr "" 11752 11753#: lazarusidestrconsts.lisjhjumphistory 11754#, fuzzy 11755#| msgid "Jump History ..." 11756msgctxt "lazarusidestrconsts.lisjhjumphistory" 11757msgid "Jump History" 11758msgstr "Toon Springpunt geschiedenis ..." 11759 11760#: lazarusidestrconsts.lisjumptoerror 11761msgid "Jump to error" 11762msgstr "" 11763 11764#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion 11765msgid "When an error in the sources is found at identifier completion, jump to it." 11766msgstr "" 11767 11768#: lazarusidestrconsts.lisjumptoprocedure 11769#, object-pascal-format 11770msgid "Jump to procedure %s" 11771msgstr "" 11772 11773#: lazarusidestrconsts.liskb 11774#, object-pascal-format 11775msgid "%s KB" 11776msgstr "" 11777 11778#: lazarusidestrconsts.liskeep2 11779msgid "Keep" 11780msgstr "" 11781 11782#: lazarusidestrconsts.liskeepfileopen 11783msgid "Keep converted files open in editor" 11784msgstr "" 11785 11786#: lazarusidestrconsts.liskeepfileopenhint 11787msgid "All project files will be open in editor after conversion" 11788msgstr "" 11789 11790#: lazarusidestrconsts.liskeepininstalllist 11791msgid "Keep in install list" 11792msgstr "" 11793 11794#: lazarusidestrconsts.liskeepname 11795msgid "Keep name" 11796msgstr "Houd naam" 11797 11798#: lazarusidestrconsts.liskeepopen 11799msgid "Keep open" 11800msgstr "" 11801 11802#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate 11803msgid "Keep relative indentation of multi line template" 11804msgstr "" 11805 11806#: lazarusidestrconsts.liskeepsubindentation 11807msgid "Keep indentation" 11808msgstr "" 11809 11810#: lazarusidestrconsts.liskeepthemandcontinue 11811msgid "Keep them and continue" 11812msgstr "" 11813 11814#: lazarusidestrconsts.liskey 11815msgctxt "lazarusidestrconsts.liskey" 11816msgid "Key" 11817msgstr "Toets" 11818 11819#: lazarusidestrconsts.liskeycatcustom 11820msgid "Custom commands" 11821msgstr "Aanpasbare commando's" 11822 11823#: lazarusidestrconsts.liskeycatdesigner 11824msgid "Designer commands" 11825msgstr "Designer acties" 11826 11827#: lazarusidestrconsts.liskeycatobjinspector 11828msgid "Object Inspector commands" 11829msgstr "Object Inspecteur commando's" 11830 11831#: lazarusidestrconsts.liskeyor2keysequence 11832msgid "Key (or 2 key sequence)" 11833msgstr "" 11834 11835#: lazarusidestrconsts.liskmabortbuilding 11836msgid "Abort building" 11837msgstr "" 11838 11839#: lazarusidestrconsts.liskmaddbpaddress 11840msgid "Add Address Breakpoint" 11841msgstr "" 11842 11843#: lazarusidestrconsts.liskmaddbpsource 11844msgid "Add Source Breakpoint" 11845msgstr "" 11846 11847#: lazarusidestrconsts.liskmaddbpwatchpoint 11848msgid "Add Data/WatchPoint" 11849msgstr "" 11850 11851#: lazarusidestrconsts.liskmaddwatch 11852msgctxt "lazarusidestrconsts.liskmaddwatch" 11853msgid "Add watch" 11854msgstr "" 11855 11856#: lazarusidestrconsts.liskmbuildmanymodes 11857msgid "Build many modes" 11858msgstr "" 11859 11860#: lazarusidestrconsts.liskmbuildprojectprogram 11861msgid "Build project/program" 11862msgstr "" 11863 11864#: lazarusidestrconsts.liskmchoosekeymappingscheme 11865msgid "Choose Keymapping scheme" 11866msgstr "" 11867 11868#: lazarusidestrconsts.liskmclassic 11869msgid "Classic" 11870msgstr "Klassiek" 11871 11872#: lazarusidestrconsts.liskmcleanupandbuild 11873msgctxt "lazarusidestrconsts.liskmcleanupandbuild" 11874msgid "Clean up and build" 11875msgstr "" 11876 11877#: lazarusidestrconsts.liskmcloseproject 11878msgid "Close project" 11879msgstr "Sluit project" 11880 11881#: lazarusidestrconsts.liskmcodetoolsdefineseditor 11882msgid "CodeTools defines editor" 11883msgstr "" 11884 11885#: lazarusidestrconsts.liskmcompileprojectprogram 11886msgid "Compile project/program" 11887msgstr "" 11888 11889#: lazarusidestrconsts.liskmconfigbuildfile 11890msgid "Config \"Build File\"" 11891msgstr "" 11892 11893#: lazarusidestrconsts.liskmconfigurecustomcomponents 11894msgid "Configure Custom Components" 11895msgstr "" 11896 11897#: lazarusidestrconsts.liskmcontextsensitivehelp 11898msgid "Context sensitive help" 11899msgstr "Context gevoellige help" 11900 11901#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage 11902msgid "Convert Delphi package to Lazarus package" 11903msgstr "Converteer Delphi pakket naar Lazarus pakket" 11904 11905#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject 11906#, fuzzy 11907#| msgid "Convert Delphi project to Lazarus project" 11908msgid "Convert Delphi Project to Lazarus Project" 11909msgstr "Converteer Delphi project naar Lazarus project" 11910 11911#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit 11912#, fuzzy 11913#| msgid "Convert Delphi unit to Lazarus unit" 11914msgid "Convert Delphi Unit to Lazarus Unit" 11915msgstr "Converteer Delphi unit naar Lazarus unit" 11916 11917#: lazarusidestrconsts.liskmconvertdfmfiletolfm 11918#, fuzzy 11919#| msgid "Convert DFM file to LFM" 11920msgid "Convert DFM File to LFM" 11921msgstr "Converteer DFM bestand naar LFM" 11922 11923#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard 11924msgid "Copy selected components" 11925msgstr "" 11926 11927#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard 11928msgid "Cut selected components" 11929msgstr "" 11930 11931#: lazarusidestrconsts.liskmdefaulttoosx 11932msgid "Default adapted to macOS" 11933msgstr "" 11934 11935#: lazarusidestrconsts.liskmdeletelastchar 11936msgid "Delete last char" 11937msgstr "Verwijder laatste karakter" 11938 11939#: lazarusidestrconsts.liskmdiffeditorfiles 11940msgid "Diff Editor Files" 11941msgstr "" 11942 11943#: lazarusidestrconsts.liskmeditcodetemplates 11944msgid "Edit Code Templates" 11945msgstr "Bewerk Code Templates" 11946 11947#: lazarusidestrconsts.liskmeditcontextsensitivehelp 11948msgid "Edit context sensitive help" 11949msgstr "" 11950 11951#: lazarusidestrconsts.liskmencloseselection 11952msgid "Enclose Selection" 11953msgstr "" 11954 11955#: lazarusidestrconsts.liskmevaluatemodify 11956msgid "Evaluate/Modify" 11957msgstr "Evalueer/bewerk" 11958 11959#: lazarusidestrconsts.liskmexampleprojects 11960msgid "Example Projects" 11961msgstr "" 11962 11963#: lazarusidestrconsts.liskmexternaltoolssettings 11964msgid "External Tools settings" 11965msgstr "" 11966 11967#: lazarusidestrconsts.liskmfindincremental 11968msgid "Find Incremental" 11969msgstr "" 11970 11971#: lazarusidestrconsts.liskmgotomarker0 11972#, fuzzy 11973#| msgid "Go to marker 0" 11974msgid "Go to bookmark 0" 11975msgstr "Ga naar marker 0" 11976 11977#: lazarusidestrconsts.liskmgotomarker1 11978#, fuzzy 11979#| msgid "Go to marker 1" 11980msgid "Go to bookmark 1" 11981msgstr "Ga naar marker 1" 11982 11983#: lazarusidestrconsts.liskmgotomarker2 11984#, fuzzy 11985#| msgid "Go to marker 2" 11986msgid "Go to bookmark 2" 11987msgstr "Ga naar marker 2" 11988 11989#: lazarusidestrconsts.liskmgotomarker3 11990#, fuzzy 11991#| msgid "Go to marker 3" 11992msgid "Go to bookmark 3" 11993msgstr "Ga naar marker 3" 11994 11995#: lazarusidestrconsts.liskmgotomarker4 11996#, fuzzy 11997#| msgid "Go to marker 4" 11998msgid "Go to bookmark 4" 11999msgstr "Ga naar marker 4" 12000 12001#: lazarusidestrconsts.liskmgotomarker5 12002#, fuzzy 12003#| msgid "Go to marker 5" 12004msgid "Go to bookmark 5" 12005msgstr "Ga naar marker 5" 12006 12007#: lazarusidestrconsts.liskmgotomarker6 12008#, fuzzy 12009#| msgid "Go to marker 6" 12010msgid "Go to bookmark 6" 12011msgstr "Ga naar marker 6" 12012 12013#: lazarusidestrconsts.liskmgotomarker7 12014#, fuzzy 12015#| msgid "Go to marker 7" 12016msgid "Go to bookmark 7" 12017msgstr "Ga naar marker 7" 12018 12019#: lazarusidestrconsts.liskmgotomarker8 12020#, fuzzy 12021#| msgid "Go to marker 8" 12022msgid "Go to bookmark 8" 12023msgstr "Ga naar marker 8" 12024 12025#: lazarusidestrconsts.liskmgotomarker9 12026#, fuzzy 12027#| msgid "Go to marker 9" 12028msgid "Go to bookmark 9" 12029msgstr "Ga naar marker 9" 12030 12031#: lazarusidestrconsts.liskmgotosourceeditor1 12032msgid "Go to source editor 1" 12033msgstr "" 12034 12035#: lazarusidestrconsts.liskmgotosourceeditor10 12036msgid "Go to source editor 10" 12037msgstr "" 12038 12039#: lazarusidestrconsts.liskmgotosourceeditor2 12040msgid "Go to source editor 2" 12041msgstr "" 12042 12043#: lazarusidestrconsts.liskmgotosourceeditor3 12044msgid "Go to source editor 3" 12045msgstr "" 12046 12047#: lazarusidestrconsts.liskmgotosourceeditor4 12048msgid "Go to source editor 4" 12049msgstr "" 12050 12051#: lazarusidestrconsts.liskmgotosourceeditor5 12052msgid "Go to source editor 5" 12053msgstr "" 12054 12055#: lazarusidestrconsts.liskmgotosourceeditor6 12056msgid "Go to source editor 6" 12057msgstr "" 12058 12059#: lazarusidestrconsts.liskmgotosourceeditor7 12060msgid "Go to source editor 7" 12061msgstr "" 12062 12063#: lazarusidestrconsts.liskmgotosourceeditor8 12064msgid "Go to source editor 8" 12065msgstr "" 12066 12067#: lazarusidestrconsts.liskmgotosourceeditor9 12068msgid "Go to source editor 9" 12069msgstr "" 12070 12071#: lazarusidestrconsts.liskminsertdateandtime 12072msgid "Insert date and time" 12073msgstr "Voeg datum en tijd in" 12074 12075#: lazarusidestrconsts.liskminsertusername 12076msgid "Insert username" 12077msgstr "Voeg gebruikersnaam in" 12078 12079#: lazarusidestrconsts.liskminspect 12080msgid "Inspect" 12081msgstr "Inspecteer" 12082 12083#: lazarusidestrconsts.liskmkeymappingscheme 12084msgid "Keymapping Scheme" 12085msgstr "Toets mapping schema" 12086 12087#: lazarusidestrconsts.liskmlazarusdefault 12088msgid "Lazarus default" 12089msgstr "" 12090 12091#: lazarusidestrconsts.liskmmacosxapple 12092msgid "macOS, Apple style" 12093msgstr "" 12094 12095#: lazarusidestrconsts.liskmmacosxlaz 12096msgid "macOS, Lazarus style" 12097msgstr "" 12098 12099#: lazarusidestrconsts.liskmnewpackage 12100msgid "New package" 12101msgstr "" 12102 12103#: lazarusidestrconsts.liskmnewproject 12104msgid "New project" 12105msgstr "Nieuw project" 12106 12107#: lazarusidestrconsts.liskmnewprojectfromfile 12108msgid "New project from file" 12109msgstr "Nieuw project van bestand" 12110 12111#: lazarusidestrconsts.liskmnewunit 12112#, fuzzy 12113msgctxt "lazarusidestrconsts.liskmnewunit" 12114msgid "New Unit" 12115msgstr "Nieuwe Unit" 12116 12117#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme 12118msgid "Note: All keys will be set to the values of the chosen scheme." 12119msgstr "" 12120 12121#: lazarusidestrconsts.liskmopenpackagefile 12122msgid "Open package file" 12123msgstr "Open pakket bestand" 12124 12125#: lazarusidestrconsts.liskmopenrecent 12126msgctxt "lazarusidestrconsts.liskmopenrecent" 12127msgid "Open Recent" 12128msgstr "" 12129 12130#: lazarusidestrconsts.liskmopenrecentpackage 12131msgid "Open recent package" 12132msgstr "" 12133 12134#: lazarusidestrconsts.liskmopenrecentproject 12135msgid "Open recent project" 12136msgstr "" 12137 12138#: lazarusidestrconsts.liskmpastecomponentsfromclipboard 12139#, fuzzy 12140#| msgid "Paste Components from clipboard" 12141msgid "Paste Components" 12142msgstr "Plak componenten van clipboard" 12143 12144#: lazarusidestrconsts.liskmpauseprogram 12145msgid "Pause program" 12146msgstr "Pauseer programma" 12147 12148#: lazarusidestrconsts.liskmpublishproject 12149msgid "Publish project" 12150msgstr "Publiceer project" 12151 12152#: lazarusidestrconsts.liskmquickcompilenolinking 12153msgid "Quick compile, no linking" 12154msgstr "" 12155 12156#: lazarusidestrconsts.liskmremoveactivefilefromproject 12157msgid "Remove Active File from Project" 12158msgstr "" 12159 12160#: lazarusidestrconsts.liskmrunprogram 12161msgid "Run program" 12162msgstr "Run programma" 12163 12164#: lazarusidestrconsts.liskmsaveall 12165msgid "SaveAll" 12166msgstr "" 12167 12168#: lazarusidestrconsts.liskmsaveas 12169msgid "SaveAs" 12170msgstr "" 12171 12172#: lazarusidestrconsts.liskmsaveproject 12173msgid "Save project" 12174msgstr "Sla project op" 12175 12176#: lazarusidestrconsts.liskmsaveprojectas 12177msgid "Save project as" 12178msgstr "Sla project op als" 12179 12180#: lazarusidestrconsts.liskmselectlineend 12181#, fuzzy 12182msgctxt "lazarusidestrconsts.liskmselectlineend" 12183msgid "Select Line End" 12184msgstr "Selecteer regel einde" 12185 12186#: lazarusidestrconsts.liskmselectlinestart 12187#, fuzzy 12188msgctxt "lazarusidestrconsts.liskmselectlinestart" 12189msgid "Select Line Start" 12190msgstr "Selecteer regel begin" 12191 12192#: lazarusidestrconsts.liskmselectpagebottom 12193#, fuzzy 12194msgctxt "lazarusidestrconsts.liskmselectpagebottom" 12195msgid "Select Page Bottom" 12196msgstr "Selecteer onderkant Pagina" 12197 12198#: lazarusidestrconsts.liskmselectpagetop 12199#, fuzzy 12200msgctxt "lazarusidestrconsts.liskmselectpagetop" 12201msgid "Select Page Top" 12202msgstr "Select bovenkant pagina" 12203 12204#: lazarusidestrconsts.liskmselectwordleft 12205#, fuzzy 12206msgctxt "lazarusidestrconsts.liskmselectwordleft" 12207msgid "Select Word Left" 12208msgstr "Selecteer linker woord" 12209 12210#: lazarusidestrconsts.liskmselectwordright 12211#, fuzzy 12212msgctxt "lazarusidestrconsts.liskmselectwordright" 12213msgid "Select Word Right" 12214msgstr "Selecteer rechter woord" 12215 12216#: lazarusidestrconsts.liskmsetfreebookmark 12217msgid "Set free Bookmark" 12218msgstr "" 12219 12220#: lazarusidestrconsts.liskmsetmarker0 12221#, fuzzy 12222#| msgid "Set marker 0" 12223msgid "Set bookmark 0" 12224msgstr "Zet marker 0" 12225 12226#: lazarusidestrconsts.liskmsetmarker1 12227#, fuzzy 12228#| msgid "Set marker 1" 12229msgid "Set bookmark 1" 12230msgstr "Zet marker 1" 12231 12232#: lazarusidestrconsts.liskmsetmarker2 12233#, fuzzy 12234#| msgid "Set marker 2" 12235msgid "Set bookmark 2" 12236msgstr "Zet marker 2" 12237 12238#: lazarusidestrconsts.liskmsetmarker3 12239#, fuzzy 12240#| msgid "Set marker 3" 12241msgid "Set bookmark 3" 12242msgstr "Zet marker 3" 12243 12244#: lazarusidestrconsts.liskmsetmarker4 12245#, fuzzy 12246#| msgid "Set marker 4" 12247msgid "Set bookmark 4" 12248msgstr "Zet marker 4" 12249 12250#: lazarusidestrconsts.liskmsetmarker5 12251#, fuzzy 12252#| msgid "Set marker 5" 12253msgid "Set bookmark 5" 12254msgstr "Zet marker 5" 12255 12256#: lazarusidestrconsts.liskmsetmarker6 12257#, fuzzy 12258#| msgid "Set marker 6" 12259msgid "Set bookmark 6" 12260msgstr "Zet marker 6" 12261 12262#: lazarusidestrconsts.liskmsetmarker7 12263#, fuzzy 12264#| msgid "Set marker 7" 12265msgid "Set bookmark 7" 12266msgstr "Zet marker 7" 12267 12268#: lazarusidestrconsts.liskmsetmarker8 12269#, fuzzy 12270#| msgid "Set marker 8" 12271msgid "Set bookmark 8" 12272msgstr "Zet marker 8" 12273 12274#: lazarusidestrconsts.liskmsetmarker9 12275#, fuzzy 12276#| msgid "Set marker 9" 12277msgid "Set bookmark 9" 12278msgstr "Zet marker 9" 12279 12280#: lazarusidestrconsts.liskmstopprogram 12281#, fuzzy 12282#| msgid "Stop program" 12283msgid "Stop Program" 12284msgstr "Stop programma" 12285 12286#: lazarusidestrconsts.liskmtogglebetweenunitandform 12287msgid "Toggle between Unit and Form" 12288msgstr "" 12289 12290#: lazarusidestrconsts.liskmtogglemarker0 12291msgid "Toggle bookmark 0" 12292msgstr "" 12293 12294#: lazarusidestrconsts.liskmtogglemarker1 12295msgid "Toggle bookmark 1" 12296msgstr "" 12297 12298#: lazarusidestrconsts.liskmtogglemarker2 12299msgid "Toggle bookmark 2" 12300msgstr "" 12301 12302#: lazarusidestrconsts.liskmtogglemarker3 12303msgid "Toggle bookmark 3" 12304msgstr "" 12305 12306#: lazarusidestrconsts.liskmtogglemarker4 12307msgid "Toggle bookmark 4" 12308msgstr "" 12309 12310#: lazarusidestrconsts.liskmtogglemarker5 12311msgid "Toggle bookmark 5" 12312msgstr "" 12313 12314#: lazarusidestrconsts.liskmtogglemarker6 12315msgid "Toggle bookmark 6" 12316msgstr "" 12317 12318#: lazarusidestrconsts.liskmtogglemarker7 12319msgid "Toggle bookmark 7" 12320msgstr "" 12321 12322#: lazarusidestrconsts.liskmtogglemarker8 12323msgid "Toggle bookmark 8" 12324msgstr "" 12325 12326#: lazarusidestrconsts.liskmtogglemarker9 12327msgid "Toggle bookmark 9" 12328msgstr "" 12329 12330#: lazarusidestrconsts.liskmtoggleviewassembler 12331msgctxt "lazarusidestrconsts.liskmtoggleviewassembler" 12332msgid "View Assembler" 12333msgstr "" 12334 12335#: lazarusidestrconsts.liskmtoggleviewbreakpoints 12336msgid "View Breakpoints" 12337msgstr "" 12338 12339#: lazarusidestrconsts.liskmtoggleviewcallstack 12340#, fuzzy 12341msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack" 12342msgid "View Call Stack" 12343msgstr "Toon Call Stack" 12344 12345#: lazarusidestrconsts.liskmtoggleviewcodebrowser 12346msgid "Toggle view Code Browser" 12347msgstr "" 12348 12349#: lazarusidestrconsts.liskmtoggleviewcodeexplorer 12350msgid "Toggle view Code Explorer" 12351msgstr "" 12352 12353#: lazarusidestrconsts.liskmtoggleviewcomponentpalette 12354msgid "Toggle View Component Palette" 12355msgstr "" 12356 12357#: lazarusidestrconsts.liskmtoggleviewdebugevents 12358msgid "View Debuger Event Log" 12359msgstr "" 12360 12361#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput 12362msgid "View Debugger Output" 12363msgstr "" 12364 12365#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor 12366msgid "Toggle view Documentation Editor" 12367msgstr "" 12368 12369#: lazarusidestrconsts.liskmtoggleviewhistory 12370msgctxt "lazarusidestrconsts.liskmtoggleviewhistory" 12371msgid "View History" 12372msgstr "" 12373 12374#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons 12375msgid "Toggle view IDE speed buttons" 12376msgstr "" 12377 12378#: lazarusidestrconsts.liskmtoggleviewlocalvariables 12379msgid "View Local Variables" 12380msgstr "" 12381 12382#: lazarusidestrconsts.liskmtoggleviewmessages 12383msgid "Toggle view Messages" 12384msgstr "" 12385 12386#: lazarusidestrconsts.liskmtoggleviewobjectinspector 12387msgid "Toggle view Object Inspector" 12388msgstr "" 12389 12390#: lazarusidestrconsts.liskmtoggleviewpseudoterminal 12391msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal" 12392msgid "View Console In/Output" 12393msgstr "" 12394 12395#: lazarusidestrconsts.liskmtoggleviewregisters 12396msgid "View Registers" 12397msgstr "" 12398 12399#: lazarusidestrconsts.liskmtoggleviewsearchresults 12400msgid "Toggle view Search Results" 12401msgstr "" 12402 12403#: lazarusidestrconsts.liskmtoggleviewsourceeditor 12404msgid "Toggle view Source Editor" 12405msgstr "" 12406 12407#: lazarusidestrconsts.liskmtoggleviewthreads 12408msgctxt "lazarusidestrconsts.liskmtoggleviewthreads" 12409msgid "View Threads" 12410msgstr "" 12411 12412#: lazarusidestrconsts.liskmtoggleviewwatches 12413msgid "View Watches" 12414msgstr "" 12415 12416#: lazarusidestrconsts.liskmviewjumphistory 12417msgid "View jump history" 12418msgstr "" 12419 12420#: lazarusidestrconsts.liskmviewprojectoptions 12421msgid "View project options" 12422msgstr "" 12423 12424#: lazarusidestrconsts.liskmviewprojectsource 12425msgid "View Project Source" 12426msgstr "" 12427 12428#: lazarusidestrconsts.liskmviewunitinfo 12429msgid "View Unit Info" 12430msgstr "" 12431 12432#: lazarusidestrconsts.lislastopened 12433msgid "Last opened" 12434msgstr "" 12435 12436#: lazarusidestrconsts.lislaunchingapplicationinvalid 12437msgid "Launching application invalid" 12438msgstr "Starten applicatie is ongeldig" 12439 12440#: lazarusidestrconsts.lislaunchingcmdline 12441msgid "Launching target command line" 12442msgstr "Commandoregel voor het starten van programma" 12443 12444#: lazarusidestrconsts.lislazarus 12445msgctxt "lazarusidestrconsts.lislazarus" 12446msgid "Lazarus" 12447msgstr "Lazarus" 12448 12449#: lazarusidestrconsts.lislazarusdefault 12450msgid "Lazarus Default" 12451msgstr "" 12452 12453#: lazarusidestrconsts.lislazarusdirectory 12454msgid "Lazarus directory" 12455msgstr "Lazarus directory" 12456 12457#: lazarusidestrconsts.lislazarusdiroverride 12458msgid "directory to be used as a basedirectory" 12459msgstr "" 12460 12461#: lazarusidestrconsts.lislazaruseditorv 12462#, object-pascal-format 12463msgid "Lazarus IDE v%s" 12464msgstr "" 12465 12466#: lazarusidestrconsts.lislazaruside 12467msgid "Lazarus IDE" 12468msgstr "" 12469 12470#: lazarusidestrconsts.lislazaruslanguageid 12471msgid "Lazarus language ID (e.g. en, de, br, fi)" 12472msgstr "Lazarus taal ID (en, de, fi, etc.)" 12473 12474#: lazarusidestrconsts.lislazaruslanguagename 12475msgid "Lazarus language name (e.g. english, deutsch)" 12476msgstr "Lazarus taal naam (Engels, Duits, etc.)" 12477 12478#: lazarusidestrconsts.lislazarusoptionsprojectfilename 12479msgid "lazarus [options] <project-filename>" 12480msgstr "lazarus [opties] <project-bestandsnaam>" 12481 12482#: lazarusidestrconsts.lislazbuildaboaction 12483msgctxt "lazarusidestrconsts.lislazbuildaboaction" 12484msgid "Action" 12485msgstr "" 12486 12487#: lazarusidestrconsts.lislazbuildabochooseoutputdir 12488msgid "Choose output directory of the IDE executable " 12489msgstr "" 12490 12491#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile 12492msgid "Are you sure you want to delete this build profile?" 12493msgstr "" 12494 12495#: lazarusidestrconsts.lislazbuildbuildmany 12496msgid "Build Many" 12497msgstr "" 12498 12499#: lazarusidestrconsts.lislazbuildcommonsettings 12500msgid "Common Settings" 12501msgstr "" 12502 12503#: lazarusidestrconsts.lislazbuildconfirmbuild 12504msgid "Confirm before build" 12505msgstr "" 12506 12507#: lazarusidestrconsts.lislazbuildconfirmdeletion 12508msgid "Confirm deletion" 12509msgstr "" 12510 12511#: lazarusidestrconsts.lislazbuilddebugide 12512msgid "Debug IDE" 12513msgstr "" 12514 12515#: lazarusidestrconsts.lislazbuilddefines 12516msgid "Defines" 12517msgstr "" 12518 12519#: lazarusidestrconsts.lislazbuilddefineswithoutd 12520msgid "Defines without -d" 12521msgstr "" 12522 12523#: lazarusidestrconsts.lislazbuildeditdefines 12524msgctxt "lazarusidestrconsts.lislazbuildeditdefines" 12525msgid "Edit Defines" 12526msgstr "" 12527 12528#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile 12529msgid "Edit list of defines which can be used by any profile" 12530msgstr "" 12531 12532#: lazarusidestrconsts.lislazbuilderrorwritingfile 12533msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile" 12534msgid "Error writing file" 12535msgstr "Fout bij schrijven bestand" 12536 12537#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow 12538#, object-pascal-format 12539msgid "%s%s%s%slazbuild is non interactive, aborting now." 12540msgstr "" 12541 12542#: lazarusidestrconsts.lislazbuildmanageprofiles 12543msgid "Manage Build Profiles" 12544msgstr "" 12545 12546#: lazarusidestrconsts.lislazbuildmanageprofiles2 12547msgid "Manage profiles" 12548msgstr "" 12549 12550#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile 12551msgid "Name of the active profile" 12552msgstr "" 12553 12554#: lazarusidestrconsts.lislazbuildnewprof 12555msgid "Add New Profile" 12556msgstr "" 12557 12558#: lazarusidestrconsts.lislazbuildnewprofinfo 12559msgid "Current build options will be associated with:" 12560msgstr "" 12561 12562#: lazarusidestrconsts.lislazbuildnormalide 12563msgid "Normal IDE" 12564msgstr "" 12565 12566#: lazarusidestrconsts.lislazbuildoptimizedide 12567msgid "Optimized IDE" 12568msgstr "" 12569 12570#: lazarusidestrconsts.lislazbuildoptions 12571msgid "Options:" 12572msgstr "Opties:" 12573 12574#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler 12575msgid "Options passed to compiler" 12576msgstr "" 12577 12578#: lazarusidestrconsts.lislazbuildprofile 12579msgid "Profile to build" 12580msgstr "" 12581 12582#: lazarusidestrconsts.lislazbuildrenameprof 12583msgid "Rename Profile" 12584msgstr "" 12585 12586#: lazarusidestrconsts.lislazbuildrenameprofinfo 12587msgid "New name for profile:" 12588msgstr "" 12589 12590#: lazarusidestrconsts.lislazbuildrestartafterbuild 12591msgid "Restart after building IDE" 12592msgstr "" 12593 12594#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically 12595msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically" 12596msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)" 12597msgstr "" 12598 12599#: lazarusidestrconsts.lislazbuildselectprofilestobuild 12600msgid "Select profiles to build" 12601msgstr "" 12602 12603#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding 12604msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding" 12605msgid "Show confirmation dialog when building directly from Tools menu" 12606msgstr "" 12607 12608#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline 12609msgid "Show options and defines for command line" 12610msgstr "" 12611 12612#: lazarusidestrconsts.lislazbuildtargetcpu 12613msgid "Target CPU:" 12614msgstr "Doel processor" 12615 12616#: lazarusidestrconsts.lislazbuildtargetdirectory 12617msgid "Target directory:" 12618msgstr "" 12619 12620#: lazarusidestrconsts.lislazbuildtargetos 12621msgid "Target OS:" 12622msgstr "Doel OS:" 12623 12624#: lazarusidestrconsts.lislazbuildunabletowritefile 12625#, object-pascal-format 12626msgid "Unable to write file \"%s\":%s" 12627msgstr "" 12628 12629#: lazarusidestrconsts.lislazbuildupdaterevinc 12630msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc" 12631msgid "Update revision.inc" 12632msgstr "" 12633 12634#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog 12635msgid "Update revision info in \"About Lazarus\" dialog" 12636msgstr "" 12637 12638#: lazarusidestrconsts.lislazcleanupbuildall 12639msgctxt "lazarusidestrconsts.lislazcleanupbuildall" 12640msgid "Clean Up + Build all" 12641msgstr "" 12642 12643#: lazarusidestrconsts.lislazver 12644msgid "Lazarus Version (e.g. 1.2.4)" 12645msgstr "" 12646 12647#: lazarusidestrconsts.lislclwidgettype 12648#, fuzzy 12649#| msgid "LCL Widget Type" 12650msgid "LCL widget type" 12651msgstr "LCL Widget Type" 12652 12653#: lazarusidestrconsts.lisldaddlinktoinherited 12654msgid "Add link to inherited" 12655msgstr "" 12656 12657#: lazarusidestrconsts.lisldcopyfrominherited 12658msgid "Copy from inherited" 12659msgstr "" 12660 12661#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo 12662#, object-pascal-format 12663msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s" 12664msgstr "" 12665 12666#: lazarusidestrconsts.lisldmoveentriestoinherited 12667msgid "Move entries to inherited" 12668msgstr "" 12669 12670#: lazarusidestrconsts.lisldnovalidfpdocpath 12671msgid "No valid FPDoc path" 12672msgstr "" 12673 12674#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe 12675#, object-pascal-format 12676msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." 12677msgstr "" 12678 12679#: lazarusidestrconsts.lisleft 12680msgctxt "lazarusidestrconsts.lisleft" 12681msgid "Left" 12682msgstr "Links" 12683 12684#: lazarusidestrconsts.lisleftborderspacespinedithint 12685msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." 12686msgstr "Linker randruimte. Wordt opgeteld met basis randruimte en gebruikt voor de ruimte links van het control." 12687 12688#: lazarusidestrconsts.lisleftgroupboxcaption 12689msgid "Left anchoring" 12690msgstr "Linker ankering" 12691 12692#: lazarusidestrconsts.lisleftsiblingcomboboxhint 12693#, fuzzy 12694#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)." 12695msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 12696msgstr "Dit is het verwante control waaraan de linkerzijde is verankerd. Laat het leeg voor ouders" 12697 12698#: lazarusidestrconsts.lisleftsides 12699msgid "Left sides" 12700msgstr "Linker zijden" 12701 12702#: lazarusidestrconsts.lisleftspaceequally 12703msgid "Left space equally" 12704msgstr "Linker kant evenredig verdelen" 12705 12706#: lazarusidestrconsts.lisless 12707msgctxt "lazarusidestrconsts.lisless" 12708msgid "Less" 12709msgstr "" 12710 12711#: lazarusidestrconsts.lislevels 12712msgctxt "lazarusidestrconsts.lislevels" 12713msgid "Levels" 12714msgstr "Niveaus" 12715 12716#: lazarusidestrconsts.lislfmfile 12717msgid "LFM file" 12718msgstr "LFM bestand" 12719 12720#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties 12721msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed." 12722msgstr "" 12723 12724#: lazarusidestrconsts.lislfmfilecorrupt 12725msgid "LFM file corrupt" 12726msgstr "Corrupt LFM bestand" 12727 12728#: lazarusidestrconsts.lislfmisok 12729msgid "LFM is ok" 12730msgstr "" 12731 12732#: lazarusidestrconsts.lislgplnotice 12733msgid "" 12734"<description>\n" 12735"\n" 12736"Copyright (C) <year> <name of author> <contact>\n" 12737"\n" 12738"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n" 12739"\n" 12740"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 12741"\n" 12742"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 12743msgstr "" 12744 12745#: lazarusidestrconsts.lislibrarypath 12746msgid "library path" 12747msgstr "Bibliotheek pad" 12748 12749#: lazarusidestrconsts.lislibraryprogramdescriptor 12750msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)." 12751msgstr "" 12752 12753#: lazarusidestrconsts.lisline 12754msgid "Line:" 12755msgstr "" 12756 12757#: lazarusidestrconsts.lislinelength 12758msgid "Line/Length" 12759msgstr "" 12760 12761#: lazarusidestrconsts.lislink 12762msgid "Link:" 12763msgstr "" 12764 12765#: lazarusidestrconsts.lislinkeroptions 12766msgid "linker options" 12767msgstr "Linker opties" 12768 12769#: lazarusidestrconsts.lislinktarget 12770msgid "Link target" 12771msgstr "" 12772 12773#: lazarusidestrconsts.lislistofallcasevalues 12774msgid "list of all case values" 12775msgstr "" 12776 12777#: lazarusidestrconsts.lisloadingfailed 12778#, object-pascal-format 12779msgid "Loading %s failed." 12780msgstr "" 12781 12782#: lazarusidestrconsts.lisloadmacrofrom 12783msgid "Load macro from" 12784msgstr "" 12785 12786#: lazarusidestrconsts.lislocal 12787msgid "&Local" 12788msgstr "" 12789 12790#: lazarusidestrconsts.lislocals 12791#, fuzzy 12792msgctxt "lazarusidestrconsts.lislocals" 12793msgid "Local Variables" 12794msgstr "Lokale Variabelen" 12795 12796#: lazarusidestrconsts.lislocalsdlgcopyall 12797msgid "Copy &all" 12798msgstr "" 12799 12800#: lazarusidestrconsts.lislocalsdlgcopyname 12801msgid "&Copy Name" 12802msgstr "" 12803 12804#: lazarusidestrconsts.lislocalsdlgcopynamevalue 12805msgid "Co&py Name and Value" 12806msgstr "" 12807 12808#: lazarusidestrconsts.lislocalsdlgcopyrawvalue 12809msgid "Copy &RAW Value" 12810msgstr "" 12811 12812#: lazarusidestrconsts.lislocalsdlgcopyvalue 12813msgid "C&opy Value" 12814msgstr "" 12815 12816#: lazarusidestrconsts.lislocalsnotevaluated 12817msgid "Locals not evaluated" 12818msgstr "" 12819 12820#: lazarusidestrconsts.lislogcallstack 12821msgid "Log Call Stack" 12822msgstr "" 12823 12824#: lazarusidestrconsts.lislogcallstacklimit 12825msgid "(frames limit. 0 - no limits)" 12826msgstr "" 12827 12828#: lazarusidestrconsts.lislogevalexpression 12829msgctxt "lazarusidestrconsts.lislogevalexpression" 12830msgid "Eval expression" 12831msgstr "" 12832 12833#: lazarusidestrconsts.lislogmessage 12834msgid "Log Message" 12835msgstr "" 12836 12837#: lazarusidestrconsts.lislowercasestring 12838msgid "lowercase string" 12839msgstr "" 12840 12841#: lazarusidestrconsts.lislowercasestringgivenasparameter 12842msgid "Lowercase string given as parameter." 12843msgstr "" 12844 12845#: lazarusidestrconsts.lislpicompatibilitymodecheckbox 12846msgid "Maximize compatibility of project files (LPI and LPS)" 12847msgstr "" 12848 12849#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint 12850msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions." 12851msgstr "" 12852 12853#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox 12854msgid "Maximize compatibility of package file (LPK)" 12855msgstr "" 12856 12857#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint 12858msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions." 12859msgstr "" 12860 12861#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative 12862#, object-pascal-format 12863msgid "lpk has vanished on disk. Using as alternative%s" 12864msgstr "" 12865 12866#: lazarusidestrconsts.lislpkismissing 12867msgid "lpk is missing" 12868msgstr "" 12869 12870#: lazarusidestrconsts.lislrsincludefiles 12871msgid "Lazarus resources (.lrs) include files" 12872msgstr "" 12873 12874#: lazarusidestrconsts.lismacpreferences 12875msgid "Preferences..." 12876msgstr "" 12877 12878#: lazarusidestrconsts.lismacro 12879#, object-pascal-format 12880msgid "Macro %s" 12881msgstr "" 12882 12883#: lazarusidestrconsts.lismacropromptenterdata 12884msgid "Enter data" 12885msgstr "Voer data in" 12886 12887#: lazarusidestrconsts.lismacropromptenterrunparameters 12888msgid "Enter run parameters" 12889msgstr "Voer Start parameters in" 12890 12891#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject 12892#, fuzzy 12893#| msgid "Main Unit has Uses Section containing all Units of project" 12894msgid "Main unit has Uses section containing all units of project" 12895msgstr "De hoofd unit bevat alle project units in de Uses sectie" 12896 12897#: lazarusidestrconsts.lismainunitispascalsource 12898msgid "Main unit is Pascal source" 12899msgstr "" 12900 12901#: lazarusidestrconsts.lismainunitispascalsourcehint 12902msgid "Assume Pascal even if it does not end with .pas/.pp suffix." 12903msgstr "" 12904 12905#: lazarusidestrconsts.lismakecurrent 12906msgctxt "lazarusidestrconsts.lismakecurrent" 12907msgid "Current" 12908msgstr "" 12909 12910#: lazarusidestrconsts.lismakeexe 12911msgid "Make Executable" 12912msgstr "Maak Executable" 12913 12914#: lazarusidestrconsts.lismakenotfound 12915msgid "Make not found" 12916msgstr "make niet gevonden" 12917 12918#: lazarusidestrconsts.lismakeresourcestring 12919msgid "Make ResourceString" 12920msgstr "Maak ResourceString" 12921 12922#: lazarusidestrconsts.lismakeresstrappendtosection 12923msgid "Append to section" 12924msgstr "Voeg aan einde van sectie toe" 12925 12926#: lazarusidestrconsts.lismakeresstrchooseanothername 12927#, object-pascal-format, fuzzy 12928#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." 12929msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway." 12930msgstr "De resourcestring \"%s\" bestaat al.%sKies een andere naam.%sKlik op Negeren om het toch toe te voegen." 12931 12932#: lazarusidestrconsts.lismakeresstrconversionoptions 12933msgid "Conversion Options" 12934msgstr "Conversieopties" 12935 12936#: lazarusidestrconsts.lismakeresstrcustomidentifier 12937msgid "Custom identifier" 12938msgstr "" 12939 12940#: lazarusidestrconsts.lismakeresstrdialogidentifier 12941msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier" 12942msgid "Identifier" 12943msgstr "Identifier" 12944 12945#: lazarusidestrconsts.lismakeresstridentifierlength 12946msgid "Identifier length:" 12947msgstr "Identifier lengte:" 12948 12949#: lazarusidestrconsts.lismakeresstridentifierprefix 12950msgid "Identifier prefix:" 12951msgstr "" 12952 12953#: lazarusidestrconsts.lismakeresstrinsertalphabetically 12954msgid "Insert alphabetically" 12955msgstr "Alfabetisch invoegen" 12956 12957#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive 12958msgid "Insert context sensitive" 12959msgstr "Context gevoelig invoegen" 12960 12961#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect 12962msgid "Invalid Resourcestring section" 12963msgstr "Ongeldige Resourcestring sectie" 12964 12965#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring 12966msgid "Please choose a resourcestring section from the list." 12967msgstr "" 12968 12969#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis 12970msgid "Resourcestring already exists" 12971msgstr "Resourcestring bestaat al" 12972 12973#: lazarusidestrconsts.lismakeresstrresourcestringsection 12974msgid "Resourcestring section:" 12975msgstr "Resourcestring sectie:" 12976 12977#: lazarusidestrconsts.lismakeresstrsourcepreview 12978msgid "Source preview" 12979msgstr "Bron vooruitzicht" 12980 12981#: lazarusidestrconsts.lismakeresstrstringconstantinsource 12982msgid "String constant in source" 12983msgstr "String constante in broncode" 12984 12985#: lazarusidestrconsts.lismakeresstrstringswithsamevalue 12986msgid "Strings with same value:" 12987msgstr "Strings met dezelfde waarde:" 12988 12989#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto 12990msgid "Make sure all ppu files of a package are in its output directory." 12991msgstr "" 12992 12993#: lazarusidestrconsts.lismanagesourceeditors 12994msgid "Manage Source Editors ..." 12995msgstr "" 12996 12997#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul 12998msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system." 12999msgstr "" 13000 13001#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault 13002#, object-pascal-format 13003msgid "Maximum parallel processes, 0 means default (%s)" 13004msgstr "" 13005 13006#: lazarusidestrconsts.lismaxs 13007#, object-pascal-format 13008msgid "Max %d" 13009msgstr "" 13010 13011#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage 13012#, object-pascal-format 13013msgid "%s Maybe you have to recompile the package." 13014msgstr "" 13015 13016#: lazarusidestrconsts.lismb 13017#, object-pascal-format 13018msgid "%s MB" 13019msgstr "" 13020 13021#: lazarusidestrconsts.lismeaction 13022msgctxt "lazarusidestrconsts.lismeaction" 13023msgid "Action" 13024msgstr "" 13025 13026#: lazarusidestrconsts.lismemorydump 13027msgid "Memory Dump" 13028msgstr "" 13029 13030#: lazarusidestrconsts.lismenuabortbuild 13031msgid "Abort Build" 13032msgstr "Bouwen afbreken" 13033 13034#: lazarusidestrconsts.lismenuaboutfpc 13035msgid "About FPC" 13036msgstr "" 13037 13038#: lazarusidestrconsts.lismenuaddbreakpoint 13039#, fuzzy 13040#| msgid "Add breakpoint" 13041msgid "Add &Breakpoint" 13042msgstr "Breekpunt toevoegen" 13043 13044#: lazarusidestrconsts.lismenuaddcurfiletopkg 13045msgid "Add Active File to Package ..." 13046msgstr "" 13047 13048#: lazarusidestrconsts.lismenuaddjumppointtohistory 13049#, fuzzy 13050#| msgid "Add jump point to history" 13051msgid "Add Jump Point to History" 13052msgstr "Springpunt aan geschiedenis toevoegen" 13053 13054#: lazarusidestrconsts.lismenuaddtoproject 13055#, fuzzy 13056#| msgid "Add editor file to Project" 13057msgid "Add Editor File to Project" 13058msgstr "Bewerker-bestand aan project toevoegen" 13059 13060#: lazarusidestrconsts.lismenuaddwatch 13061#, fuzzy 13062#| msgid "Add watch ..." 13063msgid "Add &Watch ..." 13064msgstr "Watch toevoegen ..." 13065 13066#: lazarusidestrconsts.lismenubeaklinesinselection 13067msgid "Break Lines in Selection" 13068msgstr "" 13069 13070#: lazarusidestrconsts.lismenubreak 13071msgid "&Break" 13072msgstr "" 13073 13074#: lazarusidestrconsts.lismenubuildfile 13075msgid "Build File" 13076msgstr "Bouw bestand" 13077 13078#: lazarusidestrconsts.lismenubuildlazarus 13079#, fuzzy 13080#| msgid "Build Lazarus with current profile" 13081msgid "Build Lazarus with Current Profile" 13082msgstr "Bouw Lazarus" 13083 13084#: lazarusidestrconsts.lismenubuildlazarusprof 13085#, object-pascal-format 13086msgid "Build Lazarus with Profile: %s" 13087msgstr "" 13088 13089#: lazarusidestrconsts.lismenuchecklfm 13090#, fuzzy 13091#| msgid "Check LFM file in editor" 13092msgid "Check LFM File in Editor" 13093msgstr "Controleer .lfm-bestand in editor" 13094 13095#: lazarusidestrconsts.lismenucleandirectory 13096#, fuzzy 13097#| msgid "Clean directory ..." 13098msgid "Clean Directory ..." 13099msgstr "Maak directory schoon ..." 13100 13101#: lazarusidestrconsts.lismenucleanupandbuild 13102msgid "Clean up and Build ..." 13103msgstr "" 13104 13105#: lazarusidestrconsts.lismenucloseall 13106#, fuzzy 13107#| msgid "Close A&ll Editor Files" 13108msgid "Close A&ll" 13109msgstr "Sluit alle editorbestanden" 13110 13111#: lazarusidestrconsts.lismenucloseeditorfile 13112msgid "&Close Editor File" 13113msgstr "" 13114 13115#: lazarusidestrconsts.lismenucloseproject 13116msgid "Close Project" 13117msgstr "Sluit project" 13118 13119#: lazarusidestrconsts.lismenucodetoolsdefineseditor 13120#, fuzzy 13121#| msgid "CodeTools defines editor ..." 13122msgid "CodeTools Defines Editor ..." 13123msgstr "CodeTools definitieseditor ..." 13124 13125#: lazarusidestrconsts.lismenucommentselection 13126#, fuzzy 13127#| msgid "Comment selection" 13128msgid "Comment Selection" 13129msgstr "Commentaarselectie" 13130 13131#: lazarusidestrconsts.lismenucomparefiles 13132msgid "Compare files ..." 13133msgstr "" 13134 13135#: lazarusidestrconsts.lismenucompilemanymodes 13136msgid "Compile many Modes ..." 13137msgstr "" 13138 13139#: lazarusidestrconsts.lismenucompletecode 13140msgctxt "lazarusidestrconsts.lismenucompletecode" 13141msgid "Complete Code" 13142msgstr "Completeer code" 13143 13144#: lazarusidestrconsts.lismenucompletecodeinteractive 13145msgid "Complete Code (with dialog)" 13146msgstr "" 13147 13148#: lazarusidestrconsts.lismenuconfigbuildfile 13149msgid "Configure Build+Run File ..." 13150msgstr "Configureer Bouw+Start bestand ..." 13151 13152#: lazarusidestrconsts.lismenuconfigcustomcomps 13153#, fuzzy 13154#| msgid "Configure custom components ..." 13155msgid "Configure Custom Components ..." 13156msgstr "Configureer aanpasbare componenten ..." 13157 13158#: lazarusidestrconsts.lismenuconfigexternaltools 13159msgid "Configure External Tools ..." 13160msgstr "" 13161 13162#: lazarusidestrconsts.lismenuconfigurebuildlazarus 13163msgid "Configure \"Build Lazarus\" ..." 13164msgstr "Configureer \"Bouw Lazarus\" ..." 13165 13166#: lazarusidestrconsts.lismenucontexthelp 13167msgid "Context sensitive Help" 13168msgstr "Contextgevoelige help" 13169 13170#: lazarusidestrconsts.lismenucontinue 13171msgid "&Continue" 13172msgstr "" 13173 13174#: lazarusidestrconsts.lismenuconvertdelphipackage 13175#, fuzzy 13176#| msgid "Convert Delphi package to Lazarus package ..." 13177msgid "Convert Delphi Package to Lazarus Package ..." 13178msgstr "Converteer Delphi pakket naar een Lazarus pakket ..." 13179 13180#: lazarusidestrconsts.lismenuconvertdelphiproject 13181#, fuzzy 13182#| msgid "Convert Delphi project to Lazarus project ..." 13183msgid "Convert Delphi Project to Lazarus Project ..." 13184msgstr "Converteer Delphi project naar een Lazarus project ..." 13185 13186#: lazarusidestrconsts.lismenuconvertdelphiunit 13187#, fuzzy 13188#| msgid "Convert Delphi unit to Lazarus unit ..." 13189msgid "Convert Delphi Unit to Lazarus Unit ..." 13190msgstr "Converteer Delphi-unit naar Lazarus-unit ..." 13191 13192#: lazarusidestrconsts.lismenuconvertdfmtolfm 13193#, fuzzy 13194#| msgid "Convert binary DFM to text LFM + check syntax ..." 13195msgid "Convert Binary DFM to Text LFM + Check Syntax ..." 13196msgstr "Converteer .dfm-bestand naar .lfm ..." 13197 13198#: lazarusidestrconsts.lismenuconvertencoding 13199msgid "Convert Encoding of Projects/Packages ..." 13200msgstr "" 13201 13202#: lazarusidestrconsts.lismenudebugwindows 13203#, fuzzy 13204#| msgid "Debug windows" 13205msgid "Debug Windows" 13206msgstr "Debug schermen" 13207 13208#: lazarusidestrconsts.lismenudelphiconversion 13209msgid "Delphi Conversion" 13210msgstr "" 13211 13212#: lazarusidestrconsts.lismenuedit 13213msgid "&Edit" 13214msgstr "B&ewerken" 13215 13216#: lazarusidestrconsts.lismenueditcodetemplates 13217msgid "Code Templates ..." 13218msgstr "Broncodesjablonen ..." 13219 13220#: lazarusidestrconsts.lismenueditcontexthelp 13221msgid "Edit context sensitive Help" 13222msgstr "Bewerk context gevoelige Help" 13223 13224#: lazarusidestrconsts.lismenueditinstallpkgs 13225#, fuzzy 13226#| msgid "Install/Uninstall packages ..." 13227msgid "Install/Uninstall Packages ..." 13228msgstr "Configureer geinstalleerde pakketten ..." 13229 13230#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging 13231#, object-pascal-format 13232msgid "Accelerator(&&) key \"%s\" needs changing" 13233msgstr "" 13234 13235#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem 13236msgid "Add a new item above selected item" 13237msgstr "" 13238 13239#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem 13240msgid "Add a new item after selected item" 13241msgstr "" 13242 13243#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem 13244msgid "Add a new item before selected item" 13245msgstr "" 13246 13247#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem 13248msgid "Add a new item below selected item" 13249msgstr "" 13250 13251#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem 13252msgid "Add a submenu at the right of selected item" 13253msgstr "" 13254 13255#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem 13256msgid "Add a submenu below selected item" 13257msgstr "" 13258 13259#: lazarusidestrconsts.lismenueditoraddfromtemplate 13260msgid "&Add from template ..." 13261msgstr "" 13262 13263#: lazarusidestrconsts.lismenueditoraddiconfroms 13264#, object-pascal-format 13265msgid "Add icon from %s" 13266msgstr "" 13267 13268#: lazarusidestrconsts.lismenueditoraddimagelisticon 13269msgid "Add imagelist &icon" 13270msgstr "" 13271 13272#: lazarusidestrconsts.lismenueditoraddmenuitem 13273msgid "Add menu item" 13274msgstr "" 13275 13276#: lazarusidestrconsts.lismenueditoraddnewitemabove 13277msgid "&Add new item above" 13278msgstr "" 13279 13280#: lazarusidestrconsts.lismenueditoraddnewitemafter 13281msgid "Add ne&w item after" 13282msgstr "" 13283 13284#: lazarusidestrconsts.lismenueditoraddnewitembefore 13285msgid "&Add new item before" 13286msgstr "" 13287 13288#: lazarusidestrconsts.lismenueditoraddnewitembelow 13289msgid "Add ne&w item below" 13290msgstr "" 13291 13292#: lazarusidestrconsts.lismenueditoraddonclickhandler 13293msgid "Add &OnClick handler" 13294msgstr "" 13295 13296#: lazarusidestrconsts.lismenueditoraddseparatorafter 13297msgid "Add separator &after" 13298msgstr "" 13299 13300#: lazarusidestrconsts.lismenueditoraddseparatorbefore 13301msgid "Add separator &before" 13302msgstr "" 13303 13304#: lazarusidestrconsts.lismenueditoraddsubmenu 13305msgid "Add submenu" 13306msgstr "" 13307 13308#: lazarusidestrconsts.lismenueditoraddsubmenubelow 13309msgid "Add &submenu below" 13310msgstr "" 13311 13312#: lazarusidestrconsts.lismenueditoraddsubmenuright 13313msgid "Add &submenu right" 13314msgstr "" 13315 13316#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved 13317#, object-pascal-format 13318msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items" 13319msgstr "" 13320 13321#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate 13322msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,," 13323msgstr "" 13324 13325#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate 13326msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,," 13327msgstr "" 13328 13329#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate 13330msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,," 13331msgstr "" 13332 13333#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate 13334msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,," 13335msgstr "" 13336 13337#: lazarusidestrconsts.lismenueditorcaption 13338msgid "Caption" 13339msgstr "" 13340 13341#: lazarusidestrconsts.lismenueditorcaptioneditemss 13342#, object-pascal-format 13343msgid "Captioned items: %s" 13344msgstr "" 13345 13346#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank 13347msgid "Caption should not be blank" 13348msgstr "" 13349 13350#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators 13351#, object-pascal-format 13352msgid "Change conflicting accelerator \"%s\"" 13353msgstr "" 13354 13355#: lazarusidestrconsts.lismenueditorchangeimagelisticon 13356msgid "Change imagelist &icon" 13357msgstr "" 13358 13359#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent 13360#, object-pascal-format 13361msgid "Change %s for %s" 13362msgstr "" 13363 13364#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts 13365#, object-pascal-format 13366msgid "Change shortcut conflict \"%s\"" 13367msgstr "" 13368 13369#: lazarusidestrconsts.lismenueditorchangetheshortcutfors 13370#, object-pascal-format 13371msgid "Change the shortCut for %s" 13372msgstr "" 13373 13374#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors 13375#, object-pascal-format 13376msgid "Change the shortCutKey2 for %s" 13377msgstr "" 13378 13379#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete 13380msgid "Choose template to delete" 13381msgstr "" 13382 13383#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert 13384msgid "Choose template to insert" 13385msgstr "" 13386 13387#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut 13388msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column" 13389msgstr "" 13390 13391#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind 13392msgid "Component is unexpected kind" 13393msgstr "" 13394 13395#: lazarusidestrconsts.lismenueditorcomponentisunnamed 13396msgid "Component is unnamed" 13397msgstr "" 13398 13399#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete 13400msgid "<conflict resolution complete>" 13401msgstr "" 13402 13403#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd 13404#, object-pascal-format 13405msgid "Conflicts found initially: %d" 13406msgstr "" 13407 13408#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels 13409#, object-pascal-format 13410msgid "Deepest nested menu level: %s" 13411msgstr "" 13412 13413#: lazarusidestrconsts.lismenueditordeleteitem 13414#, fuzzy 13415#| msgid "Delete Item" 13416msgid "&Delete item" 13417msgstr "Verwijder item" 13418 13419#: lazarusidestrconsts.lismenueditordeletemenutemplate 13420msgid "&Delete menu template ..." 13421msgstr "" 13422 13423#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate 13424msgid "Delete saved menu template" 13425msgstr "" 13426 13427#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate 13428msgid "Delete selected menu template" 13429msgstr "" 13430 13431#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems 13432msgid "Delete this item and its subitems?" 13433msgstr "" 13434 13435#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu 13436msgid "Display preview as &Popup menu" 13437msgstr "" 13438 13439#: lazarusidestrconsts.lismenueditoreditcaption 13440msgid "Edit &Caption" 13441msgstr "" 13442 13443#: lazarusidestrconsts.lismenueditoreditingcaptionofs 13444#, object-pascal-format 13445msgid "Editing Caption of %s" 13446msgstr "" 13447 13448#: lazarusidestrconsts.lismenueditoreditingsdots 13449#, object-pascal-format 13450msgid "To resolve conflict edit %s.%s" 13451msgstr "" 13452 13453#: lazarusidestrconsts.lismenueditoreditingsfors 13454#, object-pascal-format 13455msgid "Editing %s for %s" 13456msgstr "" 13457 13458#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected 13459#, object-pascal-format 13460msgid "Editing %s.%s - no menuitem selected" 13461msgstr "" 13462 13463#: lazarusidestrconsts.lismenueditorenteramenudescription 13464msgid "Enter a menu &Description:" 13465msgstr "" 13466 13467#: lazarusidestrconsts.lismenueditorenteranewshortcutfors 13468#, object-pascal-format 13469msgid "Enter a new ShortCut for %s" 13470msgstr "" 13471 13472#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors 13473#, object-pascal-format 13474msgid "Enter a new ShortCutKey2 for %s" 13475msgstr "" 13476 13477#: lazarusidestrconsts.lismenueditorexistingsavedtemplates 13478msgid "Existing saved templates" 13479msgstr "" 13480 13481#: lazarusidestrconsts.lismenueditorfurthershortcutconflict 13482msgid "Further shortcut conflict" 13483msgstr "" 13484 13485#: lazarusidestrconsts.lismenueditorgethelptousethiseditor 13486msgid "Get help to use this editor" 13487msgstr "" 13488 13489#: lazarusidestrconsts.lismenueditorgrabkey 13490msgid "&Grab key" 13491msgstr "" 13492 13493#: lazarusidestrconsts.lismenueditorgroupindexd 13494#, object-pascal-format 13495msgid "GroupIndex: %d" 13496msgstr "" 13497 13498#: lazarusidestrconsts.lismenueditorgroupindexvaluess 13499#, object-pascal-format 13500msgid "Values in use: %s" 13501msgstr "" 13502 13503#: lazarusidestrconsts.lismenueditorinadequatedescription 13504msgid "Inadequate Description" 13505msgstr "" 13506 13507#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs 13508#, object-pascal-format 13509msgid "Insert menu template into root of %s" 13510msgstr "" 13511 13512#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate 13513msgid "Insert selected menu template" 13514msgstr "" 13515 13516#: lazarusidestrconsts.lismenueditorisnotassigned 13517msgid "is not assigned" 13518msgstr "" 13519 13520#: lazarusidestrconsts.lismenueditoritemswithicons 13521#, object-pascal-format 13522msgid "Items with icon: %s" 13523msgstr "" 13524 13525#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators 13526#, object-pascal-format 13527msgid "List shortcuts and &accelerators for %s ..." 13528msgstr "" 13529 13530#: lazarusidestrconsts.lismenueditorlistshortcutsfors 13531#, object-pascal-format 13532msgid "List shortcuts for %s ..." 13533msgstr "" 13534 13535#: lazarusidestrconsts.lismenueditormenueditor 13536msgid "Menu Editor" 13537msgstr "Menu editor" 13538 13539#: lazarusidestrconsts.lismenueditormenuitemactions 13540msgid "Menu Item actions" 13541msgstr "" 13542 13543#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins 13544#, object-pascal-format 13545msgid "Menuitem shortcut conflicts in %s" 13546msgstr "" 13547 13548#: lazarusidestrconsts.lismenueditormovedown 13549msgid "Move Down (or right)" 13550msgstr "Beweeg omlaag (of naar rechts)" 13551 13552#: lazarusidestrconsts.lismenueditormoveitemdown 13553msgid "Mo&ve item down" 13554msgstr "" 13555 13556#: lazarusidestrconsts.lismenueditormoveitemleft 13557msgid "&Move item left" 13558msgstr "" 13559 13560#: lazarusidestrconsts.lismenueditormoveitemright 13561msgid "Mo&ve item right" 13562msgstr "" 13563 13564#: lazarusidestrconsts.lismenueditormoveitemup 13565msgid "&Move item up" 13566msgstr "" 13567 13568#: lazarusidestrconsts.lismenueditormoveselecteditemdown 13569msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown" 13570msgid "Move selected item down" 13571msgstr "" 13572 13573#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft 13574msgid "Move selected item to the left" 13575msgstr "" 13576 13577#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright 13578msgid "Move selected item to the right" 13579msgstr "" 13580 13581#: lazarusidestrconsts.lismenueditormoveselecteditemup 13582msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup" 13583msgid "Move selected item up" 13584msgstr "" 13585 13586#: lazarusidestrconsts.lismenueditormoveup 13587msgid "Move Up (or left)" 13588msgstr "Beweeg omhoog (of naar links)" 13589 13590#: lazarusidestrconsts.lismenueditorna 13591msgid "n/a" 13592msgstr "" 13593 13594#: lazarusidestrconsts.lismenueditornomenuselected 13595msgid "(no menu selected)" 13596msgstr "" 13597 13598#: lazarusidestrconsts.lismenueditornone 13599msgid "<none>" 13600msgstr "" 13601 13602#: lazarusidestrconsts.lismenueditornonenone 13603msgid "<none>,<none>" 13604msgstr "" 13605 13606#: lazarusidestrconsts.lismenueditornoshortcutconflicts 13607msgid "<no shortcut conflicts>" 13608msgstr "" 13609 13610#: lazarusidestrconsts.lismenueditornousersavedtemplates 13611msgid "No user-saved templates" 13612msgstr "" 13613 13614#: lazarusidestrconsts.lismenueditorpickaniconfroms 13615#, object-pascal-format 13616msgid "Pick an icon from %s" 13617msgstr "" 13618 13619#: lazarusidestrconsts.lismenueditorpopupassignmentss 13620#, object-pascal-format 13621msgid "Popup assignments: %s" 13622msgstr "" 13623 13624#: lazarusidestrconsts.lismenueditorradioitem 13625msgid "RadioItem" 13626msgstr "" 13627 13628#: lazarusidestrconsts.lismenueditorremainingconflictss 13629#, object-pascal-format 13630msgid "Remaining conflicts: %s" 13631msgstr "" 13632 13633#: lazarusidestrconsts.lismenueditorremoveallseparators 13634msgid "&Remove all separators" 13635msgstr "" 13636 13637#: lazarusidestrconsts.lismenueditorresolvedconflictss 13638#, object-pascal-format 13639msgid "Resolved conflicts: %s" 13640msgstr "" 13641 13642#: lazarusidestrconsts.lismenueditorresolveselectedconflict 13643msgid "Resolve selected conflict" 13644msgstr "" 13645 13646#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts 13647msgid "&Resolve shortcut conflicts ..." 13648msgstr "" 13649 13650#: lazarusidestrconsts.lismenueditorsavedtemplates 13651msgid "Saved templates" 13652msgstr "" 13653 13654#: lazarusidestrconsts.lismenueditorsavemenuasatemplate 13655msgid "&Save menu as a template ..." 13656msgstr "" 13657 13658#: lazarusidestrconsts.lismenueditorsavemenuastemplate 13659msgid "Save menu as template" 13660msgstr "" 13661 13662#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse 13663msgid "Save menu as template for future use" 13664msgstr "" 13665 13666#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate 13667msgid "Save menu shown as a new template" 13668msgstr "" 13669 13670#: lazarusidestrconsts.lismenueditorsconflictswiths 13671#, object-pascal-format 13672msgid "%s conflicts with %s" 13673msgstr "" 13674 13675#: lazarusidestrconsts.lismenueditorseparators 13676msgid "Se¶tors" 13677msgstr "" 13678 13679#: lazarusidestrconsts.lismenueditorshortcutitemss 13680#, object-pascal-format 13681msgid "Shortcut items: %s" 13682msgstr "" 13683 13684#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged 13685msgid "Shortcut not yet changed" 13686msgstr "" 13687 13688#: lazarusidestrconsts.lismenueditorshortcuts 13689msgid "Shortcuts" 13690msgstr "" 13691 13692#: lazarusidestrconsts.lismenueditorshortcuts2 13693msgid "Shortc&uts" 13694msgstr "" 13695 13696#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys 13697msgid "Shortcuts and Accelerator keys" 13698msgstr "" 13699 13700#: lazarusidestrconsts.lismenueditorshortcutsd 13701#, object-pascal-format 13702msgid "Shortcuts (%d)" 13703msgstr "" 13704 13705#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd 13706#, object-pascal-format 13707msgid "Shortcuts (%d) and Accelerator keys (%d)" 13708msgstr "" 13709 13710#: lazarusidestrconsts.lismenueditorshortcutsourceproperty 13711msgid "Shortcut,Source Property" 13712msgstr "" 13713 13714#: lazarusidestrconsts.lismenueditorshortcutsusedins 13715#, object-pascal-format 13716msgid "Shortcuts used in %s" 13717msgstr "" 13718 13719#: lazarusidestrconsts.lismenueditorshortcutsusedinsd 13720#, object-pascal-format 13721msgid "Shortcuts used in %s (%d)" 13722msgstr "" 13723 13724#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil 13725msgid "ShowMenuEditor: TMenu parameter is nil" 13726msgstr "" 13727 13728#: lazarusidestrconsts.lismenueditorsins 13729#, object-pascal-format 13730msgid "\"%s\" in %s" 13731msgstr "" 13732 13733#: lazarusidestrconsts.lismenueditorsisalreadyinuse 13734#, object-pascal-format 13735msgid "" 13736"\"%s\" is already in use in %s as a shortcut.\n" 13737"Try a different shortcut." 13738msgstr "" 13739 13740#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand 13741#, object-pascal-format 13742msgid "Please expand: \"%s\" is not a sufficient Description" 13743msgstr "" 13744 13745#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar 13746msgid "Some widgetsets do not allow separators in the main menubar" 13747msgstr "" 13748 13749#: lazarusidestrconsts.lismenueditorsshortcuts 13750#, object-pascal-format 13751msgid "%s: Shortcuts" 13752msgstr "" 13753 13754#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys 13755#, object-pascal-format 13756msgid "%s: Shortcuts and accelerator keys" 13757msgstr "" 13758 13759#: lazarusidestrconsts.lismenueditorsssonclicks 13760#, object-pascal-format 13761msgid "%s.%s.%s - OnClick: %s" 13762msgstr "" 13763 13764#: lazarusidestrconsts.lismenueditorssubmenu 13765#, object-pascal-format 13766msgid "%s submenu" 13767msgstr "" 13768 13769#: lazarusidestrconsts.lismenueditorstandardtemplates 13770msgid "Standard templates" 13771msgstr "" 13772 13773#: lazarusidestrconsts.lismenueditortemplatedescription 13774msgid "Template description:" 13775msgstr "" 13776 13777#: lazarusidestrconsts.lismenueditortemplates 13778msgid "&Templates" 13779msgstr "" 13780 13781#: lazarusidestrconsts.lismenueditortemplatesaved 13782msgid "Template saved" 13783msgstr "" 13784 13785#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates 13786msgid "" 13787"There are no user-saved menu templates.\n" 13788"\n" 13789"Only standard default templates are available." 13790msgstr "" 13791 13792#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis 13793#, object-pascal-format 13794msgid "TSCList.GetScanListCompName: invalid index %d for FScanList" 13795msgstr "" 13796 13797#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict 13798#, object-pascal-format 13799msgid "" 13800"You have to change the shortcut from %s\n" 13801"to avoid a conflict" 13802msgstr "" 13803 13804#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption 13805msgid "You must enter text for the Caption" 13806msgstr "" 13807 13808#: lazarusidestrconsts.lismenuencloseinifdef 13809msgid "Enclose in $IFDEF ..." 13810msgstr "" 13811 13812#: lazarusidestrconsts.lismenuencloseselection 13813#, fuzzy 13814#| msgid "Enclose selection ..." 13815msgid "Enclose Selection ..." 13816msgstr "Omsluit Selectie ..." 13817 13818#: lazarusidestrconsts.lismenuevaluate 13819#, fuzzy 13820#| msgid "Evaluate/Modify ..." 13821msgid "E&valuate/Modify ..." 13822msgstr "Evalueer/Wijzig ..." 13823 13824#: lazarusidestrconsts.lismenuexampleprojects 13825msgid "Example Projects ..." 13826msgstr "" 13827 13828#: lazarusidestrconsts.lismenuextractproc 13829#, fuzzy 13830#| msgid "Extract procedure ..." 13831msgid "Extract Procedure ..." 13832msgstr "Destilleer procedure ..." 13833 13834#: lazarusidestrconsts.lismenufile 13835msgid "&File" 13836msgstr "&Bestand" 13837 13838#: lazarusidestrconsts.lismenufind 13839msgctxt "lazarusidestrconsts.lismenufind" 13840msgid "Find" 13841msgstr "Zoeken" 13842 13843#: lazarusidestrconsts.lismenufind2 13844msgid "&Find ..." 13845msgstr "" 13846 13847#: lazarusidestrconsts.lismenufindblockotherendofcodeblock 13848#, fuzzy 13849#| msgid "Find other end of code block" 13850msgid "Find Other End of Code Block" 13851msgstr "Spring naar eind code blok" 13852 13853#: lazarusidestrconsts.lismenufindcodeblockstart 13854#, fuzzy 13855#| msgid "Find code block start" 13856msgid "Find Start of Code Block" 13857msgstr "Spring naar begin code blok " 13858 13859#: lazarusidestrconsts.lismenufinddeclarationatcursor 13860#, fuzzy 13861#| msgid "Find Declaration at cursor" 13862msgid "Find Declaration at Cursor" 13863msgstr "Zoek Declaraties (op cursor)" 13864 13865#: lazarusidestrconsts.lismenufindidentifierrefs 13866msgid "Find Identifier References ..." 13867msgstr "Zoek Identifier Referenties ..." 13868 13869#: lazarusidestrconsts.lismenufindinfiles 13870#, fuzzy 13871#| msgid "Find &in files ..." 13872msgid "Find &in Files ..." 13873msgstr "Zoek in &Bestanden ..." 13874 13875#: lazarusidestrconsts.lismenufindnext 13876msgid "Find &Next" 13877msgstr "Zoek &Volgende" 13878 13879#: lazarusidestrconsts.lismenufindprevious 13880msgid "Find &Previous" 13881msgstr "Zoek V&orige" 13882 13883#: lazarusidestrconsts.lismenufindreferencesofusedunit 13884msgid "Find References Of Used Unit" 13885msgstr "" 13886 13887#: lazarusidestrconsts.lismenugeneraloptions 13888msgid "Options ..." 13889msgstr "" 13890 13891#: lazarusidestrconsts.lismenugotoincludedirective 13892#, fuzzy 13893#| msgid "Goto include directive" 13894msgid "Goto Include Directive" 13895msgstr "Ga naar include directive" 13896 13897#: lazarusidestrconsts.lismenugotoline 13898#, fuzzy 13899#| msgid "Goto line ..." 13900msgid "Goto Line ..." 13901msgstr "Ga naar lijn ..." 13902 13903#: lazarusidestrconsts.lismenuguessmisplacedifdef 13904#, fuzzy 13905#| msgid "Guess misplaced IFDEF/ENDIF" 13906msgid "Guess Misplaced IFDEF/ENDIF" 13907msgstr "Corrigeer verkeerde IFDEF/ENDIF" 13908 13909#: lazarusidestrconsts.lismenuguessunclosedblock 13910#, fuzzy 13911#| msgid "Guess unclosed block" 13912msgid "Guess Unclosed Block" 13913msgstr "Corrigeer open blok" 13914 13915#: lazarusidestrconsts.lismenuhelp 13916msgid "&Help" 13917msgstr "&Help" 13918 13919#: lazarusidestrconsts.lismenuideinternals 13920msgid "IDE Internals" 13921msgstr "" 13922 13923#: lazarusidestrconsts.lismenuincrementalfind 13924msgid "Incremental Find" 13925msgstr "Incrementeel Zoeken" 13926 13927#: lazarusidestrconsts.lismenuindentselection 13928#, fuzzy 13929#| msgid "Indent selection" 13930msgid "Indent Selection" 13931msgstr "Selectie Inspringen" 13932 13933#: lazarusidestrconsts.lismenuinsertchangelogentry 13934#, fuzzy 13935#| msgid "ChangeLog entry" 13936msgid "ChangeLog Entry" 13937msgstr "ChangeLog bericht" 13938 13939#: lazarusidestrconsts.lismenuinsertcharacter 13940#, fuzzy 13941#| msgid "Insert from Character Map" 13942msgid "Insert from Character Map ..." 13943msgstr "Invoegen van Karakter Map" 13944 13945#: lazarusidestrconsts.lismenuinsertcvskeyword 13946#, fuzzy 13947#| msgid "Insert CVS keyword" 13948msgid "Insert CVS Keyword" 13949msgstr "CVS-sleutelwoord" 13950 13951#: lazarusidestrconsts.lismenuinsertdatetime 13952#, fuzzy 13953#| msgid "Current date and time" 13954msgid "Current Date and Time" 13955msgstr "Huidige datum en tijd" 13956 13957#: lazarusidestrconsts.lismenuinsertfilename 13958msgid "Insert Full Filename ..." 13959msgstr "" 13960 13961#: lazarusidestrconsts.lismenuinsertgeneral 13962#, fuzzy 13963#| msgid "General" 13964msgctxt "lazarusidestrconsts.lismenuinsertgeneral" 13965msgid "Insert General" 13966msgstr "Algemeen" 13967 13968#: lazarusidestrconsts.lismenuinsertgplnotice 13969#, fuzzy 13970#| msgid "GPL notice" 13971msgid "GPL Notice" 13972msgstr "GPL bericht" 13973 13974#: lazarusidestrconsts.lismenuinsertgplnoticetranslated 13975msgid "GPL Notice (translated)" 13976msgstr "" 13977 13978#: lazarusidestrconsts.lismenuinsertlgplnotice 13979#, fuzzy 13980#| msgid "LGPL notice" 13981msgid "LGPL Notice" 13982msgstr "LGPL melding" 13983 13984#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated 13985msgid "LGPL Notice (translated)" 13986msgstr "" 13987 13988#: lazarusidestrconsts.lismenuinsertmitnotice 13989msgid "MIT Notice" 13990msgstr "" 13991 13992#: lazarusidestrconsts.lismenuinsertmitnoticetranslated 13993msgid "MIT Notice (translated)" 13994msgstr "" 13995 13996#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice 13997msgid "Modified LGPL Notice" 13998msgstr "" 13999 14000#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated 14001msgid "Modified LGPL Notice (translated)" 14002msgstr "" 14003 14004#: lazarusidestrconsts.lismenuinsertusername 14005#, fuzzy 14006#| msgid "Current username" 14007msgid "Current Username" 14008msgstr "Huidige username" 14009 14010#: lazarusidestrconsts.lismenuinspect 14011#, fuzzy 14012#| msgid "Inspect ..." 14013msgctxt "lazarusidestrconsts.lismenuinspect" 14014msgid "&Inspect ..." 14015msgstr "Inspecteer ..." 14016 14017#: lazarusidestrconsts.lismenujumpback 14018#, fuzzy 14019#| msgid "Jump back" 14020msgid "Jump Back" 14021msgstr "Spring terug" 14022 14023#: lazarusidestrconsts.lismenujumpforward 14024#, fuzzy 14025#| msgid "Jump forward" 14026msgid "Jump Forward" 14027msgstr "Spring voorwaarts" 14028 14029#: lazarusidestrconsts.lismenujumpto 14030msgid "Jump to" 14031msgstr "Spring naar" 14032 14033#: lazarusidestrconsts.lismenujumptoimplementation 14034msgid "Jump to Implementation" 14035msgstr "" 14036 14037#: lazarusidestrconsts.lismenujumptoimplementationuses 14038msgid "Jump to Implementation uses" 14039msgstr "" 14040 14041#: lazarusidestrconsts.lismenujumptoinitialization 14042msgid "Jump to Initialization" 14043msgstr "" 14044 14045#: lazarusidestrconsts.lismenujumptointerface 14046msgid "Jump to Interface" 14047msgstr "" 14048 14049#: lazarusidestrconsts.lismenujumptointerfaceuses 14050msgid "Jump to Interface uses" 14051msgstr "" 14052 14053#: lazarusidestrconsts.lismenujumptonextbookmark 14054#, fuzzy 14055#| msgid "Jump to next bookmark" 14056msgid "Jump to Next Bookmark" 14057msgstr "Spring naar volgend bookmark" 14058 14059#: lazarusidestrconsts.lismenujumptonexterror 14060#, fuzzy 14061#| msgid "Jump to next error" 14062msgid "Jump to Next Error" 14063msgstr "Spring naar volgende fout" 14064 14065#: lazarusidestrconsts.lismenujumptoprevbookmark 14066#, fuzzy 14067#| msgid "Jump to previous bookmark" 14068msgid "Jump to Previous Bookmark" 14069msgstr "Spring naar vorig bookmark" 14070 14071#: lazarusidestrconsts.lismenujumptopreverror 14072#, fuzzy 14073#| msgid "Jump to previous error" 14074msgid "Jump to Previous Error" 14075msgstr "Spring naar vorige fout" 14076 14077#: lazarusidestrconsts.lismenujumptoprocedurebegin 14078msgid "Jump to Procedure begin" 14079msgstr "" 14080 14081#: lazarusidestrconsts.lismenujumptoprocedureheader 14082msgid "Jump to Procedure header" 14083msgstr "" 14084 14085#: lazarusidestrconsts.lismenulowercaseselection 14086#, fuzzy 14087#| msgid "Lowercase selection" 14088msgid "Lowercase Selection" 14089msgstr "Wijzig selectie in kleine letters" 14090 14091#: lazarusidestrconsts.lismenumacrolistview 14092msgid "Editor Macros ..." 14093msgstr "" 14094 14095#: lazarusidestrconsts.lismenumakeresourcestring 14096msgid "Make Resource String ..." 14097msgstr "Maak Resource string ..." 14098 14099#: lazarusidestrconsts.lismenumultipaste 14100msgctxt "lazarusidestrconsts.lismenumultipaste" 14101msgid "MultiPaste ..." 14102msgstr "" 14103 14104#: lazarusidestrconsts.lismenunewcomponent 14105msgctxt "lazarusidestrconsts.lismenunewcomponent" 14106msgid "New Component" 14107msgstr "Nieuw Component" 14108 14109#: lazarusidestrconsts.lismenunewcustom 14110#, object-pascal-format 14111msgid "New %s" 14112msgstr "" 14113 14114#: lazarusidestrconsts.lismenunewform 14115msgid "New Form" 14116msgstr "Nieuwe Form" 14117 14118#: lazarusidestrconsts.lismenunewother 14119msgid "New ..." 14120msgstr "Nieuw ..." 14121 14122#: lazarusidestrconsts.lismenunewpackage 14123msgid "New Package ..." 14124msgstr "" 14125 14126#: lazarusidestrconsts.lismenunewproject 14127msgid "New Project ..." 14128msgstr "Nieuw Project ..." 14129 14130#: lazarusidestrconsts.lismenunewprojectfromfile 14131#, fuzzy 14132#| msgid "New Project from file ..." 14133msgid "New Project from File ..." 14134msgstr "Nieuw Project van bestand ..." 14135 14136#: lazarusidestrconsts.lismenunewunit 14137msgctxt "lazarusidestrconsts.lismenunewunit" 14138msgid "New Unit" 14139msgstr "Nieuwe Unit" 14140 14141#: lazarusidestrconsts.lismenuok 14142#, fuzzy 14143#| msgid "&Ok" 14144msgctxt "lazarusidestrconsts.lismenuok" 14145msgid "&OK" 14146msgstr "&Ok" 14147 14148#: lazarusidestrconsts.lismenuonlinehelp 14149msgid "Online Help" 14150msgstr "Online help" 14151 14152#: lazarusidestrconsts.lismenuopen 14153#, fuzzy 14154#| msgid "Open ..." 14155msgid "&Open ..." 14156msgstr "Openen ..." 14157 14158#: lazarusidestrconsts.lismenuopenfilenameatcursor 14159#, fuzzy 14160#| msgid "Open filename at cursor" 14161msgid "Open Filename at Cursor" 14162msgstr "Open bestandsnaam (op cursor)" 14163 14164#: lazarusidestrconsts.lismenuopenfolder 14165msgid "Open Folder ..." 14166msgstr "" 14167 14168#: lazarusidestrconsts.lismenuopenpackage 14169#, fuzzy 14170#| msgid "Open loaded package ..." 14171msgid "Open Loaded Package ..." 14172msgstr "Open een geladen Pakket ..." 14173 14174#: lazarusidestrconsts.lismenuopenpackagefile 14175#, fuzzy 14176#| msgid "Open package file (.lpk) ..." 14177msgid "Open Package File (.lpk) ..." 14178msgstr "Open Pakket bestand (.lpk) ..." 14179 14180#: lazarusidestrconsts.lismenuopenpackageofcurunit 14181#, fuzzy 14182#| msgid "Open package of current unit" 14183msgid "Open Package of Current Unit" 14184msgstr "Open Pakket van huidige unit" 14185 14186#: lazarusidestrconsts.lismenuopenproject 14187msgid "Open Project ..." 14188msgstr "Open Project ..." 14189 14190#: lazarusidestrconsts.lismenuopenrecent 14191#, fuzzy 14192#| msgid "Open &Recent ..." 14193msgid "Open &Recent" 14194msgstr "Open Recent ..." 14195 14196#: lazarusidestrconsts.lismenuopenrecentpkg 14197#, fuzzy 14198#| msgid "Open recent package" 14199msgid "Open Recent Package" 14200msgstr "Open recent pakket ..." 14201 14202#: lazarusidestrconsts.lismenuopenrecentproject 14203#, fuzzy 14204#| msgid "Open Recent Project ..." 14205msgctxt "lazarusidestrconsts.lismenuopenrecentproject" 14206msgid "Open Recent Project" 14207msgstr "Open Recent Project ..." 14208 14209#: lazarusidestrconsts.lismenuopenunit 14210msgid "Open Unit ..." 14211msgstr "" 14212 14213#: lazarusidestrconsts.lismenupackage 14214msgid "Pa&ckage" 14215msgstr "" 14216 14217#: lazarusidestrconsts.lismenupackagegraph 14218#, fuzzy 14219#| msgid "Package Graph ..." 14220msgid "Package Graph" 14221msgstr "Pakketplaatje ..." 14222 14223#: lazarusidestrconsts.lismenupackagelinks 14224msgid "Package Links ..." 14225msgstr "" 14226 14227#: lazarusidestrconsts.lismenupastefromclipboard 14228msgctxt "lazarusidestrconsts.lismenupastefromclipboard" 14229msgid "Paste from clipboard" 14230msgstr "" 14231 14232#: lazarusidestrconsts.lismenupkgnewpackagecomponent 14233msgid "New package component" 14234msgstr "" 14235 14236#: lazarusidestrconsts.lismenuprocedurelist 14237msgctxt "lazarusidestrconsts.lismenuprocedurelist" 14238msgid "Procedure List ..." 14239msgstr "Procedure lijst ..." 14240 14241#: lazarusidestrconsts.lismenuproject 14242msgid "&Project" 14243msgstr "&Project" 14244 14245#: lazarusidestrconsts.lismenuprojectinspector 14246msgid "Project Inspector" 14247msgstr "Project Inspecteur" 14248 14249#: lazarusidestrconsts.lismenuprojectoptions 14250msgid "Project Options ..." 14251msgstr "Project Opties ..." 14252 14253#: lazarusidestrconsts.lismenuprojectrun 14254#, fuzzy 14255#| msgid "Run" 14256msgctxt "lazarusidestrconsts.lismenuprojectrun" 14257msgid "&Run" 14258msgstr "Starten" 14259 14260#: lazarusidestrconsts.lismenupublishproject 14261msgid "Publish Project ..." 14262msgstr "Publiceer Project ..." 14263 14264#: lazarusidestrconsts.lismenuquickcompile 14265#, fuzzy 14266#| msgid "Quick compile" 14267msgid "Quick Compile" 14268msgstr "Snel-compilatie" 14269 14270#: lazarusidestrconsts.lismenuquicksyntaxcheck 14271#, fuzzy 14272#| msgid "Quick syntax check" 14273msgid "Quick Syntax Check" 14274msgstr "Snellere Syntaxcheck" 14275 14276#: lazarusidestrconsts.lismenuquicksyntaxcheckok 14277msgid "Quick syntax check OK" 14278msgstr "" 14279 14280#: lazarusidestrconsts.lismenuremovefromproject 14281msgid "Remove from Project ..." 14282msgstr "Verwijder van Project ..." 14283 14284#: lazarusidestrconsts.lismenurenameidentifier 14285msgid "Rename Identifier ..." 14286msgstr "Hernoem Identifier ..." 14287 14288#: lazarusidestrconsts.lismenureportingbug 14289msgctxt "lazarusidestrconsts.lismenureportingbug" 14290msgid "Reporting a Bug" 14291msgstr "" 14292 14293#: lazarusidestrconsts.lismenuresaveformswithi18n 14294msgid "Resave forms with enabled i18n" 14295msgstr "" 14296 14297#: lazarusidestrconsts.lismenurescanfpcsourcedirectory 14298#, fuzzy 14299#| msgid "Rescan FPC source directory" 14300msgid "Rescan FPC Source Directory" 14301msgstr "Lees FPC broncode directory" 14302 14303#: lazarusidestrconsts.lismenuresetdebugger 14304#, fuzzy 14305#| msgid "Reset debugger" 14306msgid "Reset Debugger" 14307msgstr "Reset debugger" 14308 14309#: lazarusidestrconsts.lismenurevert 14310msgid "Revert" 14311msgstr "Terugzetten" 14312 14313#: lazarusidestrconsts.lismenurun 14314#, fuzzy 14315msgctxt "lazarusidestrconsts.lismenurun" 14316msgid "&Run" 14317msgstr "&Starten" 14318 14319#: lazarusidestrconsts.lismenurunfile 14320msgid "Run File" 14321msgstr "Start bestand" 14322 14323#: lazarusidestrconsts.lismenurunparameters 14324#, fuzzy 14325#| msgid "Run Parameters ..." 14326msgid "Run &Parameters ..." 14327msgstr "Start Parameter ..." 14328 14329#: lazarusidestrconsts.lismenuruntocursor 14330#, fuzzy 14331#| msgid "Run to &Cursor" 14332msgctxt "lazarusidestrconsts.lismenuruntocursor" 14333msgid "Run to Cursor" 14334msgstr "Start tot cursor" 14335 14336#: lazarusidestrconsts.lismenurunwithoutdebugging 14337msgid "Run without Debugging" 14338msgstr "" 14339 14340#: lazarusidestrconsts.lismenusave 14341#, fuzzy 14342#| msgid "Save" 14343msgctxt "lazarusidestrconsts.lismenusave" 14344msgid "&Save" 14345msgstr "Opslaan" 14346 14347#: lazarusidestrconsts.lismenusaveas 14348#, fuzzy 14349#| msgid "Save As ..." 14350msgid "Save &As ..." 14351msgstr "Opslaan Als ..." 14352 14353#: lazarusidestrconsts.lismenusaveproject 14354msgid "Save Project" 14355msgstr "Project Opslaan " 14356 14357#: lazarusidestrconsts.lismenusaveprojectas 14358msgid "Save Project As ..." 14359msgstr "Project Opslaan Als ..." 14360 14361#: lazarusidestrconsts.lismenusearch 14362msgid "&Search" 14363msgstr "&Zoeken" 14364 14365#: lazarusidestrconsts.lismenuselect 14366msgid "Select" 14367msgstr "Selecteer" 14368 14369#: lazarusidestrconsts.lismenuselectall 14370#, fuzzy 14371#| msgid "Select all" 14372msgctxt "lazarusidestrconsts.lismenuselectall" 14373msgid "Select All" 14374msgstr "Selecteer Alles" 14375 14376#: lazarusidestrconsts.lismenuselectcodeblock 14377#, fuzzy 14378#| msgid "Select code block" 14379msgid "Select Code Block" 14380msgstr "Selecteer code blok" 14381 14382#: lazarusidestrconsts.lismenuselectline 14383#, fuzzy 14384#| msgid "Select line" 14385msgid "Select Line" 14386msgstr "Selecteer lijn" 14387 14388#: lazarusidestrconsts.lismenuselectparagraph 14389#, fuzzy 14390#| msgid "Select paragraph" 14391msgid "Select Paragraph" 14392msgstr "Selecteer paragraaf" 14393 14394#: lazarusidestrconsts.lismenuselecttobrace 14395#, fuzzy 14396#| msgid "Select to brace" 14397msgid "Select to Brace" 14398msgstr "Selecteer tot accolade" 14399 14400#: lazarusidestrconsts.lismenuselectword 14401#, fuzzy 14402#| msgid "Select word" 14403msgid "Select Word" 14404msgstr "Selecteer woord" 14405 14406#: lazarusidestrconsts.lismenusetfreebookmark 14407#, fuzzy 14408#| msgid "Set a free bookmark" 14409msgctxt "lazarusidestrconsts.lismenusetfreebookmark" 14410msgid "Set a Free Bookmark" 14411msgstr "Plaats een beschikbare bookmark" 14412 14413#: lazarusidestrconsts.lismenushowexecutionpoint 14414msgid "S&how Execution Point" 14415msgstr "" 14416 14417#: lazarusidestrconsts.lismenushowsmarthint 14418msgid "Context sensitive smart hint" 14419msgstr "" 14420 14421#: lazarusidestrconsts.lismenusortselection 14422#, fuzzy 14423#| msgid "Sort selection ..." 14424msgid "Sort Selection ..." 14425msgstr "Sorteer Selectie ..." 14426 14427#: lazarusidestrconsts.lismenusource 14428msgid "S&ource" 14429msgstr "" 14430 14431#: lazarusidestrconsts.lismenustepinto 14432#, fuzzy 14433#| msgid "Step in&to" 14434msgid "Step In&to" 14435msgstr "Step Into" 14436 14437#: lazarusidestrconsts.lismenustepintocontext 14438msgid "Step Into (Context)" 14439msgstr "" 14440 14441#: lazarusidestrconsts.lismenustepintoinstr 14442msgctxt "lazarusidestrconsts.lismenustepintoinstr" 14443msgid "Step Into Instruction" 14444msgstr "" 14445 14446#: lazarusidestrconsts.lismenustepintoinstrhint 14447msgctxt "lazarusidestrconsts.lismenustepintoinstrhint" 14448msgid "Step Into Instruction" 14449msgstr "" 14450 14451#: lazarusidestrconsts.lismenustepout 14452msgid "Step O&ut" 14453msgstr "" 14454 14455#: lazarusidestrconsts.lismenustepover 14456#, fuzzy 14457#| msgid "&Step over" 14458msgid "&Step Over" 14459msgstr "Step Over" 14460 14461#: lazarusidestrconsts.lismenustepovercontext 14462msgid "Step Over (Context)" 14463msgstr "" 14464 14465#: lazarusidestrconsts.lismenustepoverinstr 14466msgctxt "lazarusidestrconsts.lismenustepoverinstr" 14467msgid "Step Over Instruction" 14468msgstr "" 14469 14470#: lazarusidestrconsts.lismenustepoverinstrhint 14471msgctxt "lazarusidestrconsts.lismenustepoverinstrhint" 14472msgid "Step Over Instruction" 14473msgstr "" 14474 14475#: lazarusidestrconsts.lismenusteptocursor 14476msgctxt "lazarusidestrconsts.lismenusteptocursor" 14477msgid "Step over to &Cursor" 14478msgstr "" 14479 14480#: lazarusidestrconsts.lismenuswapcaseselection 14481msgid "Swap Case in Selection" 14482msgstr "" 14483 14484#: lazarusidestrconsts.lismenutabstospacesselection 14485#, fuzzy 14486#| msgid "Tabs to spaces in selection" 14487msgid "Tabs to Spaces in Selection" 14488msgstr "Tabs naar Spaties" 14489 14490#: lazarusidestrconsts.lismenutemplateabout 14491msgctxt "lazarusidestrconsts.lismenutemplateabout" 14492msgid "About" 14493msgstr "Informatie" 14494 14495#: lazarusidestrconsts.lismenutogglecomment 14496msgid "Toggle Comment in Selection" 14497msgstr "" 14498 14499#: lazarusidestrconsts.lismenutools 14500msgid "&Tools" 14501msgstr "&Hulpmiddelen" 14502 14503#: lazarusidestrconsts.lismenuuncommentselection 14504#, fuzzy 14505#| msgid "Uncomment selection" 14506msgid "Uncomment Selection" 14507msgstr "Commentaar Selectie ongedaan maken" 14508 14509#: lazarusidestrconsts.lismenuunindentselection 14510#, fuzzy 14511#| msgid "Unindent selection" 14512msgid "Unindent Selection" 14513msgstr "Selectie Inspringen ongedaan maken" 14514 14515#: lazarusidestrconsts.lismenuuppercaseselection 14516#, fuzzy 14517#| msgid "Uppercase selection" 14518msgid "Uppercase Selection" 14519msgstr "Wijzig selectie in hoofdletters" 14520 14521#: lazarusidestrconsts.lismenuuseunit 14522msgctxt "lazarusidestrconsts.lismenuuseunit" 14523msgid "Add Unit to Uses Section ..." 14524msgstr "" 14525 14526#: lazarusidestrconsts.lismenuview 14527msgid "&View" 14528msgstr "&Tonen" 14529 14530#: lazarusidestrconsts.lismenuviewanchoreditor 14531#, fuzzy 14532#| msgid "View Anchor Editor" 14533msgid "Anchor Editor" 14534msgstr "Toon Anker Bewerker" 14535 14536#: lazarusidestrconsts.lismenuviewassembler 14537msgctxt "lazarusidestrconsts.lismenuviewassembler" 14538msgid "Assembler" 14539msgstr "" 14540 14541#: lazarusidestrconsts.lismenuviewbreakpoints 14542msgid "BreakPoints" 14543msgstr "Breekpunten" 14544 14545#: lazarusidestrconsts.lismenuviewcallstack 14546msgid "Call Stack" 14547msgstr "Call Stack" 14548 14549#: lazarusidestrconsts.lismenuviewcodebrowser 14550msgctxt "lazarusidestrconsts.lismenuviewcodebrowser" 14551msgid "Code Browser" 14552msgstr "" 14553 14554#: lazarusidestrconsts.lismenuviewcodeexplorer 14555msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer" 14556msgid "Code Explorer" 14557msgstr "Codeverkenner" 14558 14559#: lazarusidestrconsts.lismenuviewcomponentpalette 14560#, fuzzy 14561#| msgid "View Component Palette" 14562msgid "Component Palette" 14563msgstr "Toon component palette" 14564 14565#: lazarusidestrconsts.lismenuviewcomponents 14566msgid "&Components" 14567msgstr "&Componenten" 14568 14569#: lazarusidestrconsts.lismenuviewdebugevents 14570msgctxt "lazarusidestrconsts.lismenuviewdebugevents" 14571msgid "Event Log" 14572msgstr "" 14573 14574#: lazarusidestrconsts.lismenuviewdebugoutput 14575#, fuzzy 14576#| msgid "Debug output" 14577msgid "Debug Output" 14578msgstr "Debugger output" 14579 14580#: lazarusidestrconsts.lismenuviewforms 14581#, fuzzy 14582#| msgid "Forms..." 14583msgid "Forms ..." 14584msgstr "Forms..." 14585 14586#: lazarusidestrconsts.lismenuviewhistory 14587msgctxt "lazarusidestrconsts.lismenuviewhistory" 14588msgid "History" 14589msgstr "" 14590 14591#: lazarusidestrconsts.lismenuviewjumphistory 14592#, fuzzy 14593#| msgid "Jump History ..." 14594msgctxt "lazarusidestrconsts.lismenuviewjumphistory" 14595msgid "Jump History" 14596msgstr "Toon Springpunt geschiedenis ..." 14597 14598#: lazarusidestrconsts.lismenuviewlocalvariables 14599msgctxt "lazarusidestrconsts.lismenuviewlocalvariables" 14600msgid "Local Variables" 14601msgstr "Lokale Variabelen" 14602 14603#: lazarusidestrconsts.lismenuviewmessages 14604msgctxt "lazarusidestrconsts.lismenuviewmessages" 14605msgid "Messages" 14606msgstr "Berichten" 14607 14608#: lazarusidestrconsts.lismenuviewobjectinspector 14609msgctxt "lazarusidestrconsts.lismenuviewobjectinspector" 14610msgid "Object Inspector" 14611msgstr "Object Inspecteur" 14612 14613#: lazarusidestrconsts.lismenuviewprojectsource 14614msgid "&View Project Source" 14615msgstr "" 14616 14617#: lazarusidestrconsts.lismenuviewpseudoterminal 14618msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal" 14619msgid "Console In/Output" 14620msgstr "" 14621 14622#: lazarusidestrconsts.lismenuviewregisters 14623msgctxt "lazarusidestrconsts.lismenuviewregisters" 14624msgid "Registers" 14625msgstr "" 14626 14627#: lazarusidestrconsts.lismenuviewrestrictionbrowser 14628msgid "Restriction Browser" 14629msgstr "" 14630 14631#: lazarusidestrconsts.lismenuviewsearchresults 14632msgid "Search Results" 14633msgstr "Zoek Resultaten" 14634 14635#: lazarusidestrconsts.lismenuviewsourceeditor 14636msgctxt "lazarusidestrconsts.lismenuviewsourceeditor" 14637msgid "Source Editor" 14638msgstr "Broncode Bewerker" 14639 14640#: lazarusidestrconsts.lismenuviewtaborder 14641msgid "Tab Order" 14642msgstr "" 14643 14644#: lazarusidestrconsts.lismenuviewthreads 14645msgctxt "lazarusidestrconsts.lismenuviewthreads" 14646msgid "Threads" 14647msgstr "" 14648 14649#: lazarusidestrconsts.lismenuviewtoggleformunit 14650#, fuzzy 14651#| msgid "Toggle form/unit view" 14652msgid "Toggle Form/Unit View" 14653msgstr "Schakel tussen Form/Unit zicht" 14654 14655#: lazarusidestrconsts.lismenuviewunitdependencies 14656#, fuzzy 14657#| msgid "Unit Dependencies ..." 14658msgctxt "lazarusidestrconsts.lismenuviewunitdependencies" 14659msgid "Unit Dependencies" 14660msgstr "Toon Unit Afhankelijkheden" 14661 14662#: lazarusidestrconsts.lismenuviewunitinfo 14663#, fuzzy 14664#| msgid "Unit Information" 14665msgid "Unit Information ..." 14666msgstr "Toon Unit informatie" 14667 14668#: lazarusidestrconsts.lismenuviewunits 14669#, fuzzy 14670#| msgid "Units..." 14671msgid "Units ..." 14672msgstr "Units..." 14673 14674#: lazarusidestrconsts.lismenuviewwatches 14675msgctxt "lazarusidestrconsts.lismenuviewwatches" 14676msgid "Watches" 14677msgstr "Watches" 14678 14679#: lazarusidestrconsts.lismenuwhatneedsbuilding 14680msgid "What Needs Building" 14681msgstr "" 14682 14683#: lazarusidestrconsts.lismenuwindow 14684msgid "&Window" 14685msgstr "" 14686 14687#: lazarusidestrconsts.lismeother 14688#, fuzzy 14689#| msgid "Other" 14690msgctxt "lazarusidestrconsts.lismeother" 14691msgid "Other tabs" 14692msgstr "Ander" 14693 14694#: lazarusidestrconsts.lismeprojects 14695msgid "Projects" 14696msgstr "" 14697 14698#: lazarusidestrconsts.lismessageseditor 14699msgid "Messages Editor" 14700msgstr "" 14701 14702#: lazarusidestrconsts.lismessageswindow 14703msgid "Messages Window" 14704msgstr "" 14705 14706#: lazarusidestrconsts.lismethodclassnotfound 14707msgid "Method class not found" 14708msgstr "" 14709 14710#: lazarusidestrconsts.lismissingdirectory 14711#, object-pascal-format 14712msgid "missing directory \"%s\"" 14713msgstr "" 14714 14715#: lazarusidestrconsts.lismissingevents 14716msgid "Missing Events" 14717msgstr "" 14718 14719#: lazarusidestrconsts.lismissingexecutable 14720#, object-pascal-format 14721msgid "missing executable \"%s\"" 14722msgstr "" 14723 14724#: lazarusidestrconsts.lismissingidentifiers 14725msgid "Missing identifiers" 14726msgstr "" 14727 14728#: lazarusidestrconsts.lismissingpackages 14729msgid "Missing Packages" 14730msgstr "Ontbrekende pakketten" 14731 14732#: lazarusidestrconsts.lismissingunitschoices 14733msgid "Your choices are:" 14734msgstr "" 14735 14736#: lazarusidestrconsts.lismissingunitscomment 14737msgid "Comment Out" 14738msgstr "" 14739 14740#: lazarusidestrconsts.lismissingunitsfordelphi 14741msgid "For Delphi only" 14742msgstr "" 14743 14744#: lazarusidestrconsts.lismissingunitsinfo1 14745msgid "1) Comment out the selected units." 14746msgstr "" 14747 14748#: lazarusidestrconsts.lismissingunitsinfo1b 14749msgid "1) Use the units only for Delphi." 14750msgstr "" 14751 14752#: lazarusidestrconsts.lismissingunitsinfo2 14753msgid "2) Search for units. Found paths are added to project settings." 14754msgstr "" 14755 14756#: lazarusidestrconsts.lismissingunitsinfo3 14757msgid "3) Abort now, install packages or fix paths and try again." 14758msgstr "" 14759 14760#: lazarusidestrconsts.lismissingunitssearch 14761msgid "Search Unit Path" 14762msgstr "" 14763 14764#: lazarusidestrconsts.lismissingunitsskip 14765msgid "Skip this Unit" 14766msgstr "" 14767 14768#: lazarusidestrconsts.lismitnotice 14769msgid "" 14770"<description>\n" 14771"\n" 14772"Copyright (c) <year> <copyright holders>\n" 14773"\n" 14774"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n" 14775"\n" 14776"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n" 14777"\n" 14778"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE." 14779msgstr "" 14780 14781#: lazarusidestrconsts.lismmadditionsandoverrides 14782msgid "Additions and Overrides" 14783msgstr "" 14784 14785#: lazarusidestrconsts.lismmaddscustomoptions 14786msgid "Adds custom options:" 14787msgstr "" 14788 14789#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag 14790msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag" 14791msgstr "" 14792 14793#: lazarusidestrconsts.lismmapplytoallpackages 14794msgid "Apply to all packages." 14795msgstr "" 14796 14797#: lazarusidestrconsts.lismmapplytoallpackagesandprojects 14798msgid "Apply to all packages and projects." 14799msgstr "" 14800 14801#: lazarusidestrconsts.lismmapplytoallpackagesmatching 14802#, object-pascal-format 14803msgid "Apply to all packages matching name \"%s\"" 14804msgstr "" 14805 14806#: lazarusidestrconsts.lismmapplytoproject 14807msgid "Apply to project." 14808msgstr "" 14809 14810#: lazarusidestrconsts.lismmcreateanewgroupofoptions 14811msgid "Create a new group of options" 14812msgstr "" 14813 14814#: lazarusidestrconsts.lismmcustomoption 14815msgid "Custom Option" 14816msgstr "" 14817 14818#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption 14819msgid "Delete the selected target or option" 14820msgstr "" 14821 14822#: lazarusidestrconsts.lismmdoesnotaddcustomoptions 14823msgid "Does not add custom options:" 14824msgstr "" 14825 14826#: lazarusidestrconsts.lismmdoesnothaveidemacro 14827#, object-pascal-format 14828msgid "Does not have IDE Macro %s:=%s" 14829msgstr "" 14830 14831#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu 14832msgid "Does not override OutDir (-FU)" 14833msgstr "" 14834 14835#: lazarusidestrconsts.lismmexcludeallpackagesmatching 14836#, object-pascal-format 14837msgid "Exclude all packages matching name \"%s\"" 14838msgstr "" 14839 14840#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound 14841#, object-pascal-format 14842msgid "expected \":=\" after macro name but found \"%s\"" 14843msgstr "" 14844 14845#: lazarusidestrconsts.lismmexpectedmacronamebutfound 14846#, object-pascal-format 14847msgid "expected macro name but found \"%s\"" 14848msgstr "" 14849 14850#: lazarusidestrconsts.lismmfromto 14851#, object-pascal-format 14852msgid "From %s to %s" 14853msgstr "" 14854 14855#: lazarusidestrconsts.lismmidemacro 14856msgid "IDE Macro" 14857msgstr "" 14858 14859#: lazarusidestrconsts.lismmidemacro2 14860#, object-pascal-format 14861msgid "IDE Macro %s:=%s" 14862msgstr "" 14863 14864#: lazarusidestrconsts.lismminvalidcharacterat 14865#, object-pascal-format 14866msgid "invalid character \"%s\" at %s" 14867msgstr "" 14868 14869#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue 14870#, object-pascal-format 14871msgid "invalid character in macro value \"%s\"" 14872msgstr "" 14873 14874#: lazarusidestrconsts.lismmmissingmacroname 14875msgid "missing macro name" 14876msgstr "" 14877 14878#: lazarusidestrconsts.lismmmoveselecteditemdown 14879msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown" 14880msgid "Move selected item down" 14881msgstr "" 14882 14883#: lazarusidestrconsts.lismmmoveselecteditemup 14884msgctxt "lazarusidestrconsts.lismmmoveselecteditemup" 14885msgid "Move selected item up" 14886msgstr "" 14887 14888#: lazarusidestrconsts.lismmnewtarget 14889msgid "New Target" 14890msgstr "" 14891 14892#: lazarusidestrconsts.lismmoverrideoutdirfu 14893#, object-pascal-format 14894msgid "Override OutDir (-FU): %s" 14895msgstr "" 14896 14897#: lazarusidestrconsts.lismmoverrideoutputdirectory 14898msgid "Override output directory (-FU)" 14899msgstr "" 14900 14901#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget 14902msgid "Override output directory -FU of target" 14903msgstr "" 14904 14905#: lazarusidestrconsts.lismmredolastundotothisgrid 14906msgid "Redo last undo to this grid" 14907msgstr "" 14908 14909#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32 14910msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32" 14911msgstr "" 14912 14913#: lazarusidestrconsts.lismmsets 14914#, object-pascal-format 14915msgid "Set \"%s\"" 14916msgstr "" 14917 14918#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml 14919msgid "Stored in IDE (environmentoptions.xml)" 14920msgstr "" 14921 14922#: lazarusidestrconsts.lismmstoredinprojectlpi 14923msgid "Stored in project (.lpi)" 14924msgstr "" 14925 14926#: lazarusidestrconsts.lismmstoredinsessionofprojectlps 14927msgid "Stored in session of project (.lps)" 14928msgstr "" 14929 14930#: lazarusidestrconsts.lismmtargets 14931msgid "Targets: " 14932msgstr "" 14933 14934#: lazarusidestrconsts.lismmundolastchangetothisgrid 14935msgid "Undo last change to this grid" 14936msgstr "" 14937 14938#: lazarusidestrconsts.lismmusesystemencoding 14939msgid "Use system encoding" 14940msgstr "" 14941 14942#: lazarusidestrconsts.lismmusesystemencodinghint 14943msgid "Disable support for UTF-8 default string encoding." 14944msgstr "" 14945 14946#: lazarusidestrconsts.lismmvalues 14947#, object-pascal-format 14948msgid "Value \"%s\"" 14949msgstr "" 14950 14951#: lazarusidestrconsts.lismmwas 14952#, object-pascal-format 14953msgid "(was \"%s\")" 14954msgstr "" 14955 14956#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject 14957msgid "WidgetSet change is available only for LCL projects" 14958msgstr "" 14959 14960#: lazarusidestrconsts.lismode 14961#, object-pascal-format 14962msgid ", Mode: %s" 14963msgstr "" 14964 14965#: lazarusidestrconsts.lismodifiedlgplnotice 14966msgid "" 14967"<description>\n" 14968"\n" 14969"Copyright (C) <year> <name of author> <contact>\n" 14970"\n" 14971"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n" 14972"\n" 14973"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n" 14974"\n" 14975"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n" 14976"\n" 14977"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA." 14978msgstr "" 14979 14980#: lazarusidestrconsts.lismodify 14981msgid "&Modify" 14982msgstr "" 14983 14984#: lazarusidestrconsts.lismore 14985msgctxt "lazarusidestrconsts.lismore" 14986msgid "More" 14987msgstr "" 14988 14989#: lazarusidestrconsts.lismoresub 14990msgctxt "lazarusidestrconsts.lismoresub" 14991msgid "More" 14992msgstr "" 14993 14994#: lazarusidestrconsts.lismove 14995msgid "Move" 14996msgstr "" 14997 14998#: lazarusidestrconsts.lismovedown 14999msgid "Move Down" 15000msgstr "" 15001 15002#: lazarusidestrconsts.lismovefiles 15003msgid "Move Files" 15004msgstr "" 15005 15006#: lazarusidestrconsts.lismovefiles2 15007msgid "Move files?" 15008msgstr "" 15009 15010#: lazarusidestrconsts.lismovefilesfromtothedirectoryof 15011#, object-pascal-format 15012msgid "Move %s file(s) from %s to the directory%s%s%sof %s?" 15013msgstr "" 15014 15015#: lazarusidestrconsts.lismoveonepositiondown 15016#, object-pascal-format 15017msgid "Move \"%s\" one position down" 15018msgstr "" 15019 15020#: lazarusidestrconsts.lismoveonepositionup 15021#, object-pascal-format 15022msgid "Move \"%s\" one position up" 15023msgstr "" 15024 15025#: lazarusidestrconsts.lismoveorcopyfiles 15026msgid "Move or Copy files?" 15027msgstr "" 15028 15029#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage 15030#, object-pascal-format 15031msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?" 15032msgstr "" 15033 15034#: lazarusidestrconsts.lismovepage 15035msgid "Move Page" 15036msgstr "" 15037 15038#: lazarusidestrconsts.lismoveselecteddown 15039msgid "Move selected item down (Ctrl+Down)" 15040msgstr "" 15041 15042#: lazarusidestrconsts.lismoveselectedup 15043msgid "Move selected item up (Ctrl+Up)" 15044msgstr "" 15045 15046#: lazarusidestrconsts.lismoveto 15047msgid "Move to: " 15048msgstr "" 15049 15050#: lazarusidestrconsts.lismoveup 15051msgid "Move Up" 15052msgstr "" 15053 15054#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa 15055msgid "Moving these units will break their uses sections. See Messages window for details." 15056msgstr "" 15057 15058#: lazarusidestrconsts.lismpcstyle 15059msgid "C style: \" => \\\"" 15060msgstr "" 15061 15062#: lazarusidestrconsts.lismpescapequotes 15063msgid "Escape "es" 15064msgstr "" 15065 15066#: lazarusidestrconsts.lismpmultipaste 15067msgctxt "lazarusidestrconsts.lismpmultipaste" 15068msgid "MultiPaste" 15069msgstr "" 15070 15071#: lazarusidestrconsts.lismppascalstyle 15072msgid "Pascal style: ' => ''" 15073msgstr "" 15074 15075#: lazarusidestrconsts.lismppasteoptions 15076msgid "Paste &options" 15077msgstr "" 15078 15079#: lazarusidestrconsts.lismppreview 15080msgid "&Preview" 15081msgstr "" 15082 15083#: lazarusidestrconsts.lismptextaftereachline 15084msgid "Text &after each line" 15085msgstr "" 15086 15087#: lazarusidestrconsts.lismptextbeforeeachline 15088msgid "Text &before each line" 15089msgstr "" 15090 15091#: lazarusidestrconsts.lismptrimclipboardcontents 15092msgid "&Trim clipboard contents" 15093msgstr "" 15094 15095#: lazarusidestrconsts.lisms 15096msgid "(ms)" 15097msgstr "" 15098 15099#: lazarusidestrconsts.lismsgcolors 15100msgid "Message colors" 15101msgstr "" 15102 15103#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons 15104msgid "Multiple directories are separated with semicolons" 15105msgstr "" 15106 15107#: lazarusidestrconsts.lismultiplepack 15108msgid ", multiple packages: " 15109msgstr "" 15110 15111#: lazarusidestrconsts.lismvsavemessagestofiletxt 15112msgid "Save messages to file (*.txt)" 15113msgstr "Berichten opslaan in bestand (*.txt)" 15114 15115#: lazarusidestrconsts.lisname 15116msgctxt "lazarusidestrconsts.lisname" 15117msgid "Name" 15118msgstr "Naam" 15119 15120#: lazarusidestrconsts.lisnameconflict 15121msgid "Name conflict" 15122msgstr "" 15123 15124#: lazarusidestrconsts.lisnameofactivebuildmode 15125msgid "Name of active build mode" 15126msgstr "" 15127 15128#: lazarusidestrconsts.lisnameofnewprocedure 15129msgid "Name of new procedure" 15130msgstr "Naam van nieuwe procedure" 15131 15132#: lazarusidestrconsts.lisnever 15133msgctxt "lazarusidestrconsts.lisnever" 15134msgid "Never" 15135msgstr "" 15136 15137#: lazarusidestrconsts.lisnew 15138msgctxt "lazarusidestrconsts.lisnew" 15139msgid "New" 15140msgstr "Nieuw" 15141 15142#: lazarusidestrconsts.lisnewclass 15143msgid "New Class" 15144msgstr "Nieuwe klasse" 15145 15146#: lazarusidestrconsts.lisnewconsoleapplication 15147msgid "New console application" 15148msgstr "" 15149 15150#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype 15151#, object-pascal-format 15152msgid "Create a new editor file.%sChoose a type." 15153msgstr "Maak een nieuw editor-bestand.%sKies een type." 15154 15155#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile 15156msgid "Create a new empty text file." 15157msgstr "Maak een nieuw leeg tekst bestand." 15158 15159#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype 15160#, object-pascal-format 15161msgid "Create a new project.%sChoose a type." 15162msgstr "Maak een nieuw project.%sKies een type." 15163 15164#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun 15165#, object-pascal-format 15166msgid "Create a new standard package.%sA package is a collection of units and components." 15167msgstr "Maak een nieuw standaard pakket.%sEen pakket is een verzameling units en componenten." 15168 15169#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule 15170msgid "Create a new unit with a datamodule." 15171msgstr "Maak een nieuwe unit met een datamodule." 15172 15173#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe 15174msgid "Create a new unit with a frame." 15175msgstr "" 15176 15177#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform 15178msgid "Create a new unit with a LCL form." 15179msgstr "Maak een nieuwe unit met een LCL-formulier." 15180 15181#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent 15182msgid "Inherit from a project form or component" 15183msgstr "" 15184 15185#: lazarusidestrconsts.lisnewdlgnoitemselected 15186msgid "No item selected" 15187msgstr "Geen item geselecteerd" 15188 15189#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst 15190msgid "Please select an item first." 15191msgstr "Selecteer eerst een item" 15192 15193#: lazarusidestrconsts.lisnewencoding 15194msgid "New encoding:" 15195msgstr "" 15196 15197#: lazarusidestrconsts.lisnewmacroname 15198#, object-pascal-format 15199msgid "Macro %d" 15200msgstr "" 15201 15202#: lazarusidestrconsts.lisnewmacroname2 15203msgid "New Macroname" 15204msgstr "" 15205 15206#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting 15207msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order." 15208msgstr "" 15209 15210#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd 15211msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last." 15212msgstr "" 15213 15214#: lazarusidestrconsts.lisnewpage 15215msgid "New page" 15216msgstr "" 15217 15218#: lazarusidestrconsts.lisnewproject 15219#, fuzzy 15220#| msgid "%s - (new project)" 15221msgid "(new project)" 15222msgstr "(nieuw project)" 15223 15224#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved 15225msgid "New recorded macros. Not to be saved" 15226msgstr "" 15227 15228#: lazarusidestrconsts.lisnewunitsareaddedtousessections 15229msgid "New units are added to uses sections" 15230msgstr "" 15231 15232#: lazarusidestrconsts.lisno 15233msgid "No" 15234msgstr "" 15235 15236#: lazarusidestrconsts.lisnoautosaveactivedesktop 15237msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually." 15238msgstr "" 15239 15240#: lazarusidestrconsts.lisnobackupfiles 15241msgid "No backup files" 15242msgstr "Geen backup bestanden" 15243 15244#: lazarusidestrconsts.lisnobuildprofilesselected 15245msgid "No profiles are selected to be built." 15246msgstr "" 15247 15248#: lazarusidestrconsts.lisnochange 15249msgid "No change" 15250msgstr "Geen wijziging" 15251 15252#: lazarusidestrconsts.lisnocodeselected 15253msgid "No code selected" 15254msgstr "Geen code geselecteerd" 15255 15256#: lazarusidestrconsts.lisnocompileroptionsinherited 15257msgid "No compiler options inherited." 15258msgstr "Geen compiler opties overgenomen." 15259 15260#: lazarusidestrconsts.lisnofppkgprefix 15261msgid "empty Free Pascal compiler prefix." 15262msgstr "" 15263 15264#: lazarusidestrconsts.lisnohints 15265msgid "no hints" 15266msgstr "" 15267 15268#: lazarusidestrconsts.lisnoidewindowselected 15269msgid "No IDE window selected" 15270msgstr "" 15271 15272#: lazarusidestrconsts.lisnolfmfile 15273msgid "No LFM file" 15274msgstr "" 15275 15276#: lazarusidestrconsts.lisnomacroselected 15277msgid "No macro selected" 15278msgstr "" 15279 15280#: lazarusidestrconsts.lisnomessageselected 15281msgid "(no message selected)" 15282msgstr "" 15283 15284#: lazarusidestrconsts.lisnoname 15285msgid "noname" 15286msgstr "geen naam" 15287 15288#: lazarusidestrconsts.lisnone 15289#, object-pascal-format 15290msgid "%snone" 15291msgstr "%sgeen" 15292 15293#: lazarusidestrconsts.lisnoneclicktochooseone 15294msgid "none, click to choose one" 15295msgstr "" 15296 15297#: lazarusidestrconsts.lisnoneselected 15298msgid "(None selected)" 15299msgstr "" 15300 15301#: lazarusidestrconsts.lisnonodeselected 15302msgid "no node selected" 15303msgstr "" 15304 15305#: lazarusidestrconsts.lisnopascalfile 15306msgid "No Pascal file" 15307msgstr "" 15308 15309#: lazarusidestrconsts.lisnoprogramfilesfound 15310#, object-pascal-format 15311msgid "No program file \"%s\" found." 15312msgstr "" 15313 15314#: lazarusidestrconsts.lisnoresourcestringsectionfound 15315msgid "No ResourceString Section found" 15316msgstr "Geen ResourceString sectie gevonden" 15317 15318#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta 15319#, fuzzy 15320#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" 15321msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" 15322msgstr "Het filter is gewoonlijk een regular expressie. In de eenvoudige syntax betekent een . een gewoon karakter, een * staat voor alles, een ? staat voor elk willekeurig karakter. Komma's en puntkomma's zijn scheidingstekens tussen alternatieven. Bijvoorbeeld: *.pas;*.pp staat voor ^(.*\\.pas|.*\\.pp)$" 15323 15324#: lazarusidestrconsts.lisnostringconstantfound 15325msgid "No string constant found" 15326msgstr "Geen string constante gevonden" 15327 15328#: lazarusidestrconsts.lisnotadesigntimepackage 15329msgid "Not a designtime package" 15330msgstr "" 15331 15332#: lazarusidestrconsts.lisnotaninstallpackage 15333msgid "Not an install package" 15334msgstr "" 15335 15336#: lazarusidestrconsts.lisnotavalidfppkgprefix 15337msgid "Free Pascal compiler not found at the given prefix." 15338msgstr "" 15339 15340#: lazarusidestrconsts.lisnotavalidpascalidentifier 15341msgid "Not a valid Pascal identifier" 15342msgstr "" 15343 15344#: lazarusidestrconsts.lisnote 15345msgctxt "lazarusidestrconsts.lisnote" 15346msgid "Note" 15347msgstr "" 15348 15349#: lazarusidestrconsts.lisnotebooktabposbottom 15350msgctxt "lazarusidestrconsts.lisnotebooktabposbottom" 15351msgid "Bottom" 15352msgstr "" 15353 15354#: lazarusidestrconsts.lisnotebooktabposleft 15355msgctxt "lazarusidestrconsts.lisnotebooktabposleft" 15356msgid "Left" 15357msgstr "Links" 15358 15359#: lazarusidestrconsts.lisnotebooktabposright 15360msgctxt "lazarusidestrconsts.lisnotebooktabposright" 15361msgid "Right" 15362msgstr "Rechts" 15363 15364#: lazarusidestrconsts.lisnotebooktabpostop 15365msgctxt "lazarusidestrconsts.lisnotebooktabpostop" 15366msgid "Top" 15367msgstr "" 15368 15369#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal 15370msgid "NOTE: Could not create Define Template for Free Pascal Sources" 15371msgstr "Opmerking: Define Template voor Free Pascal broncode kon niet gemaakt worden" 15372 15373#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources 15374msgid "NOTE: Could not create Define Template for Lazarus Sources" 15375msgstr "Opmerking: Define Template voor Lazarus broncode kon niet gemaakt worden" 15376 15377#: lazarusidestrconsts.lisnotemplateselected 15378msgid "no template selected" 15379msgstr "" 15380 15381#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated 15382#, object-pascal-format 15383msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated" 15384msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated." 15385msgstr "" 15386 15387#: lazarusidestrconsts.lisnotimplemented 15388msgid "Not implemented" 15389msgstr "" 15390 15391#: lazarusidestrconsts.lisnotimplementedyet 15392#, object-pascal-format 15393msgid "Not implemented yet:%s%s" 15394msgstr "" 15395 15396#: lazarusidestrconsts.lisnotinstalled 15397msgid "not installed" 15398msgstr "" 15399 15400#: lazarusidestrconsts.lisnotinstalledpackages 15401msgid "Not installed packages" 15402msgstr "" 15403 15404#: lazarusidestrconsts.lisnotnow 15405msgid "Not now" 15406msgstr "Niet nu" 15407 15408#: lazarusidestrconsts.lisnowloadedscheme 15409msgid "Now loaded: " 15410msgstr "" 15411 15412#: lazarusidestrconsts.lisnpcreate 15413msgid "Create" 15414msgstr "Maak" 15415 15416#: lazarusidestrconsts.lisnpcreateanewproject 15417msgid "Create a new project" 15418msgstr "Maak een nieuw project" 15419 15420#: lazarusidestrconsts.lisnumberoffilestoconvert 15421#, object-pascal-format 15422msgid "Number of files to convert: %s" 15423msgstr "" 15424 15425#: lazarusidestrconsts.lisobjectinspectorbecomesvisible 15426msgid "Object Inspector becomes visible when components are selected in designer." 15427msgstr "" 15428 15429#: lazarusidestrconsts.lisobjectpascaldefault 15430msgid "Object Pascal - default" 15431msgstr "" 15432 15433#: lazarusidestrconsts.lisobjectpath 15434msgid "object path" 15435msgstr "obectpad" 15436 15437#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab 15438msgid "Switch to Object Inspector Favorites tab" 15439msgstr "" 15440 15441#: lazarusidestrconsts.lisoff 15442msgid "? (Off)" 15443msgstr "" 15444 15445#: lazarusidestrconsts.lisofpackage 15446#, object-pascal-format 15447msgid " of package %s" 15448msgstr "" 15449 15450#: lazarusidestrconsts.lisoftheprojectinspector 15451msgid " of the Project Inspector" 15452msgstr "" 15453 15454#: lazarusidestrconsts.lisoifaddtofavoriteproperties 15455msgid "Add to favorite properties" 15456msgstr "" 15457 15458#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty 15459#, object-pascal-format 15460msgid "Choose a base class for the favorite property \"%s\"." 15461msgstr "" 15462 15463#: lazarusidestrconsts.lisoifclassnotfound 15464#, object-pascal-format, fuzzy 15465#| msgid "Class %s%s%s not found." 15466msgid "Class \"%s\" not found." 15467msgstr "Klasse \"%s\" niet gevonden." 15468 15469#: lazarusidestrconsts.lisoifremovefromfavoriteproperties 15470msgid "Remove from favorite properties" 15471msgstr "" 15472 15473#: lazarusidestrconsts.lisoipautoinstalldynamic 15474msgid "auto install dynamic" 15475msgstr "Automatisch installeren dynamisch" 15476 15477#: lazarusidestrconsts.lisoipautoinstallstatic 15478msgid "auto install static" 15479msgstr "Automatisch installeren statisch" 15480 15481#: lazarusidestrconsts.lisoipdescription 15482msgid "Description: " 15483msgstr "Beschrijving: " 15484 15485#: lazarusidestrconsts.lisoipdescriptiondescription 15486#, object-pascal-format 15487msgid "%sDescription: %s" 15488msgstr "%sBeschrijving: %s" 15489 15490#: lazarusidestrconsts.lisoipfilename 15491#, object-pascal-format 15492msgid "Filename: %s" 15493msgstr "Bestandsnaam: %s" 15494 15495#: lazarusidestrconsts.lisoipinstalleddynamic 15496msgid "installed dynamic" 15497msgstr "dynamisch geinstalleerd" 15498 15499#: lazarusidestrconsts.lisoipinstalledstatic 15500msgid "installed static" 15501msgstr "statisch geinstalleerd" 15502 15503#: lazarusidestrconsts.lisoiplicenselicense 15504#, object-pascal-format 15505msgid "%sLicense: %s" 15506msgstr "" 15507 15508#: lazarusidestrconsts.lisoipmissing 15509msgid "missing" 15510msgstr "niet aanwwezig" 15511 15512#: lazarusidestrconsts.lisoipmodified 15513msgid "modified" 15514msgstr "gewijzigd" 15515 15516#: lazarusidestrconsts.lisoipopenloadedpackage 15517#, fuzzy 15518#| msgid "Open loaded package" 15519msgid "Open Loaded Package" 15520msgstr "Open een geladen Pakket" 15521 15522#: lazarusidestrconsts.lisoippackagename 15523msgid "Package Name" 15524msgstr "Pakketnaam" 15525 15526#: lazarusidestrconsts.lisoippleaseselectapackage 15527msgid "Please select a package" 15528msgstr "Selecteer een pakket" 15529 15530#: lazarusidestrconsts.lisoipreadonly 15531msgid "readonly" 15532msgstr "niet wijzigbaar" 15533 15534#: lazarusidestrconsts.lisoipstate 15535msgctxt "lazarusidestrconsts.lisoipstate" 15536msgid "State" 15537msgstr "Status" 15538 15539#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound 15540#, object-pascal-format, fuzzy 15541#| msgid "%sThis package is installed, but the lpk file was not found" 15542msgid "%sThis package is installed but the lpk file was not found" 15543msgstr "%sDit package was geïnstalleerd, maar het lpk-bestand was niet gevonden" 15544 15545#: lazarusidestrconsts.lisok 15546msgctxt "lazarusidestrconsts.lisok" 15547msgid "OK" 15548msgstr "Ok" 15549 15550#: lazarusidestrconsts.lisoldclass 15551msgid "Old Class" 15552msgstr "Oude Klasse" 15553 15554#: lazarusidestrconsts.lison 15555msgid "? (On)" 15556msgstr "" 15557 15558#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey 15559msgid "On break line (i.e. return or enter key)" 15560msgstr "" 15561 15562#: lazarusidestrconsts.lisonlinepackage 15563msgid "available in the main repository" 15564msgstr "" 15565 15566#: lazarusidestrconsts.lisonly32bit 15567msgid "only 32bit" 15568msgstr "" 15569 15570#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden 15571msgid "Only available on Windows. Run the tool hidden." 15572msgstr "" 15573 15574#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole 15575msgid "Only available on Windows. Run tool in a new console." 15576msgstr "" 15577 15578#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression 15579msgid "Only messages fitting this regular expression:" 15580msgstr "" 15581 15582#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated 15583msgid "Only messages with these FPC IDs (comma separated):" 15584msgstr "" 15585 15586#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild 15587msgid "Only register the Lazarus package files (.lpk). Do not build." 15588msgstr "" 15589 15590#: lazarusidestrconsts.lisonlysearchforwholewords 15591msgid "Only search for whole words" 15592msgstr "Alleen hele woorden zoeken" 15593 15594#: lazarusidestrconsts.lisonpastefromclipboard 15595msgid "On paste from clipboard" 15596msgstr "" 15597 15598#: lazarusidestrconsts.lisopen 15599msgctxt "lazarusidestrconsts.lisopen" 15600msgid "Open" 15601msgstr "Openen" 15602 15603#: lazarusidestrconsts.lisopenasxmlfile 15604msgid "Open as XML file" 15605msgstr "Open als XML bestand" 15606 15607#: lazarusidestrconsts.lisopendesigneronopenunit 15608msgid "Open designer on open unit" 15609msgstr "" 15610 15611#: lazarusidestrconsts.lisopendesigneronopenunithint 15612msgid "Form is loaded in designer always when source unit is opened." 15613msgstr "" 15614 15615#: lazarusidestrconsts.lisopenexistingfile 15616msgid "Open existing file" 15617msgstr "Open bestannd bestand" 15618 15619#: lazarusidestrconsts.lisopenfile 15620#, fuzzy 15621#| msgid "Open file" 15622msgctxt "lazarusidestrconsts.lisopenfile" 15623msgid "Open File" 15624msgstr "Open bestand" 15625 15626#: lazarusidestrconsts.lisopenfile2 15627#, fuzzy 15628#| msgid "Open file" 15629msgctxt "lazarusidestrconsts.lisopenfile2" 15630msgid "Open file" 15631msgstr "Open bestand" 15632 15633#: lazarusidestrconsts.lisopenfileatcursor 15634msgid "Open file at cursor" 15635msgstr "" 15636 15637#: lazarusidestrconsts.lisopeninfileman 15638msgid "Open in file manager" 15639msgstr "" 15640 15641#: lazarusidestrconsts.lisopeninfilemanhint 15642msgid "Open destination directory in file manager" 15643msgstr "" 15644 15645#: lazarusidestrconsts.lisopenlfm 15646#, object-pascal-format 15647msgid "Open %s" 15648msgstr "Open %s" 15649 15650#: lazarusidestrconsts.lisopenpackage 15651msgid "Open Package?" 15652msgstr "Open Pakket?" 15653 15654#: lazarusidestrconsts.lisopenpackage2 15655#, object-pascal-format 15656msgid "Open package %s" 15657msgstr "" 15658 15659#: lazarusidestrconsts.lisopenpackagefile 15660msgid "Open Package File" 15661msgstr "Open Pakket bestand" 15662 15663#: lazarusidestrconsts.lisopenproject 15664msgid "Open Project?" 15665msgstr "Open Project?" 15666 15667#: lazarusidestrconsts.lisopenproject2 15668msgid "Open project" 15669msgstr "Project openen" 15670 15671#: lazarusidestrconsts.lisopenprojectagain 15672msgid "Open project again" 15673msgstr "Project opnieuw openen" 15674 15675#: lazarusidestrconsts.lisopenprojectfile 15676msgid "Open Project File" 15677msgstr "Open Project bestand" 15678 15679#: lazarusidestrconsts.lisopensymlink 15680msgid "Open symlink" 15681msgstr "" 15682 15683#: lazarusidestrconsts.lisopentarget 15684msgid "Open target" 15685msgstr "" 15686 15687#: lazarusidestrconsts.lisopenthefileasnormalsource 15688msgid "Open the file as normal source" 15689msgstr "Open het bestand als normale broncode" 15690 15691#: lazarusidestrconsts.lisopenthepackage 15692#, object-pascal-format 15693msgid "Open the package %s?" 15694msgstr "Open het pakket %s?" 15695 15696#: lazarusidestrconsts.lisopentheproject 15697#, object-pascal-format 15698msgid "Open the project %s?" 15699msgstr "Open het project %s" 15700 15701#: lazarusidestrconsts.lisopentooloptions 15702msgid "Open Tool Options" 15703msgstr "" 15704 15705#: lazarusidestrconsts.lisopenunit 15706msgid "Open Unit" 15707msgstr "" 15708 15709#: lazarusidestrconsts.lisopenurl 15710msgid "Open URL" 15711msgstr "" 15712 15713#: lazarusidestrconsts.lisopenxml 15714msgid "Open XML" 15715msgstr "" 15716 15717#: lazarusidestrconsts.lisoptions 15718#, fuzzy 15719msgctxt "lazarusidestrconsts.lisoptions" 15720msgid "Options" 15721msgstr "Opties" 15722 15723#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb 15724msgid "Options changed, recompiling clean with -B" 15725msgstr "" 15726 15727#: lazarusidestrconsts.lisoptionvalueignored 15728msgid "ignored" 15729msgstr "" 15730 15731#: lazarusidestrconsts.lisor 15732msgid "or" 15733msgstr "of" 15734 15735#: lazarusidestrconsts.lisos 15736#, object-pascal-format 15737msgid ", OS: %s" 15738msgstr "" 15739 15740#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa 15741#, object-pascal-format 15742msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path." 15743msgstr "" 15744 15745#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource 15746#, object-pascal-format 15747msgid "output directory of %s contains Pascal unit source \"%s\"" 15748msgstr "" 15749 15750#: lazarusidestrconsts.lisoutputfilenameofproject 15751msgid "Output filename of project" 15752msgstr "" 15753 15754#: lazarusidestrconsts.lisoverridelanguage 15755msgid "Override language. For example --language=de. For possible values see files in the languages directory." 15756msgstr "Overrule de ingestelde taal. Bijv. --language=nl. Voor mogelijke waardes zie de bestanden in the directorie languages" 15757 15758#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype 15759msgid "Override function result string types with the first parameter expression type" 15760msgstr "" 15761 15762#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd 15763#, object-pascal-format 15764msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" 15765msgstr "" 15766 15767#: lazarusidestrconsts.lisoverridetheprojectbuildmode 15768#, object-pascal-format 15769msgid "%soverride the project or IDE build mode." 15770msgstr "" 15771 15772#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 15773#, object-pascal-format 15774msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" 15775msgstr "" 15776 15777#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau 15778#, object-pascal-format 15779msgid "%soverride the project operating system. e.g. win32 linux. default: %s" 15780msgstr "" 15781 15782#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond 15783#, object-pascal-format 15784msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" 15785msgstr "" 15786 15787#: lazarusidestrconsts.lisoverwritefile 15788msgid "Overwrite file?" 15789msgstr "Bestand overschrijven?" 15790 15791#: lazarusidestrconsts.lisoverwritefileondisk 15792msgid "Overwrite file on disk" 15793msgstr "Bestand op disk overschrijven" 15794 15795#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot 15796msgid "'Owner' is already used by TReader/TWriter. Please choose another name." 15797msgstr "" 15798 15799#: lazarusidestrconsts.lispackage 15800msgid "Package" 15801msgstr "Pakket" 15802 15803#: lazarusidestrconsts.lispackage2 15804#, object-pascal-format 15805msgid "package %s" 15806msgstr "" 15807 15808#: lazarusidestrconsts.lispackage3 15809#, object-pascal-format 15810msgid ", package %s" 15811msgstr "" 15812 15813#: lazarusidestrconsts.lispackageinfo 15814#, fuzzy 15815#| msgid "Package Info" 15816msgid "Package info" 15817msgstr "Pakketinformatie" 15818 15819#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint 15820#, object-pascal-format 15821msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages." 15822msgstr "" 15823 15824#: lazarusidestrconsts.lispackagenamebeginswith 15825msgid "Package name begins with ..." 15826msgstr "Pakketnaam begint met ..." 15827 15828#: lazarusidestrconsts.lispackagenamecontains 15829msgid "Package name contains ..." 15830msgstr "Pakketnaam bevat ..." 15831 15832#: lazarusidestrconsts.lispackageneedsanoutputdirectory 15833msgid "Package needs an output directory." 15834msgstr "" 15835 15836#: lazarusidestrconsts.lispackageneedsinstallation 15837msgid "Package needs installation" 15838msgstr "Pakket moet geinstalleerd worden" 15839 15840#: lazarusidestrconsts.lispackageoption 15841#, object-pascal-format 15842msgid "Package \"%s\" Option" 15843msgstr "" 15844 15845#: lazarusidestrconsts.lispackageoutputdirectories 15846msgid "Package output directories" 15847msgstr "" 15848 15849#: lazarusidestrconsts.lispackagesourcedirectories 15850msgid "Package source directories" 15851msgstr "" 15852 15853#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes 15854#, object-pascal-format 15855msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s" 15856msgstr "" 15857 15858#: lazarusidestrconsts.lispackageunit 15859msgid "package unit" 15860msgstr "" 15861 15862#: lazarusidestrconsts.lispage 15863msgctxt "lazarusidestrconsts.lispage" 15864msgid "Page" 15865msgstr "" 15866 15867#: lazarusidestrconsts.lispagename 15868msgid "Page name" 15869msgstr "" 15870 15871#: lazarusidestrconsts.lispagenamealreadyexists 15872#, object-pascal-format 15873msgid "Page name \"%s\" already exists. Not added." 15874msgstr "" 15875 15876#: lazarusidestrconsts.lispanic 15877msgctxt "lazarusidestrconsts.lispanic" 15878msgid "Panic" 15879msgstr "" 15880 15881#: lazarusidestrconsts.lisparsed 15882msgid ", parsed " 15883msgstr "" 15884 15885#: lazarusidestrconsts.lisparser 15886#, object-pascal-format 15887msgid "parser \"%s\": %s" 15888msgstr "" 15889 15890#: lazarusidestrconsts.lisparsers 15891msgid "Parsers:" 15892msgstr "" 15893 15894#: lazarusidestrconsts.lispasscount 15895msgid "Pass Count" 15896msgstr "" 15897 15898#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues 15899#, object-pascal-format 15900msgid "passing compiler define \"%s\" twice with different values" 15901msgstr "" 15902 15903#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues 15904#, object-pascal-format 15905msgid "passing compiler option -%s twice with different values" 15906msgstr "" 15907 15908#: lazarusidestrconsts.lispaste 15909msgctxt "lazarusidestrconsts.lispaste" 15910msgid "Paste" 15911msgstr "Plakken" 15912 15913#: lazarusidestrconsts.lispasteclipboard 15914msgid "paste clipboard" 15915msgstr "" 15916 15917#: lazarusidestrconsts.lispastefromclipboard 15918msgctxt "lazarusidestrconsts.lispastefromclipboard" 15919msgid "Paste from clipboard." 15920msgstr "" 15921 15922#: lazarusidestrconsts.lispastelcolors 15923msgid "Pastel Colors" 15924msgstr "" 15925 15926#: lazarusidestrconsts.lispath 15927msgid "Path" 15928msgstr "" 15929 15930#: lazarusidestrconsts.lispatheditbrowse 15931msgctxt "lazarusidestrconsts.lispatheditbrowse" 15932msgid "Browse" 15933msgstr "Blader" 15934 15935#: lazarusidestrconsts.lispatheditdeleteinvalidpaths 15936msgid "Delete Invalid Paths" 15937msgstr "" 15938 15939#: lazarusidestrconsts.lispatheditmovepathdown 15940#, fuzzy 15941#| msgid "Move path down" 15942msgid "Move path down (Ctrl+Down)" 15943msgstr "Verplaats pad omlaag" 15944 15945#: lazarusidestrconsts.lispatheditmovepathup 15946#, fuzzy 15947#| msgid "Move path up" 15948msgid "Move path up (Ctrl+Up)" 15949msgstr "Verplaats pad omhoog" 15950 15951#: lazarusidestrconsts.lispatheditoraddhint 15952msgid "Add new path to the list" 15953msgstr "" 15954 15955#: lazarusidestrconsts.lispatheditordeletehint 15956msgid "Delete the selected path" 15957msgstr "" 15958 15959#: lazarusidestrconsts.lispatheditordeleteinvalidhint 15960msgid "Remove non-existent (gray) paths from the list" 15961msgstr "" 15962 15963#: lazarusidestrconsts.lispatheditorreplacehint 15964msgid "Replace the selected path with a new path" 15965msgstr "" 15966 15967#: lazarusidestrconsts.lispatheditortempladdhint 15968msgid "Add template to the list" 15969msgstr "" 15970 15971#: lazarusidestrconsts.lispatheditpathtemplates 15972msgid "Path templates" 15973msgstr "Pad templates" 15974 15975#: lazarusidestrconsts.lispatheditsearchpaths 15976msgid "Search paths:" 15977msgstr "Doorzoek paden:" 15978 15979#: lazarusidestrconsts.lispathisnodirectory 15980msgid "is not a directory" 15981msgstr "" 15982 15983#: lazarusidestrconsts.lispathoftheinstantfpccache 15984msgid "path of the instantfpc cache" 15985msgstr "" 15986 15987#: lazarusidestrconsts.lispathofthemakeutility 15988msgid "Path of the make utility" 15989msgstr "" 15990 15991#: lazarusidestrconsts.lispathtoinstance 15992msgid "Path to failed Instance:" 15993msgstr "" 15994 15995#: lazarusidestrconsts.lispause 15996msgctxt "lazarusidestrconsts.lispause" 15997msgid "Pause" 15998msgstr "Pauze" 15999 16000#: lazarusidestrconsts.lispckcleartousethepackagename 16001msgid "Clear to use the package name" 16002msgstr "" 16003 16004#: lazarusidestrconsts.lispckdisablei18noflfm 16005msgid "Disable I18N of lfm" 16006msgstr "" 16007 16008#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem 16009msgid "Add Files from File System" 16010msgstr "" 16011 16012#: lazarusidestrconsts.lispckeditaddotheritems 16013msgid "Add other items" 16014msgstr "" 16015 16016#: lazarusidestrconsts.lispckeditaddtoproject 16017#, fuzzy 16018#| msgid "Add to project" 16019msgctxt "lazarusidestrconsts.lispckeditaddtoproject" 16020msgid "Add to Project" 16021msgstr "Voeg toe aan het project" 16022 16023#: lazarusidestrconsts.lispckeditapplychanges 16024msgid "Apply changes" 16025msgstr "Wijzigingen toepassen" 16026 16027#: lazarusidestrconsts.lispckeditavailableonline 16028msgid "(available online)" 16029msgstr "" 16030 16031#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit 16032#, object-pascal-format 16033msgid "Call %sRegister%s procedure of selected unit" 16034msgstr "Aanroepen %sRegister%s procedure van de geselecteerde unit" 16035 16036#: lazarusidestrconsts.lispckeditcheckavailabilityonline 16037msgid "Check availability online" 16038msgstr "" 16039 16040#: lazarusidestrconsts.lispckeditcleanupdependencies 16041msgid "Clean up dependencies ..." 16042msgstr "" 16043 16044#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency 16045msgid "Clear default/preferred filename of dependency" 16046msgstr "" 16047 16048#: lazarusidestrconsts.lispckeditcommonoptions 16049msgid "Common" 16050msgstr "" 16051 16052#: lazarusidestrconsts.lispckeditcompileeverything 16053msgid "Compile everything?" 16054msgstr "Alles compileeren?" 16055 16056#: lazarusidestrconsts.lispckeditcompilepackage 16057msgid "Compile package" 16058msgstr "Compileer package" 16059 16060#: lazarusidestrconsts.lispckeditcompileroptionsforpackage 16061#, object-pascal-format 16062msgid "Compiler Options for Package %s" 16063msgstr "Compileropties voor Package %s" 16064 16065#: lazarusidestrconsts.lispckeditcreatefpmakefile 16066msgid "Create fpmake.pp" 16067msgstr "" 16068 16069#: lazarusidestrconsts.lispckeditcreatemakefile 16070msgctxt "lazarusidestrconsts.lispckeditcreatemakefile" 16071msgid "Create Makefile" 16072msgstr "Maak MakeFile" 16073 16074#: lazarusidestrconsts.lispckeditdefault 16075#, object-pascal-format 16076msgid "%s, default: %s" 16077msgstr "" 16078 16079#: lazarusidestrconsts.lispckeditdependencyproperties 16080msgid "Dependency Properties" 16081msgstr "" 16082 16083#: lazarusidestrconsts.lispckediteditgeneraloptions 16084#, fuzzy 16085#| msgid "Edit General Options" 16086msgid "Edit general options" 16087msgstr "Bewerk algemene opies" 16088 16089#: lazarusidestrconsts.lispckeditfileproperties 16090msgid "File Properties" 16091msgstr "Bestand eigenschappen" 16092 16093#: lazarusidestrconsts.lispckeditfpmakepackage 16094msgid "(fpmake)" 16095msgstr "" 16096 16097#: lazarusidestrconsts.lispckeditinstall 16098msgid "Install" 16099msgstr "Installeren" 16100 16101#: lazarusidestrconsts.lispckeditinvalidmaximumversion 16102msgid "Invalid maximum version" 16103msgstr "Ongeldige maximum versie" 16104 16105#: lazarusidestrconsts.lispckeditinvalidminimumversion 16106msgid "Invalid minimum version" 16107msgstr "Ongeldige minimum versie" 16108 16109#: lazarusidestrconsts.lispckeditmaximumversion 16110msgid "Maximum Version:" 16111msgstr "Maximum versie" 16112 16113#: lazarusidestrconsts.lispckeditminimumversion 16114msgid "Minimum Version:" 16115msgstr "Minimum Versie:" 16116 16117#: lazarusidestrconsts.lispckeditmodified 16118#, object-pascal-format 16119msgid "Modified: %s" 16120msgstr "Gewijzigd: %s" 16121 16122#: lazarusidestrconsts.lispckeditmovedependencydown 16123msgid "Move dependency down" 16124msgstr "Verplaats afhankelijk omlaag" 16125 16126#: lazarusidestrconsts.lispckeditmovedependencyup 16127msgid "Move dependency up" 16128msgstr "Verplaats afhankelijkheid omhoog" 16129 16130#: lazarusidestrconsts.lispckeditpackage 16131#, object-pascal-format 16132msgid "Package %s" 16133msgstr "Pakket %s" 16134 16135#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage 16136#, object-pascal-format, fuzzy 16137#| msgid "Package %s%s%s has changed.%sSave package?" 16138msgid "Package \"%s\" has changed.%sSave package?" 16139msgstr "Pakket \"%s\" is gewijzigd.%sPakket opslaan?" 16140 16141#: lazarusidestrconsts.lispckeditpackagenotsaved 16142#, object-pascal-format 16143msgid "package %s not saved" 16144msgstr "package %s niet opgeslagen" 16145 16146#: lazarusidestrconsts.lispckeditpage 16147#, object-pascal-format 16148msgid "%s, Page: %s" 16149msgstr "%s, Pagina: %s" 16150 16151#: lazarusidestrconsts.lispckeditreadddependency 16152msgid "Re-Add dependency" 16153msgstr "Voeg afhankelijkheid opnieuw toe" 16154 16155#: lazarusidestrconsts.lispckeditreaddfile 16156msgid "Re-Add file" 16157msgstr "Voeg bestand opnieuw toe" 16158 16159#: lazarusidestrconsts.lispckeditreadonly 16160#, object-pascal-format 16161msgid "Read Only: %s" 16162msgstr "Niet wijzigbaar: %s" 16163 16164#: lazarusidestrconsts.lispckeditrecompileallrequired 16165#, fuzzy 16166#| msgid "Recompile all required" 16167msgid "Recompile All Required" 16168msgstr "Hercompileer wat benodigd is" 16169 16170#: lazarusidestrconsts.lispckeditrecompileclean 16171#, fuzzy 16172#| msgid "Recompile clean" 16173msgid "Recompile Clean" 16174msgstr "Hercompileer opnieuw" 16175 16176#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages 16177msgid "Re-Compile this and all required packages?" 16178msgstr "Compileer dit opnieuw en alle benodigde Pakketten?" 16179 16180#: lazarusidestrconsts.lispckeditregisteredplugins 16181msgid "Registered plugins" 16182msgstr "Geregistreerde plugins" 16183 16184#: lazarusidestrconsts.lispckeditregisterunit 16185msgid "Register unit" 16186msgstr "Registreer unit" 16187 16188#: lazarusidestrconsts.lispckeditremovedependency 16189msgid "Remove dependency" 16190msgstr "Verwijder afhankelijkheid" 16191 16192#: lazarusidestrconsts.lispckeditremovedependency2 16193msgid "Remove Dependency?" 16194msgstr "Verwijder afhankelijkheid" 16195 16196#: lazarusidestrconsts.lispckeditremovedependencyfrompackage 16197#, object-pascal-format, fuzzy 16198#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" 16199msgid "Remove dependency \"%s\"%sfrom package \"%s\"?" 16200msgstr "Verwijder afhankelijkheid \"%s\"%suit pakket \"%s\"?" 16201 16202#: lazarusidestrconsts.lispckeditremovedfiles 16203msgid "Removed Files" 16204msgstr "" 16205 16206#: lazarusidestrconsts.lispckeditremovedrequiredpackages 16207msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages" 16208msgid "Removed required packages" 16209msgstr "Benodigde pakketten verwijderd" 16210 16211#: lazarusidestrconsts.lispckeditremovefile 16212msgid "Remove file" 16213msgstr "Verwijder bestand" 16214 16215#: lazarusidestrconsts.lispckeditremovefile2 16216msgid "Remove file?" 16217msgstr "Bestand verwijderen?" 16218 16219#: lazarusidestrconsts.lispckeditremovefilefrompackage 16220#, object-pascal-format, fuzzy 16221#| msgid "Remove file %s%s%s%sfrom package %s%s%s?" 16222msgid "Remove file \"%s\"%sfrom package \"%s\"?" 16223msgstr "Verwijder bestand \"%s\"%svan pakket \"%s\"?" 16224 16225#: lazarusidestrconsts.lispckeditremoveselecteditem 16226msgid "Remove selected item" 16227msgstr "Verwijder geselecteerde items" 16228 16229#: lazarusidestrconsts.lispckeditrequiredpackages 16230msgid "Required Packages" 16231msgstr "Benodigde Pakketten" 16232 16233#: lazarusidestrconsts.lispckeditsavepackage 16234#, fuzzy 16235#| msgid "Save package" 16236msgid "Save Package" 16237msgstr "Pakket opslaan" 16238 16239#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency 16240msgid "Store file name as default for this dependency" 16241msgstr "" 16242 16243#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency 16244msgid "Store file name as preferred for this dependency" 16245msgstr "" 16246 16247#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion 16248#, object-pascal-format, fuzzy 16249#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" 16250msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 16251msgstr "De maximum versie \"%s\" is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)" 16252 16253#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion 16254#, object-pascal-format, fuzzy 16255#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" 16256msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)" 16257msgstr "De minimum versie \"%s\" is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)" 16258 16259#: lazarusidestrconsts.lispckedituninstall 16260msgid "Uninstall" 16261msgstr "De-installeer" 16262 16263#: lazarusidestrconsts.lispckeditviewpackagesource 16264msgctxt "lazarusidestrconsts.lispckeditviewpackagesource" 16265msgid "View Package Source" 16266msgstr "Toon Pakket Bron" 16267 16268#: lazarusidestrconsts.lispckexplbase 16269msgid "Base, cannot be uninstalled" 16270msgstr "" 16271 16272#: lazarusidestrconsts.lispckexplinstalled 16273msgctxt "lazarusidestrconsts.lispckexplinstalled" 16274msgid "Installed" 16275msgstr "Geinstalleerd" 16276 16277#: lazarusidestrconsts.lispckexplinstallonnextstart 16278msgid "Install on next start" 16279msgstr "Installeer bij volgende start" 16280 16281#: lazarusidestrconsts.lispckexplstate 16282#, object-pascal-format 16283msgid "%sState: " 16284msgstr "%sStatus: " 16285 16286#: lazarusidestrconsts.lispckexpluninstallonnextstart 16287#, fuzzy 16288#| msgid "Uninstall on next start" 16289msgid "Uninstall on next start (unless needed by an installed package)" 16290msgstr "De-installeer bij volgende start" 16291 16292#: lazarusidestrconsts.lispckexpluninstallpackage 16293#, object-pascal-format 16294msgctxt "lazarusidestrconsts.lispckexpluninstallpackage" 16295msgid "Uninstall package %s" 16296msgstr "" 16297 16298#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects 16299msgid "Add options to dependent packages and projects" 16300msgstr "Opties aan pakketten en projecten toevoegen" 16301 16302#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects 16303msgid "Add paths to dependent packages/projects" 16304msgstr "Paden aan pakketten en projecten toevoegen" 16305 16306#: lazarusidestrconsts.lispckoptsauthor 16307#, fuzzy 16308#| msgid "Author:" 16309msgid "Author" 16310msgstr "Auteur:" 16311 16312#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded 16313msgid "Automatically rebuild as needed" 16314msgstr "Automatisch herbouwen wanneer nodig" 16315 16316#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall 16317msgid "Auto rebuild when rebuilding all" 16318msgstr "Automatisch herbouwen wanneer allen herbouwd worden" 16319 16320#: lazarusidestrconsts.lispckoptscustom 16321msgid "Custom" 16322msgstr "Aanpasbaar" 16323 16324#: lazarusidestrconsts.lispckoptsdescriptionabstract 16325#, fuzzy 16326#| msgid "Description/Abstract" 16327msgid "Description / Abstract" 16328msgstr "Beschrijving/Samenvatting" 16329 16330#: lazarusidestrconsts.lispckoptsdesigntime 16331msgid "Designtime" 16332msgstr "" 16333 16334#: lazarusidestrconsts.lispckoptsdesigntimeandruntime 16335#, fuzzy 16336#| msgid "Designtime and Runtime" 16337msgid "Designtime and runtime" 16338msgstr "Designtime en Runtime" 16339 16340#: lazarusidestrconsts.lispckoptsideintegration 16341msgid "IDE Integration" 16342msgstr "IDE Integratie" 16343 16344#: lazarusidestrconsts.lispckoptsinclude 16345msgid "Include" 16346msgstr "Neem op" 16347 16348#: lazarusidestrconsts.lispckoptsinvalidpackagetype 16349msgid "Invalid package type" 16350msgstr "Ongeldige pakket type" 16351 16352#: lazarusidestrconsts.lispckoptslibrary 16353msgid "Library" 16354msgstr "Bibliotheek" 16355 16356#: lazarusidestrconsts.lispckoptslicense 16357#, fuzzy 16358#| msgid "License:" 16359msgid "License" 16360msgstr "Licentie:" 16361 16362#: lazarusidestrconsts.lispckoptslinker 16363msgid "Linker" 16364msgstr "Linker" 16365 16366#: lazarusidestrconsts.lispckoptsmajor 16367msgid "Major" 16368msgstr "Major" 16369 16370#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically 16371msgid "Manual compilation (never automatically)" 16372msgstr "Handmatige compilatie (nooit automatisch)" 16373 16374#: lazarusidestrconsts.lispckoptsminor 16375msgid "Minor" 16376msgstr "Minor" 16377 16378#: lazarusidestrconsts.lispckoptsobject 16379msgid "Object" 16380msgstr "Object" 16381 16382#: lazarusidestrconsts.lispckoptspackagefileoptions 16383msgid "Additional Package File Options" 16384msgstr "" 16385 16386#: lazarusidestrconsts.lispckoptspackageoptions 16387msgid "Package Options" 16388msgstr "Pakketopties" 16389 16390#: lazarusidestrconsts.lispckoptspackagetype 16391#, fuzzy 16392#| msgid "PackageType" 16393msgid "Package type" 16394msgstr "Pakkettype" 16395 16396#: lazarusidestrconsts.lispckoptsprovides 16397msgid "Provides" 16398msgstr "" 16399 16400#: lazarusidestrconsts.lispckoptsrelease 16401msgid "Release" 16402msgstr "Vrijgeven" 16403 16404#: lazarusidestrconsts.lispckoptsruntime 16405msgid "Runtime" 16406msgstr "" 16407 16408#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans 16409#, object-pascal-format, fuzzy 16410#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." 16411msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages." 16412msgstr "Het package \"%s\" heeft de \"auto install\" vlag.%sDit betekent dat het in de IDE wordt geinstalleerd. Te installeren packages%smoeten \"ontwerp\" packages zijn. " 16413 16414#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages 16415msgid "This package provides the same as the following packages:" 16416msgstr "" 16417 16418#: lazarusidestrconsts.lispckoptsupdaterebuild 16419#, fuzzy 16420#| msgid "Update/Rebuild" 16421msgid "Update / Rebuild" 16422msgstr "Update/Herbouwen" 16423 16424#: lazarusidestrconsts.lispckoptsusage 16425msgid "Usage" 16426msgstr "Gebruik" 16427 16428#: lazarusidestrconsts.lispckpackage 16429msgid "Package:" 16430msgstr "" 16431 16432#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa 16433msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon." 16434msgstr "" 16435 16436#: lazarusidestrconsts.lispckshowunneededdependencies 16437msgid "Show unneeded dependencies" 16438msgstr "" 16439 16440#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring 16441msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked." 16442msgstr "" 16443 16444#: lazarusidestrconsts.lispdabort 16445msgctxt "lazarusidestrconsts.lispdabort" 16446msgid "Abort" 16447msgstr "Afbreken" 16448 16449#: lazarusidestrconsts.lispdprogress 16450msgid "Progress" 16451msgstr "Voortgang" 16452 16453#: lazarusidestrconsts.lispecollapsedirectory 16454msgid "Collapse directory" 16455msgstr "" 16456 16457#: lazarusidestrconsts.lispeconflictfound 16458msgid "Conflict found" 16459msgstr "Conflict gevonden" 16460 16461#: lazarusidestrconsts.lispeeditvirtualunit 16462msgid "Edit Virtual Unit" 16463msgstr "" 16464 16465#: lazarusidestrconsts.lispeexpanddirectory 16466msgid "Expand directory" 16467msgstr "" 16468 16469#: lazarusidestrconsts.lispefilename 16470msgid "Filename:" 16471msgstr "" 16472 16473#: lazarusidestrconsts.lispefixfilescase 16474msgid "Fix Files Case" 16475msgstr "" 16476 16477#: lazarusidestrconsts.lispeinvalidunitfilename 16478msgid "Invalid unit filename" 16479msgstr "Ongeldige unit bestandsnaam" 16480 16481#: lazarusidestrconsts.lispeinvalidunitname 16482msgid "Invalid unitname" 16483msgstr "Ongeldige unit naam" 16484 16485#: lazarusidestrconsts.lispemissingfilesofpackage 16486#, object-pascal-format 16487msgid "Missing files of package %s" 16488msgstr "" 16489 16490#: lazarusidestrconsts.lispendingon 16491msgid "Pending (On)" 16492msgstr "" 16493 16494#: lazarusidestrconsts.lispenewfilenotinincludepath 16495msgid "New file not in include path" 16496msgstr "" 16497 16498#: lazarusidestrconsts.lispenofilesmissingallfilesexist 16499msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist" 16500msgid "No files missing. All files exist." 16501msgstr "" 16502 16503#: lazarusidestrconsts.lisperemovefiles 16504msgid "Remove files" 16505msgstr "" 16506 16507#: lazarusidestrconsts.lisperevertpackage 16508msgid "Revert Package" 16509msgstr "" 16510 16511#: lazarusidestrconsts.lispesavepackageas 16512msgid "Save Package As ..." 16513msgstr "" 16514 16515#: lazarusidestrconsts.lispeshowdirectoryhierarchy 16516msgid "Show directory hierarchy" 16517msgstr "" 16518 16519#: lazarusidestrconsts.lispeshowmissingfiles 16520msgid "Show Missing Files" 16521msgstr "" 16522 16523#: lazarusidestrconsts.lispesortfiles 16524msgid "Sort Files Permanently" 16525msgstr "" 16526 16527#: lazarusidestrconsts.lispesortfilesalphabetically 16528msgid "Sort files alphabetically" 16529msgstr "" 16530 16531#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea 16532#, object-pascal-format 16533msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?" 16534msgstr "" 16535 16536#: lazarusidestrconsts.lispeunitname 16537msgid "Unitname:" 16538msgstr "Unitnaam:" 16539 16540#: lazarusidestrconsts.lispeuseallunitsindirectory 16541msgid "Use all units in directory" 16542msgstr "" 16543 16544#: lazarusidestrconsts.lispeusenounitsindirectory 16545msgid "Use no units in directory" 16546msgstr "" 16547 16548#: lazarusidestrconsts.lispkgcleanuppackagedependencies 16549msgid "Clean up package dependencies" 16550msgstr "" 16551 16552#: lazarusidestrconsts.lispkgclearselection 16553msgid "Clear Selection" 16554msgstr "" 16555 16556#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition 16557msgid "CompiledSrcPath addition" 16558msgstr "CompiledSrcPath toevoeging" 16559 16560#: lazarusidestrconsts.lispkgdefsnamespaces 16561msgid "Namespaces" 16562msgstr "" 16563 16564#: lazarusidestrconsts.lispkgdefsoutputdirectory 16565msgid "Output directory" 16566msgstr "Uitvoer directory" 16567 16568#: lazarusidestrconsts.lispkgdefssrcdirmark 16569msgid "Package Source Directory Mark" 16570msgstr "Pakketbronbestanden directory markering" 16571 16572#: lazarusidestrconsts.lispkgdefsunitpath 16573msgid "Unit Path" 16574msgstr "Unitpad" 16575 16576#: lazarusidestrconsts.lispkgdeletedependencies 16577msgid "Delete dependencies" 16578msgstr "" 16579 16580#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand 16581#, object-pascal-format 16582msgid "Do you really want to forget all changes to package %s and reload it from file?" 16583msgstr "Weet u zeker dat alle wijzigingen in pakket %s geannuleerd moeten worden en het project opnieuw geladen moet worden?" 16584 16585#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath 16586msgid "New unit not in unitpath" 16587msgstr "De nieuwe unit bevindt zich niet in het unit pad" 16588 16589#: lazarusidestrconsts.lispkgeditpublishpackage 16590msgid "Publish Package" 16591msgstr "Publiceer Pakket" 16592 16593#: lazarusidestrconsts.lispkgeditrevertpackage 16594msgid "Revert package?" 16595msgstr "Pakket terugzetten?" 16596 16597#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage 16598#, object-pascal-format, fuzzy 16599#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?" 16600msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?" 16601msgstr "Het bestand \"%s\"%sstaat niet in het unitpad van het package.%s\"%s\" toevoegen aan het unitpad?" 16602 16603#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage 16604msgid "More functions for the package" 16605msgstr "" 16606 16607#: lazarusidestrconsts.lispkgfiletypebinary 16608msgctxt "lazarusidestrconsts.lispkgfiletypebinary" 16609msgid "Binary" 16610msgstr "Binair" 16611 16612#: lazarusidestrconsts.lispkgfiletypeinclude 16613msgid "Include file" 16614msgstr "Include bestand" 16615 16616#: lazarusidestrconsts.lispkgfiletypeissues 16617msgid "Issues xml file" 16618msgstr "" 16619 16620#: lazarusidestrconsts.lispkgfiletypelfm 16621msgid "LFM - Lazarus form text" 16622msgstr "LFM - Lazarus form beschrijving" 16623 16624#: lazarusidestrconsts.lispkgfiletypelrs 16625msgid "LRS - Lazarus resource" 16626msgstr "LRS - Lazarus resource" 16627 16628#: lazarusidestrconsts.lispkgfiletypemainunit 16629msgid "Main Unit" 16630msgstr "" 16631 16632#: lazarusidestrconsts.lispkgfiletypetext 16633msgctxt "lazarusidestrconsts.lispkgfiletypetext" 16634msgid "Text" 16635msgstr "Tekst" 16636 16637#: lazarusidestrconsts.lispkgfiletypevirtualunit 16638msgid "Virtual Unit" 16639msgstr "Virtuele Unit" 16640 16641#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid 16642msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16643msgstr "" 16644 16645#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid 16646msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16647msgstr "" 16648 16649#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid 16650msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16651msgstr "" 16652 16653#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid 16654msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16655msgstr "" 16656 16657#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid 16658msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16659msgstr "" 16660 16661#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid 16662msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\"" 16663msgstr "" 16664 16665#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage 16666#, object-pascal-format, fuzzy 16667#| msgid "%sAdding new Dependency for package %s: package %s%s" 16668msgid "%sAdding new Dependency for package %s: package %s" 16669msgstr "%sToevoegen nieuwe afhankelijkheid aan package %s: package %s" 16670 16671#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage 16672#, object-pascal-format, fuzzy 16673#| msgid "%sAdding new Dependency for project %s: package %s%s" 16674msgid "%sAdding new Dependency for project %s: package %s" 16675msgstr "%sToevoegen nieuwe afhankelijkheid voor project %s: package %s" 16676 16677#: lazarusidestrconsts.lispkgmangaddunittousesclause 16678msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases." 16679msgstr "" 16680 16681#: lazarusidestrconsts.lispkgmangambiguousunitsfound 16682msgid "Ambiguous units found" 16683msgstr "Dubbelzinnige units gevonden" 16684 16685#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages 16686msgid "Automatically installed packages" 16687msgstr "Automatisch geïnstalleerde packages" 16688 16689#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu 16690#, object-pascal-format 16691msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." 16692msgstr "%sBeide packages zijn verbonden, ofwel de ene package gebruikt de andere, of een derde gebruikt deze twee." 16693 16694#: lazarusidestrconsts.lispkgmangbrokendependency 16695msgid "Broken dependency" 16696msgstr "Gebroken Dependency" 16697 16698#: lazarusidestrconsts.lispkgmangcirculardependencies 16699msgid "Circular dependencies found" 16700msgstr "" 16701 16702#: lazarusidestrconsts.lispkgmangcompilepackage 16703#, object-pascal-format 16704msgid "Compile package %s" 16705msgstr "" 16706 16707#: lazarusidestrconsts.lispkgmangdeletefailed 16708msgid "Delete failed" 16709msgstr "Verwijderen mislukt" 16710 16711#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile 16712msgid "Delete Old Package File?" 16713msgstr "Verwijder het oude pakket-bestand?" 16714 16715#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 16716#, object-pascal-format, fuzzy 16717#| msgid "Delete old package file %s%s%s?" 16718msgid "Delete old package file \"%s\"?" 16719msgstr "Verwijder oud pakket bestand \"%s\"?" 16720 16721#: lazarusidestrconsts.lispkgmangdependencywithoutowner 16722#, object-pascal-format 16723msgid "Dependency without Owner: %s" 16724msgstr "Afhankelijkheid zonder eigenaar: %s" 16725 16726#: lazarusidestrconsts.lispkgmangerrorreadingfile 16727msgid "Error reading file" 16728msgstr "Fout bij lezen bestand" 16729 16730#: lazarusidestrconsts.lispkgmangerrorreadingpackage 16731msgid "Error Reading Package" 16732msgstr "Fout bij Lezen Pakket" 16733 16734#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage 16735#, object-pascal-format 16736msgid "Error: updating po files failed for package %s" 16737msgstr "" 16738 16739#: lazarusidestrconsts.lispkgmangerrorwritingfile 16740msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile" 16741msgid "Error writing file" 16742msgstr "Fout bij schrijven bestand" 16743 16744#: lazarusidestrconsts.lispkgmangerrorwritingpackage 16745msgid "Error Writing Package" 16746msgstr "Fout bij schrijven Pakket" 16747 16748#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage 16749msgid "File is already in package" 16750msgstr "Bestand is reeds aanwezig in pakket" 16751 16752#: lazarusidestrconsts.lispkgmangfileisinproject 16753msgid "File is in Project" 16754msgstr "Bestand is in project" 16755 16756#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename 16757msgid "Filename differs from Packagename" 16758msgstr "Bestandsnaam verschilt van pakketnaam" 16759 16760#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage 16761msgid "Filename is used by other package" 16762msgstr "Bestandsnaam in gebruik in ander pakket" 16763 16764#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject 16765msgid "Filename is used by project" 16766msgstr "Bestand in gebruik door project" 16767 16768#: lazarusidestrconsts.lispkgmangfilenotfound 16769#, object-pascal-format, fuzzy 16770#| msgid "File %s%s%s not found." 16771msgctxt "lazarusidestrconsts.lispkgmangfilenotfound" 16772msgid "File \"%s\" not found." 16773msgstr "Bestand \"%s\" niet gevonden." 16774 16775#: lazarusidestrconsts.lispkgmangfilenotsaved 16776msgid "File not saved" 16777msgstr "Bestand niet bewaard" 16778 16779#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac 16780#, object-pascal-format 16781msgid "Installing the package %s will automatically install the package:" 16782msgstr "De installatie van pakket %s zal automatisch het volgende package installeren:" 16783 16784#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 16785#, object-pascal-format 16786msgid "Installing the package %s will automatically install the packages:" 16787msgstr "De installatie van pakket %s zal automatisch de volgende pakket installeren:" 16788 16789#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename 16790msgid "invalid Compiler filename" 16791msgstr "ongeldige compiler bestandsnaam" 16792 16793#: lazarusidestrconsts.lispkgmanginvalidfileextension 16794msgid "Invalid file extension" 16795msgstr "Ongeldige bestands extensie" 16796 16797#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension 16798msgid "Invalid package file extension" 16799msgstr "Ongeldige pakket bestandsextensie" 16800 16801#: lazarusidestrconsts.lispkgmanginvalidpackagefilename 16802msgid "Invalid package filename" 16803msgstr "Ongeldige pakket bestandsnaam" 16804 16805#: lazarusidestrconsts.lispkgmanginvalidpackagename 16806msgid "Invalid package name" 16807msgstr "Ongeldige pakketnaam" 16808 16809#: lazarusidestrconsts.lispkgmanginvalidpackagename2 16810msgid "Invalid Package Name" 16811msgstr "Ongeldige Pakketnaam" 16812 16813#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage 16814#, object-pascal-format, fuzzy 16815#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" 16816msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?" 16817msgstr "Het laden van Package %s zal package %s%s van bestand %s vervangen.%s Het oude pakket is gewijzigd. %sHet oude pakket %s opslaan?" 16818 16819#: lazarusidestrconsts.lispkgmangpackage 16820#, object-pascal-format 16821msgid "Package: %s" 16822msgstr "Pakket: %s" 16823 16824#: lazarusidestrconsts.lispkgmangpackageconflicts 16825msgid "Package conflicts" 16826msgstr "Pakket conflicteert." 16827 16828#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage 16829#, fuzzy 16830#| msgid "Package is no designtime package" 16831msgid "Package is not a designtime package" 16832msgstr "Pakket is geen design-time pakket" 16833 16834#: lazarusidestrconsts.lispkgmangpackageisrequired 16835msgid "Package is required" 16836msgstr "Pakket is benodigd" 16837 16838#: lazarusidestrconsts.lispkgmangpackagemainsourcefile 16839msgid "package main source file" 16840msgstr "package hoofd broncode" 16841 16842#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists 16843msgid "Package name already exists" 16844msgstr "Pakketnaam bestaat al" 16845 16846#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk 16847msgid "Packages must have the extension .lpk" 16848msgstr "Pakketbestanden moeten de .lpk extensie hebben" 16849 16850#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst 16851msgid "Please compile the package first." 16852msgstr "" 16853 16854#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage 16855msgid "Please save the file before adding it to a package." 16856msgstr "Sla het bestand op voor het toevoegen aan een package" 16857 16858#: lazarusidestrconsts.lispkgmangproject 16859#, object-pascal-format 16860msgid "Project: %s" 16861msgstr "Project: %s" 16862 16863#: lazarusidestrconsts.lispkgmangrebuildlazarus 16864msgid "Rebuild Lazarus?" 16865msgstr "Lazarus opnieuw bouwen" 16866 16867#: lazarusidestrconsts.lispkgmangrenamefilelowercase 16868msgid "Rename File lowercase?" 16869msgstr "" 16870 16871#: lazarusidestrconsts.lispkgmangreplaceexistingfile 16872#, object-pascal-format, fuzzy 16873#| msgid "Replace existing file %s%s%s?" 16874msgid "Replace existing file \"%s\"?" 16875msgstr "Vervang bestaand bestand \"%s\"?" 16876 16877#: lazarusidestrconsts.lispkgmangreplacefile 16878msgid "Replace File" 16879msgstr "Vervang bestand" 16880 16881#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound 16882msgid "One or more required packages were not found. See package graph for details." 16883msgstr "" 16884 16885#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage 16886#, object-pascal-format 16887msgid "" 16888"The package %s is already open in the IDE.\n" 16889"You cannot save a package with the same name." 16890msgstr "" 16891 16892#: lazarusidestrconsts.lispkgmangsavepackage 16893#, fuzzy 16894#| msgid "Save Package?" 16895msgid "Save package?" 16896msgstr "Package Opslaan ?" 16897 16898#: lazarusidestrconsts.lispkgmangsavepackagelpk 16899#, object-pascal-format 16900msgid "Save Package %s (*.lpk)" 16901msgstr "Package Opslaan %s (*.lpk)" 16902 16903#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto 16904#, object-pascal-format, fuzzy 16905#| msgid "Should the file be renamed lowercase to%s%s%s%s?" 16906msgid "Should the file be renamed lowercase to%s\"%s\"?" 16907msgstr "Moet het bestand met kleine letters hernoemd worden naar%s\"%s\"?" 16908 16909#: lazarusidestrconsts.lispkgmangskipthispackage 16910msgid "Skip this package" 16911msgstr "" 16912 16913#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile 16914msgid "static packages config file" 16915msgstr " configuratiebestand statische packages" 16916 16917#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable 16918#, object-pascal-format 16919msgid "The compiler file for package %s is not a valid executable:%s%s" 16920msgstr "Het compiler bestand voor package %s is geen geldige executable:%s%s" 16921 16922#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage 16923#, object-pascal-format, fuzzy 16924#| msgid "The file %s%s%s%sis already in the package %s." 16925msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage" 16926msgid "The file \"%s\"%sis already in the package %s." 16927msgstr "Het bestand \"%s\"%smaakt al deel uit van het package %s." 16928 16929#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage 16930#, object-pascal-format, fuzzy 16931#| msgid "The file %s%s%s is not a Lazarus package." 16932msgid "The file \"%s\" is not a Lazarus package." 16933msgstr "Het bestand \"%s\" is geen Lazarus package" 16934 16935#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage 16936#, object-pascal-format, fuzzy 16937#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" 16938msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?" 16939msgstr "De bestandsnaam \"%s\" correspondeert niet met de package naam \"%s\" in het bestand.%sPackage naam wijzigen in \"%s\"?" 16940 16941#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject 16942#, object-pascal-format, fuzzy 16943#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." 16944msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files." 16945msgstr "De bestandsnaam \"%s\" is onderdeel van het huidige project.%sProjecten en Packages mogen geen bestanden delen." 16946 16947#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile 16948#, object-pascal-format, fuzzy 16949#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." 16950msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"." 16951msgstr "De bestandsnaam \"%s\" wordt gebruikt door%shet package \"%s\"%sin bestand \"%s\"." 16952 16953#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound 16954#, object-pascal-format 16955msgid "The file \"%s\" of package %s was not found." 16956msgstr "" 16957 16958#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload 16959msgid "The following package failed to load:" 16960msgstr "Het volgende pakket is niet geladen:" 16961 16962#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload 16963msgid "The following packages failed to load:" 16964msgstr "De volgende pakketten zijn niet geladen:" 16965 16966#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof 16967#, object-pascal-format, fuzzy 16968#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" 16969msgid "%sThe following units will be added to the uses section of%s%s:%s%s" 16970msgstr "%sDe volgende units zullen aan de uses sectie van %s%s:%s%s worden toegevoegd" 16971 16972#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati 16973#, object-pascal-format, fuzzy 16974#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" 16975msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?" 16976msgstr "Het package \"%s\" kon niet worden gecompileerd.%sHet package verwijderen uit de installatie lijst?" 16977 16978#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename 16979#, object-pascal-format, fuzzy 16980#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name." 16981msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name." 16982msgstr "De bestandsnaam voor package \"%s\" in%s\"%s\" is geen geldige lazarus package naam." 16983 16984#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages 16985#, object-pascal-format, fuzzy 16986#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." 16987msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE." 16988msgstr "Het package %s is alleen beschikbaar in runtime.%sDit soort packages kunnen niet geinstalleerd worden." 16989 16990#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec 16991#, object-pascal-format 16992msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies." 16993msgstr "" 16994 16995#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound 16996#, object-pascal-format, fuzzy 16997#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?" 16998msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?" 16999msgstr "Het package \"%s\" is aangemeld voor installatie, maar is niet gevonden.%sAfhankelijkheid verwijderen van de lijst te installeren packages?" 17000 17001#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation 17002#, object-pascal-format, fuzzy 17003#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." 17004msgid "The package %s is required by %s which is marked for installation.%sSee package graph." 17005msgstr "Het package %s is nodig voor %s, dat geinstalleerd moet worden.%sZie package plaatje." 17006 17007#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean 17008#, object-pascal-format, fuzzy 17009#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" 17010msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)" 17011msgstr "Het packagenaam \"%s\" is geen geldige packagenaam%sKies een andere naam (bijv. package1.lpk)" 17012 17013#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid 17014#, object-pascal-format, fuzzy 17015#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." 17016msgid "The package name \"%s\" of%sthe file \"%s\" is invalid." 17017msgstr "De package naam \"%s\" van%shet bestand \"%s\" is ongeldig." 17018 17019#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus 17020#, object-pascal-format, fuzzy 17021#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" 17022msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 17023msgstr "Het package \"%s\" is verwijderd.%sLazarus ondersteund alleen statisch gelinkte packages. Om het volledig te de-installeren moet lazarus opnieuw gebouwd en gestart worden.%sWilt u Lazarus opnieuw bouwen?" 17024 17025#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus 17026#, object-pascal-format, fuzzy 17027#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?" 17028msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?" 17029msgstr "Het package \"%s\" is aangemeld voor installatie.%sLazarus ondersteund alleen statisch gelinkte packages. Om het te installeren moet lazarus opnieuw gebouwd en gestart worden.%sWilt u Lazarus opnieuw bouwen?" 17030 17031#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound 17032#, object-pascal-format, fuzzy 17033#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." 17034msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector." 17035msgstr "Het project heeft het pakket \"%s\" nodig.%sDit is niet gevonden. Zie Project -> Project Inspecteur" 17036 17037#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from 17038#, object-pascal-format, fuzzy 17039#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" 17040msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s" 17041msgstr "Er zijn twee units met dezelfde naam:%s1. \"%s\" uit %s%s2. \"%s\" uit %s" 17042 17043#: lazarusidestrconsts.lispkgmangthereisacirculardependency 17044msgid "There is a circular dependency in the packages. See package graph." 17045msgstr "" 17046 17047#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage 17048#, object-pascal-format, fuzzy 17049#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" 17050msgid "There is a FPC unit with the same name as a package:%s\"%s\"" 17051msgstr "Er is een FPC unit met dezelfde naam als een package:%s\"%s\"" 17052 17053#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom 17054#, object-pascal-format, fuzzy 17055#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" 17056msgid "There is a FPC unit with the same name as:%s\"%s\" from %s" 17057msgstr "Er is een FPC unit met dezelfde naam als:%s\"%s\" uit %s" 17058 17059#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename 17060#, object-pascal-format, fuzzy 17061#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" 17062msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\"" 17063msgstr "There is al een ander package met de naam \"%s\".%sConflicterend package: \"%s\"%sBestand: \"%s\"" 17064 17065#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile 17066#, object-pascal-format, fuzzy 17067#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible." 17068msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible." 17069msgstr "Er is al een package \"%s\" geladen%svan bestand \"%s\".%sZie Componenten -> Package plaatje.%sVervangen is onmogelijk" 17070 17071#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages 17072msgid "There is an unsaved package in the required packages. See package graph." 17073msgstr "Er is een niet opgeslagen package in the benodigde packages. Zie package plaatje." 17074 17075#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 17076#, object-pascal-format, fuzzy 17077#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" 17078msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\"" 17079msgstr "Er is een unit met dezelfde naam als een package:%s1. \"%s\" uit %s%s2. \"%s\"" 17080 17081#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe 17082msgid "This is a virtual package. It has no source yet. Please save the package first." 17083msgstr "Dit is een viruteel pakket. Er is nog geen broncode. Sla het pakket eerst op." 17084 17085#: lazarusidestrconsts.lispkgmangunabletocreatedirectory 17086msgid "Unable to create directory" 17087msgstr "Kan de directory niet maken" 17088 17089#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage 17090#, object-pascal-format, fuzzy 17091#| msgid "Unable to create output directory %s%s%s%sfor package %s." 17092msgid "Unable to create output directory \"%s\"%sfor package %s." 17093msgstr "Kan de uitvoerdirectory \"%s\"%svoor package %s niet maken." 17094 17095#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage 17096#, object-pascal-format, fuzzy 17097#| msgid "Unable to create package source directory %s%s%s%sfor package %s." 17098msgid "Unable to create package source directory \"%s\"%sfor package %s." 17099msgstr "Kan geen package broncode directory \"%s\"%svoor package %s." 17100 17101#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus 17102#, object-pascal-format, fuzzy 17103#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages." 17104msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages." 17105msgstr "Kan doel directorie for lazarus:%s\"%s\" niet maken.%sDeze directorie is nodig voor de nieuwe lazarus IDE met je packages." 17106 17107#: lazarusidestrconsts.lispkgmangunabletodeletefile 17108#, object-pascal-format, fuzzy 17109#| msgid "Unable to delete file %s%s%s." 17110msgid "Unable to delete file \"%s\"." 17111msgstr "Kan het bestand \"%s\" niet verwijderen." 17112 17113#: lazarusidestrconsts.lispkgmangunabletodeletefilename 17114msgid "Unable to delete file" 17115msgstr "Kan het bestand niet verwijderen" 17116 17117#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage 17118#, object-pascal-format, fuzzy 17119#| msgid "Unable to delete old state file %s%s%s%sfor package %s." 17120msgid "Unable to delete old state file \"%s\"%sfor package %s." 17121msgstr "Kan het oude status bestand \"%s\"%svoor package %s niet verwijderen." 17122 17123#: lazarusidestrconsts.lispkgmangunabletoloadpackage 17124msgid "Unable to load package" 17125msgstr "" 17126 17127#: lazarusidestrconsts.lispkgmangunabletoopenthepackage 17128#, object-pascal-format, fuzzy 17129#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." 17130msgid "Unable to open the package \"%s\".%sThis package was marked for installation." 17131msgstr "Kan het package \"%s\" niet openen.%sDit package moet geinstalleerd worden." 17132 17133#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror 17134#, object-pascal-format, fuzzy 17135#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" 17136msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s" 17137msgstr "Kan het status bestand \"%s\"%svan package %s niet vinden.%sFout: %s" 17138 17139#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror 17140#, object-pascal-format, fuzzy 17141#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" 17142msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s" 17143msgstr "Kan het package \"%s\"%sniet schrijven in bestand \"%s\".%sFout: %s" 17144 17145#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror 17146#, object-pascal-format, fuzzy 17147#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" 17148msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s" 17149msgstr "Kan het status bestand \"%s\"%s van package %s niet schrijven.%sFout: %s" 17150 17151#: lazarusidestrconsts.lispkgmanguninstallpackage 17152msgid "Uninstall package?" 17153msgstr "Package de-installeren" 17154 17155#: lazarusidestrconsts.lispkgmanguninstallpackage2 17156#, object-pascal-format 17157msgid "Uninstall package %s?" 17158msgstr "Package %s de-installeren?" 17159 17160#: lazarusidestrconsts.lispkgmangunsavedpackage 17161msgid "Unsaved package" 17162msgstr "Niet opgeslagen package" 17163 17164#: lazarusidestrconsts.lispkgmanguseunit 17165msgid "Use unit" 17166msgstr "Gebruik unit" 17167 17168#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject 17169#, object-pascal-format, fuzzy 17170#| msgid "Warning: The file %s%s%s%sbelongs to the current project." 17171msgid "Warning: The file \"%s\"%sbelongs to the current project." 17172msgstr "Waarschuwing: Het bestand \"%s\"%sbehoort tot het huidige project." 17173 17174#: lazarusidestrconsts.lispkgmgrkeep 17175msgctxt "lazarusidestrconsts.lispkgmgrkeep" 17176msgid "keep" 17177msgstr "" 17178 17179#: lazarusidestrconsts.lispkgmgrnew 17180msgctxt "lazarusidestrconsts.lispkgmgrnew" 17181msgid "new" 17182msgstr "" 17183 17184#: lazarusidestrconsts.lispkgmgrremove 17185msgctxt "lazarusidestrconsts.lispkgmgrremove" 17186msgid "remove" 17187msgstr "" 17188 17189#: lazarusidestrconsts.lispkgselectapackage 17190msgid "Select a package" 17191msgstr "" 17192 17193#: lazarusidestrconsts.lispkgsinstalled 17194msgctxt "lazarusidestrconsts.lispkgsinstalled" 17195msgid "Installed" 17196msgstr "Geinstalleerd" 17197 17198#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit 17199#, fuzzy 17200#| msgid "Can not register components without unit" 17201msgid "Cannot register components without unit" 17202msgstr "Kan componenten zonder unit niet registreren" 17203 17204#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined 17205#, object-pascal-format, fuzzy 17206#| msgid "Component Class %s%s%s already defined" 17207msgid "Component Class \"%s\" already defined" 17208msgstr "Componentklasse \"%s\" reeds gedefinieerd" 17209 17210#: lazarusidestrconsts.lispkgsysfilename 17211#, object-pascal-format, fuzzy 17212#| msgid "%s%sFile Name: %s%s%s" 17213msgid "%s%sFile Name: \"%s\"" 17214msgstr "%s%sbestandsnaam: \"%s\"" 17215 17216#: lazarusidestrconsts.lispkgsysinvalidcomponentclass 17217msgid "Invalid component class" 17218msgstr "Ongeldige component Class" 17219 17220#: lazarusidestrconsts.lispkgsysinvalidunitname 17221#, object-pascal-format 17222msgid "Invalid Unitname: %s" 17223msgstr "Ongeldige unit naam: %s" 17224 17225#: lazarusidestrconsts.lispkgsyslpkfilename 17226#, object-pascal-format 17227msgid "%s%slpk file: \"%s\"" 17228msgstr "" 17229 17230#: lazarusidestrconsts.lispkgsyspackagefilenotfound 17231msgid "Package file not found" 17232msgstr "Pakketbestand niet gevonden" 17233 17234#: lazarusidestrconsts.lispkgsyspackageregistrationerror 17235msgid "Package registration error" 17236msgstr "" 17237 17238#: lazarusidestrconsts.lispkgsysregisterprocedureisnil 17239msgid "Register procedure is nil" 17240msgstr "Register proceure is nill" 17241 17242#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering 17243#, fuzzy 17244#| msgid "RegisterUnit was called, but no package is registering." 17245msgid "RegisterUnit was called but no package is registering." 17246msgstr "RegisterUnit is aangeroepen, maar er is geen pakket geregistreerd" 17247 17248#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound 17249#, object-pascal-format 17250msgid "%s%sThe lpk file was not found." 17251msgstr "" 17252 17253#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound 17254#, object-pascal-format, fuzzy 17255#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." 17256msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created." 17257msgstr "Het package \"%s\" is geinstalleerd, maar er is geen geldig .lpk bestand gevonden.%sEen dummy package is aangemaakt." 17258 17259#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents 17260msgid "This is the default package. Used only for components without a package. These components are outdated." 17261msgstr "Dit is het standaard pakket. Het wordt alleen gebruikt voor componenten zonder package. Deze zijn verouderd." 17262 17263#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound 17264#, fuzzy 17265#| msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." 17266msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this." 17267msgstr "Het pakket is geinstalleerd, maar het lpk-bestand niet gevonden. Alle componenten hieruit zijn gedeactiveed. Herstel dit alstublieft." 17268 17269#: lazarusidestrconsts.lispkgsysunitname 17270#, object-pascal-format, fuzzy 17271#| msgid "%s%sUnit Name: %s%s%s" 17272msgid "%s%sUnit Name: \"%s\"" 17273msgstr "%s%sUnitnaam: \"%s\"" 17274 17275#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn 17276#, object-pascal-format 17277msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit." 17278msgstr "" 17279 17280#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk 17281#, object-pascal-format 17282msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk" 17283msgid "Unit \"%s\" was removed from package (lpk)" 17284msgstr "" 17285 17286#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau 17287msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies." 17288msgstr "" 17289 17290#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin 17291#, object-pascal-format 17292msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s" 17293msgstr "" 17294 17295#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage 17296msgid "This file is not in any loaded package." 17297msgstr "Dit bestand is niet aanwezig in een van de geladen packages." 17298 17299#: lazarusidestrconsts.lispkgtransitivity 17300msgid "Transitivity" 17301msgstr "" 17302 17303#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror 17304#, object-pascal-format 17305msgid "Unable to read package file \"%s\".%sError: %s" 17306msgstr "" 17307 17308#: lazarusidestrconsts.lisplay 17309msgid "Play" 17310msgstr "" 17311 17312#: lazarusidestrconsts.lispldglobal 17313msgctxt "lazarusidestrconsts.lispldglobal" 17314msgid "Global" 17315msgstr "" 17316 17317#: lazarusidestrconsts.lispldonline 17318msgid "Online" 17319msgstr "" 17320 17321#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted 17322msgid "Online packages cannot be deleted" 17323msgstr "" 17324 17325#: lazarusidestrconsts.lispldpackagelinks 17326msgid "Package Links" 17327msgstr "" 17328 17329#: lazarusidestrconsts.lispldshowgloballinksin 17330msgid "Show global links in " 17331msgstr "" 17332 17333#: lazarusidestrconsts.lispldshowonlinelinks 17334msgid "Show online links" 17335msgstr "" 17336 17337#: lazarusidestrconsts.lispldshowuserlinksin 17338msgid "Show user links in " 17339msgstr "" 17340 17341#: lazarusidestrconsts.lispldsomepackagescannotbedeleted 17342msgid "Some packages cannot be deleted" 17343msgstr "" 17344 17345#: lazarusidestrconsts.lisplduser 17346msgid "User" 17347msgstr "" 17348 17349#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow 17350msgid "Please fix the error shown in the message window which is normally below the source editor." 17351msgstr "" 17352 17353#: lazarusidestrconsts.lispleaseopenaunitbeforerun 17354msgid "Please open a unit before run." 17355msgstr "A.u.b. een unit openen .." 17356 17357#: lazarusidestrconsts.lispleaseselectatleastonebuildmode 17358msgid "Please select at least one build mode." 17359msgstr "" 17360 17361#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod 17362msgid "Please select some code to extract a new procedure/method." 17363msgstr "Selecteer een stuk code om in een nieuwe procedure/methode te maken" 17364 17365#: lazarusidestrconsts.lisplistall 17366msgctxt "lazarusidestrconsts.lisplistall" 17367msgid "<All>" 17368msgstr "<Alles>" 17369 17370#: lazarusidestrconsts.lisplistchangefont 17371msgid "Change Font" 17372msgstr "" 17373 17374#: lazarusidestrconsts.lisplistcopymethodtoclipboard 17375msgid "Copy method name to the clipboard" 17376msgstr "" 17377 17378#: lazarusidestrconsts.lisplistfilterany 17379msgid "Filter by matching any part of method" 17380msgstr "" 17381 17382#: lazarusidestrconsts.lisplistfilterstart 17383msgid "Filter by matching with start of method" 17384msgstr "" 17385 17386#: lazarusidestrconsts.lisplistjumptoselection 17387msgid "Jump To Selection" 17388msgstr "Spring naar selectie" 17389 17390#: lazarusidestrconsts.lisplistnone 17391msgid "<None>" 17392msgstr "<Geen>" 17393 17394#: lazarusidestrconsts.lisplistobjects 17395msgid "&Objects" 17396msgstr "&Objecten" 17397 17398#: lazarusidestrconsts.lisplistprocedurelist 17399msgid "Procedure List" 17400msgstr "" 17401 17402#: lazarusidestrconsts.lisplisttype 17403msgctxt "lazarusidestrconsts.lisplisttype" 17404msgid "Type" 17405msgstr "Type" 17406 17407#: lazarusidestrconsts.lispochoosepofiledirectory 17408msgid "Choose .po file directory" 17409msgstr "" 17410 17411#: lazarusidestrconsts.lispodonotsaveanysessioninfo 17412msgid "Do not save any session info" 17413msgstr "Geen sessie info opslaan" 17414 17415#: lazarusidestrconsts.lispointer 17416msgid "Pointer" 17417msgstr "" 17418 17419#: lazarusidestrconsts.lisposaveinideconfigdirectory 17420#, fuzzy 17421#| msgid "Save in IDE config directory" 17422msgid "Save in .lps file in IDE config directory" 17423msgstr "Opslaan in IDE configuratie directorie" 17424 17425#: lazarusidestrconsts.lisposaveinlpifil 17426msgid "Save in .lpi file" 17427msgstr "Opslaan in .lpi bestand" 17428 17429#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory 17430msgid "Save in .lps file in project directory" 17431msgstr "Opslaan in .lps bestand in project directory" 17432 17433#: lazarusidestrconsts.lisposavesessioninformationin 17434msgid "Save session information in" 17435msgstr "Sessie informatie opslaan in" 17436 17437#: lazarusidestrconsts.lisposavesessioninformationinhint 17438msgid ".lpi is the project main info file, .lps is a separate file for session data only." 17439msgstr "" 17440 17441#: lazarusidestrconsts.lisposition 17442msgid "Position" 17443msgstr "" 17444 17445#: lazarusidestrconsts.lispositionoutsideofsource 17446#, object-pascal-format 17447msgid "%s (position outside of source)" 17448msgstr "" 17449 17450#: lazarusidestrconsts.lisppuinwrongdirectory 17451#, object-pascal-format 17452msgid "ppu in wrong directory=%s." 17453msgstr "" 17454 17455#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg 17456#, object-pascal-format 17457msgid "%s.ppu not found. Check your fpc.cfg." 17458msgstr "" 17459 17460#: lazarusidestrconsts.lisprecedingword 17461msgid "Preceding word" 17462msgstr "" 17463 17464#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig 17465#, fuzzy 17466#| msgid "primary config directory, where Lazarus stores its config files. Default is " 17467msgid "primary config directory where Lazarus stores its config files. Default is " 17468msgstr "eerste configuratie directory, waar Lazarus de configuratie bestanden opslaat. Standaard is " 17469 17470#: lazarusidestrconsts.lisprimaryconfigpath 17471msgid "Primary config path" 17472msgstr "" 17473 17474#: lazarusidestrconsts.lisprior 17475#, object-pascal-format 17476msgid "prior %s" 17477msgstr "" 17478 17479#: lazarusidestrconsts.lispriority 17480msgctxt "lazarusidestrconsts.lispriority" 17481msgid "Priority" 17482msgstr "" 17483 17484#: lazarusidestrconsts.lisprivate 17485msgid "Private" 17486msgstr "" 17487 17488#: lazarusidestrconsts.lisprivatemethod 17489msgid "Private Method" 17490msgstr "Private methode" 17491 17492#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti 17493#, object-pascal-format, fuzzy 17494#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s" 17495msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first." 17496msgstr "Waarschijnlijk moeten sommige pakketten geïnstalleerd voordat je door kunt gaan.%sWaarschuwing:%sHet project gebruikt de volgende design time pakketten, welke mogelijk in de form ontwerper geopend moeten worden. Als je doorgaat kun je foutmeldingen krijgen over missende componenten, en het lade van het form zal waarschijnlijk uitermate onplzierige resultaten opleveren.%sHet is aanbevolen om te annuleren en deze paketten eerts te installeren." 17497 17498#: lazarusidestrconsts.lisprocedure 17499msgctxt "lazarusidestrconsts.lisprocedure" 17500msgid "Procedure" 17501msgstr "Procedure" 17502 17503#: lazarusidestrconsts.lisprocedurewithinterface 17504msgid "Procedure with interface" 17505msgstr "Procedure met interface" 17506 17507#: lazarusidestrconsts.lisprogram 17508msgctxt "lazarusidestrconsts.lisprogram" 17509msgid "Program" 17510msgstr "Programma" 17511 17512#: lazarusidestrconsts.lisprogramdetected 17513msgid "Program detected" 17514msgstr "Programma vastgesteld" 17515 17516#: lazarusidestrconsts.lisprogramprogramdescriptor 17517msgid "A Free Pascal command line program with some useful settings added." 17518msgstr "" 17519 17520#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp 17521#, fuzzy 17522#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr" 17523msgid "Program source must have a Pascal extension like .pas, .pp or .lpr" 17524msgstr "Programma broncode dient een Pascal extensie, zoals .pas, .pp of .lpr, te hebben." 17525 17526#: lazarusidestrconsts.lisprojadddependencyalreadyexists 17527msgid "Dependency already exists" 17528msgstr "Afhankelijkheid bestaat al" 17529 17530#: lazarusidestrconsts.lisprojaddeditorfile 17531#, fuzzy 17532#| msgid "Add editor files" 17533msgid "Add Editor Files" 17534msgstr "Bewerker-bestanden toevoegen" 17535 17536#: lazarusidestrconsts.lisprojaddinvalidminmaxversion 17537msgid "Invalid Min-Max version" 17538msgstr "Ongeldige Min-Max versie" 17539 17540#: lazarusidestrconsts.lisprojaddinvalidversion 17541msgid "Invalid version" 17542msgstr "Ongeldige versie" 17543 17544#: lazarusidestrconsts.lisprojaddlocalpkg 17545#, object-pascal-format 17546msgid "Local (%s)" 17547msgstr "" 17548 17549#: lazarusidestrconsts.lisprojaddmaximumversionoptional 17550msgid "Maximum Version (optional):" 17551msgstr "Maximum Versie (optioneel):" 17552 17553#: lazarusidestrconsts.lisprojaddminimumversionoptional 17554msgid "Minimum Version (optional):" 17555msgstr "Minimum Versie (optioneel):" 17556 17557#: lazarusidestrconsts.lisprojaddnewfpmakerequirement 17558msgid "New FPMake Requirement" 17559msgstr "" 17560 17561#: lazarusidestrconsts.lisprojaddnewrequirement 17562msgid "New Requirement" 17563msgstr "Nieuwe vereiste" 17564 17565#: lazarusidestrconsts.lisprojaddonlinepkg 17566#, object-pascal-format 17567msgid "Online (%s)" 17568msgstr "" 17569 17570#: lazarusidestrconsts.lisprojaddpackagename 17571msgid "Package Name:" 17572msgstr "Pakketnaam" 17573 17574#: lazarusidestrconsts.lisprojaddpackagenotfound 17575msgid "Package not found" 17576msgstr "Pakket niet gevonden" 17577 17578#: lazarusidestrconsts.lisprojaddpackagetype 17579msgid "Package Type:" 17580msgstr "" 17581 17582#: lazarusidestrconsts.lisprojaddthedependencywasnotfound 17583#, object-pascal-format, fuzzy 17584#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." 17585msgid "The dependency \"%s\" was not found.%sPlease choose an existing package." 17586msgstr "De afhankelijkheid \"%s\" is niet gevonden.%sKies een bestaand package." 17587 17588#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid 17589#, object-pascal-format, fuzzy 17590#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" 17591msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid" 17592msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 17593msgstr "De Maximum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10" 17594 17595#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion 17596msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion" 17597msgid "The Maximum Version is lower than the Minimim Version." 17598msgstr "De maximum versie is lager dan de minimum versie" 17599 17600#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid 17601#, object-pascal-format, fuzzy 17602#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" 17603msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid" 17604msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10" 17605msgstr "De Minimum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10" 17606 17607#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency 17608#, object-pascal-format, fuzzy 17609#| msgid "The project has already a dependency for the package %s%s%s." 17610msgid "The project has already a dependency for the package \"%s\"." 17611msgstr "Het project is al afhankelijk van het pakket \"%s\"." 17612 17613#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject 17614#, object-pascal-format, fuzzy 17615#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." 17616msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"." 17617msgstr "De unitnaam \"%s\" bestaat al in het project%smet bestand: \"%s\"." 17618 17619#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection 17620#, object-pascal-format, fuzzy 17621#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." 17622msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"." 17623msgstr "De unitnaam \"%s\" bestaat al in de selectie%smet bestand: \"%s\"." 17624 17625#: lazarusidestrconsts.lisprojaddunitnamealreadyexists 17626msgid "Unit name already exists" 17627msgstr "Unitnaam bestaat al" 17628 17629#: lazarusidestrconsts.lisproject 17630#, object-pascal-format 17631msgid "Project %s" 17632msgstr "" 17633 17634#: lazarusidestrconsts.lisproject2 17635msgid "Project: " 17636msgstr "" 17637 17638#: lazarusidestrconsts.lisproject3 17639msgid "project" 17640msgstr "" 17641 17642#: lazarusidestrconsts.lisprojectchanged 17643msgid "Project changed" 17644msgstr "Project is gewijzigd" 17645 17646#: lazarusidestrconsts.lisprojectchangedondisk 17647msgid "Project changed on disk" 17648msgstr "" 17649 17650#: lazarusidestrconsts.lisprojectcount 17651#, object-pascal-format 17652msgid "%d projects" 17653msgstr "" 17654 17655#: lazarusidestrconsts.lisprojectdirectory 17656msgctxt "lazarusidestrconsts.lisprojectdirectory" 17657msgid "Project directory" 17658msgstr "Project directory" 17659 17660#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar 17661msgid "Title in taskbar shows also directory path of the project" 17662msgstr "" 17663 17664#: lazarusidestrconsts.lisprojectfilename 17665msgid "Project filename" 17666msgstr "Project bestandsnaam" 17667 17668#: lazarusidestrconsts.lisprojectincpath 17669msgid "Project Include Path" 17670msgstr "Project Include Path" 17671 17672#: lazarusidestrconsts.lisprojectinfofiledetected 17673msgid "Project info file detected" 17674msgstr "Project info bestand gevonden" 17675 17676#: lazarusidestrconsts.lisprojectisrunnable 17677msgid "Project is runnable" 17678msgstr "Project is 'runnable'" 17679 17680#: lazarusidestrconsts.lisprojectisrunnablehint 17681msgid "Generates a binary executable which can be run." 17682msgstr "" 17683 17684#: lazarusidestrconsts.lisprojectmacro 17685msgctxt "lazarusidestrconsts.lisprojectmacro" 17686msgid "Project" 17687msgstr "" 17688 17689#: lazarusidestrconsts.lisprojectmacroproperties 17690msgid "Project macro properties" 17691msgstr "Project macro eigenschappen" 17692 17693#: lazarusidestrconsts.lisprojectnamespaces 17694msgid "Project Namespaces" 17695msgstr "" 17696 17697#: lazarusidestrconsts.lisprojectoption 17698msgid "Project Option" 17699msgstr "" 17700 17701#: lazarusidestrconsts.lisprojectoutdir 17702msgid "Project Output directory (e.g. the ppu directory)" 17703msgstr "" 17704 17705#: lazarusidestrconsts.lisprojectoutputdirectory 17706msgid "Project output directory" 17707msgstr "" 17708 17709#: lazarusidestrconsts.lisprojectpathhint 17710msgid "Directory where project's main file must be" 17711msgstr "" 17712 17713#: lazarusidestrconsts.lisprojectsession 17714msgid "Project Session" 17715msgstr "" 17716 17717#: lazarusidestrconsts.lisprojectsessionchanged 17718msgid "Project session changed" 17719msgstr "" 17720 17721#: lazarusidestrconsts.lisprojectsourcedirectories 17722msgid "Project source directories" 17723msgstr "" 17724 17725#: lazarusidestrconsts.lisprojectsraisedexceptionataddress 17726#, object-pascal-format 17727msgid "%0:s%0:s At address %1:x" 17728msgstr "" 17729 17730#: lazarusidestrconsts.lisprojectsraisedexceptionclasss 17731#, object-pascal-format 17732msgid "Project %s raised exception class '%s'." 17733msgstr "" 17734 17735#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess 17736#, object-pascal-format 17737msgid "Project %s raised exception class '%s' with message:%s%s" 17738msgstr "" 17739 17740#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress 17741#, object-pascal-format 17742msgid "%0:s%0:s In file '%1:s' at address %2:x" 17743msgstr "" 17744 17745#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline 17746#, object-pascal-format 17747msgid "%0:s%0:s In file '%1:s' at line %2:d" 17748msgstr "" 17749 17750#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc 17751#, object-pascal-format 17752msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s" 17753msgstr "" 17754 17755#: lazarusidestrconsts.lisprojectsrcpath 17756msgid "Project Src Path" 17757msgstr "Project Src Path" 17758 17759#: lazarusidestrconsts.lisprojectunit 17760msgid "project unit" 17761msgstr "" 17762 17763#: lazarusidestrconsts.lisprojectunitpath 17764msgid "Project Unit Path" 17765msgstr "Project Unit pad" 17766 17767#: lazarusidestrconsts.lisprojectwizard 17768msgid "Project Wizard" 17769msgstr "" 17770 17771#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency 17772msgid "Confirm deleting dependency" 17773msgstr "Bevestig Afhankelijkheid verwijderen" 17774 17775#: lazarusidestrconsts.lisprojinspconfirmremovingfile 17776msgid "Confirm removing file" 17777msgstr "" 17778 17779#: lazarusidestrconsts.lisprojinspdeletedependencyfor 17780#, object-pascal-format 17781msgid "Delete dependency for %s?" 17782msgstr "Verwijder afhankelijkheid voor %s?" 17783 17784#: lazarusidestrconsts.lisprojinspprojectinspector 17785#, object-pascal-format 17786msgid "Project Inspector - %s" 17787msgstr "Project Inspecteur - %s" 17788 17789#: lazarusidestrconsts.lisprojinspremovedrequiredpackages 17790msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages" 17791msgid "Removed required packages" 17792msgstr "Benodigde pakketten verwijderd" 17793 17794#: lazarusidestrconsts.lisprojinspremovefilefromproject 17795#, object-pascal-format 17796msgid "Remove file %s from project?" 17797msgstr "Verwijder bestand %s van het project?" 17798 17799#: lazarusidestrconsts.lisprojinspremoveitemsf 17800#, object-pascal-format 17801msgid "Remove %s items from project?" 17802msgstr "" 17803 17804#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror 17805#, object-pascal-format 17806msgid "Unable to read state file %s of project %s%sError: %s" 17807msgstr "Kan het status bestand %s van project %s%s niet lezen. Fout: %s" 17808 17809#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror 17810#, object-pascal-format 17811msgid "Unable to write state file for project %s%sError: %s" 17812msgstr "Kan het status bestand van project %s%s niet schrijven. Four %s" 17813 17814#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged 17815msgid "Always build (even if nothing changed)" 17816msgstr "Altijd bouwen (ook als er niks is gewijzigd)" 17817 17818#: lazarusidestrconsts.lisprojoptsalwaysbuildhint 17819msgid "May be needed if there is a bug in dependency check, normally not needed." 17820msgstr "" 17821 17822#: lazarusidestrconsts.lisprojoptserror 17823msgctxt "lazarusidestrconsts.lisprojoptserror" 17824msgid "Error" 17825msgstr "Fout" 17826 17827#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist 17828#, object-pascal-format 17829msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." 17830msgstr "Kan de \"Auto createlijst\" niet wijzigen in de broncode.%sLos eerst de fouten op." 17831 17832#: lazarusidestrconsts.lisprojprojectsourcedirectorymark 17833msgid "Project Source Directory Mark" 17834msgstr "Project broncode directory merk" 17835 17836#: lazarusidestrconsts.lispromptforvalue 17837msgid "Prompt for value" 17838msgstr "Vraag om een waarde" 17839 17840#: lazarusidestrconsts.lisproperties 17841msgid "Properties (replace or remove)" 17842msgstr "" 17843 17844#: lazarusidestrconsts.lisproperty 17845#, object-pascal-format 17846msgid "%s property" 17847msgstr "" 17848 17849#: lazarusidestrconsts.lisprotected 17850msgid "Protected" 17851msgstr "" 17852 17853#: lazarusidestrconsts.lisprotectedmethod 17854msgid "Protected Method" 17855msgstr "Beschermde methode" 17856 17857#: lazarusidestrconsts.lispublicmethod 17858msgid "Public Method" 17859msgstr "Publieke methode" 17860 17861#: lazarusidestrconsts.lispublishedmethod 17862msgid "Published Method" 17863msgstr "Gepubliceerde methode" 17864 17865#: lazarusidestrconsts.lispublishedto 17866#, object-pascal-format 17867msgid "Published to %s" 17868msgstr "" 17869 17870#: lazarusidestrconsts.lispublishmodulenote 17871msgid "Files belonging to project / package will be included automatically." 17872msgstr "" 17873 17874#: lazarusidestrconsts.lispublishprojdir 17875msgid "Publish project directory" 17876msgstr "Publiceer project directory" 17877 17878#: lazarusidestrconsts.lispublishproject 17879msgid "Publish Project" 17880msgstr "" 17881 17882#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory 17883msgid "Save .lrs files in the output directory" 17884msgstr "" 17885 17886#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint 17887msgid "The resource will be available for FPC." 17888msgstr "" 17889 17890#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas 17891#, fuzzy 17892#| msgid "A pascal unit must have the extension .pp or .pas" 17893msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas" 17894msgid "A Pascal unit must have the extension .pp or .pas" 17895msgstr "Een Pascal-unit dient op .pp of .pas te eindigen." 17896 17897#: lazarusidestrconsts.lispvueditvirtualunit 17898msgid "Edit virtual unit" 17899msgstr "Bewerk virtuele unit" 17900 17901#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile 17902#, object-pascal-format 17903msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile" 17904msgid "There is already an unit with this name.%sFile: %s" 17905msgstr "" 17906 17907#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier 17908msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier" 17909msgid "The unitname is not a valid Pascal identifier." 17910msgstr "" 17911 17912#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses 17913msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses" 17914msgid "The unitname is used when the IDE extends uses clauses" 17915msgstr "" 17916 17917#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni 17918#, object-pascal-format 17919msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni" 17920msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" 17921msgstr "" 17922 17923#: lazarusidestrconsts.lispwconvertproject 17924msgid "Convert &Delphi Project" 17925msgstr "" 17926 17927#: lazarusidestrconsts.lispwnewproject 17928msgid "&New Project" 17929msgstr "" 17930 17931#: lazarusidestrconsts.lispwopenproject 17932msgid "&Open Project" 17933msgstr "" 17934 17935#: lazarusidestrconsts.lispwopenrecentproject 17936#, fuzzy 17937#| msgid "Open Recent Project" 17938msgctxt "lazarusidestrconsts.lispwopenrecentproject" 17939msgid "Open &Recent Project" 17940msgstr "Open Recent" 17941 17942#: lazarusidestrconsts.lispwviewexampleprojects 17943msgid "View &Example Projects" 17944msgstr "" 17945 17946#: lazarusidestrconsts.lisquickfixerror 17947msgid "QuickFix error" 17948msgstr "" 17949 17950#: lazarusidestrconsts.lisquickfixes 17951msgid "Quick fixes" 17952msgstr "" 17953 17954#: lazarusidestrconsts.lisquickfixremoveunit 17955msgid "Quick fix: Remove unit" 17956msgstr "" 17957 17958#: lazarusidestrconsts.lisquickfixsearchidentifier 17959msgid "Search identifier" 17960msgstr "" 17961 17962#: lazarusidestrconsts.lisquit 17963msgctxt "lazarusidestrconsts.lisquit" 17964msgid "Quit" 17965msgstr "" 17966 17967#: lazarusidestrconsts.lisquitlazarus 17968#, fuzzy 17969#| msgid "Quit Lazarus" 17970msgid "&Quit Lazarus" 17971msgstr "Verlaat Lazarus" 17972 17973#: lazarusidestrconsts.lisrange 17974#, fuzzy 17975msgctxt "lazarusidestrconsts.lisrange" 17976msgid "Range" 17977msgstr "Bereik" 17978 17979#: lazarusidestrconsts.lisreaderror 17980msgid "Read Error" 17981msgstr "Leesfout" 17982 17983#: lazarusidestrconsts.lisreallydelete 17984msgid "Really delete?" 17985msgstr "" 17986 17987#: lazarusidestrconsts.lisrecenttabs 17988msgid "Recent tabs" 17989msgstr "" 17990 17991#: lazarusidestrconsts.lisrecord 17992msgctxt "lazarusidestrconsts.lisrecord" 17993msgid "Record" 17994msgstr "" 17995 17996#: lazarusidestrconsts.lisrecordedmacros 17997msgid "Recorded" 17998msgstr "" 17999 18000#: lazarusidestrconsts.lisrecordstruct 18001msgid "Record/Structure" 18002msgstr "" 18003 18004#: lazarusidestrconsts.lisredo 18005msgctxt "lazarusidestrconsts.lisredo" 18006msgid "Redo" 18007msgstr "Opnieuw" 18008 18009#: lazarusidestrconsts.lisregisters 18010msgctxt "lazarusidestrconsts.lisregisters" 18011msgid "Registers" 18012msgstr "" 18013 18014#: lazarusidestrconsts.lisregularexpression 18015msgid "Regular expression" 18016msgstr "" 18017 18018#: lazarusidestrconsts.lisrelative 18019msgid "Relative" 18020msgstr "" 18021 18022#: lazarusidestrconsts.lisrelativepaths 18023msgid "Relative paths" 18024msgstr "Relatieve paden" 18025 18026#: lazarusidestrconsts.lisremove 18027msgctxt "lazarusidestrconsts.lisremove" 18028msgid "Remove" 18029msgstr "" 18030 18031#: lazarusidestrconsts.lisremove2 18032msgid "Remove?" 18033msgstr "" 18034 18035#: lazarusidestrconsts.lisremoveallinvalidproperties 18036msgid "Remove all invalid properties" 18037msgstr "Verwijder alle ongeldige properties" 18038 18039#: lazarusidestrconsts.lisremoveallmessagetypefilters 18040msgid "Remove all message type filters" 18041msgstr "" 18042 18043#: lazarusidestrconsts.lisremoveallunits 18044msgid "Remove all units" 18045msgstr "" 18046 18047#: lazarusidestrconsts.lisremovecompileroptionhidemessage 18048msgid "Remove Compiler Option Hide Message" 18049msgstr "" 18050 18051#: lazarusidestrconsts.lisremovedependenciesfrompackage 18052#, object-pascal-format 18053msgid "Remove %s dependencies from package \"%s\"?" 18054msgstr "" 18055 18056#: lazarusidestrconsts.lisremovedpropertys 18057#, object-pascal-format 18058msgid "Removed property \"%s\"." 18059msgstr "" 18060 18061#: lazarusidestrconsts.lisremovefilesfrompackage 18062#, object-pascal-format 18063msgid "Remove %s files from package \"%s\"?" 18064msgstr "" 18065 18066#: lazarusidestrconsts.lisremovefrominstalllist 18067msgid "Remove from install list" 18068msgstr "" 18069 18070#: lazarusidestrconsts.lisremovefromproject 18071#, fuzzy 18072#| msgid "Remove from project" 18073msgid "Remove from Project" 18074msgstr "Verwijder van Project" 18075 18076#: lazarusidestrconsts.lisremovefromsearchpath 18077msgid "Remove from search path" 18078msgstr "" 18079 18080#: lazarusidestrconsts.lisremoveincludepath 18081msgid "Remove include path?" 18082msgstr "" 18083 18084#: lazarusidestrconsts.lisremovelocalvariable 18085#, object-pascal-format 18086msgid "Remove local variable %s" 18087msgstr "" 18088 18089#: lazarusidestrconsts.lisremovelocalvariable3 18090#, object-pascal-format 18091msgid "Remove local variable \"%s\"" 18092msgstr "" 18093 18094#: lazarusidestrconsts.lisremovemessagetypefilter 18095msgid "Remove Message Type Filter" 18096msgstr "" 18097 18098#: lazarusidestrconsts.lisremovenonexistingfiles 18099msgid "Remove nonexistent files" 18100msgstr "" 18101 18102#: lazarusidestrconsts.lisremoveselectedunits 18103msgid "Remove selected units" 18104msgstr "" 18105 18106#: lazarusidestrconsts.lisremovethem 18107msgid "Remove them" 18108msgstr "Verwijder ze" 18109 18110#: lazarusidestrconsts.lisremovethepathsfromothersources 18111msgid "Remove the paths from \"Other sources\"" 18112msgstr "" 18113 18114#: lazarusidestrconsts.lisremoveunitpath 18115msgid "Remove unit path?" 18116msgstr "" 18117 18118#: lazarusidestrconsts.lisremoveuses 18119#, object-pascal-format 18120msgid "Remove uses \"%s\"" 18121msgstr "" 18122 18123#: lazarusidestrconsts.lisrename 18124msgctxt "lazarusidestrconsts.lisrename" 18125msgid "Rename" 18126msgstr "Hernoemen" 18127 18128#: lazarusidestrconsts.lisrename2 18129msgid "Rename ..." 18130msgstr "" 18131 18132#: lazarusidestrconsts.lisrenamefile 18133msgid "Rename file?" 18134msgstr "Hernoem bestand?" 18135 18136#: lazarusidestrconsts.lisrenamefilefailed 18137msgid "Rename file failed" 18138msgstr "Hernoemen van bestand gefaald." 18139 18140#: lazarusidestrconsts.lisrenameshowresult 18141msgid "Show list of renamed Identifiers" 18142msgstr "" 18143 18144#: lazarusidestrconsts.lisrenameto 18145#, object-pascal-format 18146msgid "Rename to %s" 18147msgstr "" 18148 18149#: lazarusidestrconsts.lisrenametolowercase 18150msgid "Rename to lowercase" 18151msgstr "Hernoemen in kleine letters" 18152 18153#: lazarusidestrconsts.lisreopenproject 18154msgid "Reopen project" 18155msgstr "" 18156 18157#: lazarusidestrconsts.lisreopenwithanotherencoding 18158msgid "Reopen with another encoding" 18159msgstr "" 18160 18161#: lazarusidestrconsts.lisrepeat 18162msgctxt "lazarusidestrconsts.lisrepeat" 18163msgid "Repeat" 18164msgstr "" 18165 18166#: lazarusidestrconsts.lisrepeatcount 18167msgid "Repeat Count:" 18168msgstr "" 18169 18170#: lazarusidestrconsts.lisreplace 18171msgctxt "lazarusidestrconsts.lisreplace" 18172msgid "Replace" 18173msgstr "Vervangen" 18174 18175#: lazarusidestrconsts.lisreplacedpropertyswiths 18176#, object-pascal-format 18177msgid "Replaced property \"%s\" with \"%s\"." 18178msgstr "" 18179 18180#: lazarusidestrconsts.lisreplacedtypeswiths 18181#, object-pascal-format 18182msgid "Replaced type \"%s\" with \"%s\"." 18183msgstr "" 18184 18185#: lazarusidestrconsts.lisreplacement 18186msgid "Replacement" 18187msgstr "" 18188 18189#: lazarusidestrconsts.lisreplacementfuncs 18190msgid "Replacement functions" 18191msgstr "" 18192 18193#: lazarusidestrconsts.lisreplacements 18194msgid "Replacements" 18195msgstr "" 18196 18197#: lazarusidestrconsts.lisreplaceremoveunknown 18198msgid "Fix unknown properties and types" 18199msgstr "" 18200 18201#: lazarusidestrconsts.lisreplacewholeidentifier 18202msgid "Replace whole identifier" 18203msgstr "" 18204 18205#: lazarusidestrconsts.lisreplacingselectionfailed 18206msgid "Replacing selection failed." 18207msgstr "Het vervangen van de selectie is niet gelukt." 18208 18209#: lazarusidestrconsts.lisreportingbugurl 18210msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" 18211msgstr "" 18212 18213#: lazarusidestrconsts.lisrescan 18214msgid "Rescan" 18215msgstr "" 18216 18217#: lazarusidestrconsts.lisreset 18218msgctxt "lazarusidestrconsts.lisreset" 18219msgid "Reset" 18220msgstr "" 18221 18222#: lazarusidestrconsts.lisresetallfilefilterstodefaults 18223msgid "Reset all file filters to defaults?" 18224msgstr "" 18225 18226#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir 18227msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?" 18228msgstr "" 18229 18230#: lazarusidestrconsts.lisresourcenamemustbeunique 18231msgid "Resource name must be unique." 18232msgstr "" 18233 18234#: lazarusidestrconsts.lisresourcesaveerror 18235msgid "Resource save error" 18236msgstr "Fout bij opslaan Resource" 18237 18238#: lazarusidestrconsts.lisresourcetypeofnewfiles 18239msgid "Resource type of project" 18240msgstr "" 18241 18242#: lazarusidestrconsts.lisrestart 18243msgctxt "lazarusidestrconsts.lisrestart" 18244msgid "Restart" 18245msgstr "Herstart" 18246 18247#: lazarusidestrconsts.lisresult2 18248msgid "Result:" 18249msgstr "" 18250 18251#: lazarusidestrconsts.lisreturnparameterindexedword 18252msgid "" 18253"Return parameter-indexed word from the current line preceding cursor position.\n" 18254"\n" 18255"Words in a line are numbered 1,2,3,... from left to right, but the last word\n" 18256"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n" 18257"is always the current macro.\n" 18258"\n" 18259"Example line:\n" 18260"i 0 count-1 forb|\n" 18261"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n" 18262"\n" 18263"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+" 18264msgstr "" 18265 18266#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria 18267msgid "" 18268"Return the list of all values of case variable in front of variable.\n" 18269"\n" 18270"Optional Parameters (comma separated):\n" 18271"WithoutExtraIndent // the case list will be generated without extra indentation" 18272msgstr "" 18273 18274#: lazarusidestrconsts.lisrevertfailed 18275msgid "Revert failed" 18276msgstr "Terugzetten mislukt" 18277 18278#: lazarusidestrconsts.lisrevision 18279msgid "Revision: " 18280msgstr "" 18281 18282#: lazarusidestrconsts.lisright 18283msgctxt "lazarusidestrconsts.lisright" 18284msgid "Right" 18285msgstr "Rechts" 18286 18287#: lazarusidestrconsts.lisrightanchoring 18288msgid "Right anchoring" 18289msgstr "Rechter ankering" 18290 18291#: lazarusidestrconsts.lisrightborderspacespinedithint 18292msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." 18293msgstr "" 18294 18295#: lazarusidestrconsts.lisrightsiblingcomboboxhint 18296#, fuzzy 18297#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)." 18298msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 18299msgstr "Dit is het verwante control waaraan de rechterzijde is verankerd. Laat het leeg voor ouders" 18300 18301#: lazarusidestrconsts.lisrightsides 18302msgid "Right sides" 18303msgstr "Rechter kanten" 18304 18305#: lazarusidestrconsts.lisrightspaceequally 18306msgid "Right space equally" 18307msgstr "Verdeel rechter kant evenredig" 18308 18309#: lazarusidestrconsts.lisroot 18310msgid "Root" 18311msgstr "" 18312 18313#: lazarusidestrconsts.lisrootdirectory 18314msgid "Root Directory" 18315msgstr "" 18316 18317#: lazarusidestrconsts.lisrun 18318msgctxt "lazarusidestrconsts.lisrun" 18319msgid "Run" 18320msgstr "Starten" 18321 18322#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations 18323msgid "\"Run and Design time\" packages have no limitations." 18324msgstr "" 18325 18326#: lazarusidestrconsts.lisrunbuttonhint 18327msgctxt "lazarusidestrconsts.lisrunbuttonhint" 18328msgid "Run" 18329msgstr "Starten" 18330 18331#: lazarusidestrconsts.lisrunning 18332#, object-pascal-format 18333msgid "%s (running ...)" 18334msgstr "" 18335 18336#: lazarusidestrconsts.lisrunparamsfilenotexecutable 18337msgid "File not executable" 18338msgstr "Bestand niet uitvoerbaar" 18339 18340#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable 18341#, object-pascal-format, fuzzy 18342#| msgid "The host application %s%s%s is not executable." 18343msgid "The host application \"%s\" is not executable." 18344msgstr "Het \"host\" programma \"%s\" is niet uitvoerbaar." 18345 18346#: lazarusidestrconsts.lisrunstage 18347msgctxt "lazarusidestrconsts.lisrunstage" 18348msgid "Run" 18349msgstr "Starten" 18350 18351#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide 18352msgid "Runtime only, cannot be installed in IDE" 18353msgstr "" 18354 18355#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei 18356msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly." 18357msgstr "" 18358 18359#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst 18360msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them." 18361msgstr "" 18362 18363#: lazarusidestrconsts.lisruntofailed 18364msgid "Run-to failed" 18365msgstr "Uitvoeren to mislukte" 18366 18367#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden 18368msgid "Abstract Methods - not yet overridden" 18369msgstr "" 18370 18371#: lazarusidestrconsts.lissamabstractmethodsof 18372#, object-pascal-format 18373msgid "Abstract methods of %s" 18374msgstr "" 18375 18376#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration 18377msgid "Cursor is not in a class declaration" 18378msgstr "" 18379 18380#: lazarusidestrconsts.lissamideisbusy 18381msgid "IDE is busy" 18382msgstr "" 18383 18384#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods 18385#, object-pascal-format 18386msgid "%s is an abstract class, it has %s abstract methods." 18387msgstr "" 18388 18389#: lazarusidestrconsts.lissamnoabstractmethodsfound 18390msgid "No abstract methods found" 18391msgstr "" 18392 18393#: lazarusidestrconsts.lissamoverrideallselected 18394msgid "Override all selected" 18395msgstr "" 18396 18397#: lazarusidestrconsts.lissamoverridefirstselected 18398msgid "Override first selected" 18399msgstr "" 18400 18401#: lazarusidestrconsts.lissamselectnone 18402msgid "Select none" 18403msgstr "" 18404 18405#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf 18406#, object-pascal-format 18407msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" 18408msgstr "" 18409 18410#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride 18411msgid "There are no abstract methods left to override." 18412msgstr "" 18413 18414#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth 18415msgid "This method can not be overridden because it is defined in the current class" 18416msgstr "" 18417 18418#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus 18419msgid "Unable to show abstract methods of the current class, because" 18420msgstr "" 18421 18422#: lazarusidestrconsts.lissave 18423#, fuzzy 18424#| msgid "Save ..." 18425msgctxt "lazarusidestrconsts.lissave" 18426msgid "Save" 18427msgstr "Opslaan ..." 18428 18429#: lazarusidestrconsts.lissaveall 18430msgctxt "lazarusidestrconsts.lissaveall" 18431msgid "Save All" 18432msgstr "Alles Opslaan" 18433 18434#: lazarusidestrconsts.lissaveallchecked 18435msgid "Save All Checked" 18436msgstr "" 18437 18438#: lazarusidestrconsts.lissaveallmodified 18439#, fuzzy 18440#| msgid "save all modified files" 18441msgid "Save all modified files" 18442msgstr "alle gewijzigde bestanden opslaan" 18443 18444#: lazarusidestrconsts.lissavealloriginalmessagestofile 18445msgid "Save All/Original Messages to File ..." 18446msgstr "" 18447 18448#: lazarusidestrconsts.lissaveandexitdialog 18449msgid "Save and exit dialog" 18450msgstr "Opslaan en dialoog sluiten" 18451 18452#: lazarusidestrconsts.lissaveandrebuildide 18453msgid "Save and rebuild IDE" 18454msgstr "Opslaan and IDE opnieuw bouwen" 18455 18456#: lazarusidestrconsts.lissaveas 18457msgctxt "lazarusidestrconsts.lissaveas" 18458msgid "Save As" 18459msgstr "Opslaan Als" 18460 18461#: lazarusidestrconsts.lissavechangedfiles 18462msgid "Save changed files?" 18463msgstr "" 18464 18465#: lazarusidestrconsts.lissavechanges 18466msgid "Save changes?" 18467msgstr "Wijzigingen opslaan?" 18468 18469#: lazarusidestrconsts.lissavechangestoproject 18470#, object-pascal-format 18471msgid "Save changes to project %s?" 18472msgstr "Wijzigingen in project %s opslaan?" 18473 18474#: lazarusidestrconsts.lissavecurrenteditorfile 18475#, fuzzy 18476#| msgid "save current editor file" 18477msgid "Save current editor file" 18478msgstr "huidige bestanden in de bewerker opslaan" 18479 18480#: lazarusidestrconsts.lissavedwithidesettings 18481msgid "Saved with IDE settings" 18482msgstr "" 18483 18484#: lazarusidestrconsts.lissavedwithprojectsession 18485msgid "Saved with project session" 18486msgstr "" 18487 18488#: lazarusidestrconsts.lissavefileas 18489msgid "Save file as" 18490msgstr "Sla bestand op als" 18491 18492#: lazarusidestrconsts.lissavefilebeforeclosingform 18493#, object-pascal-format, fuzzy 18494#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?" 18495msgid "Save file \"%s\"%sbefore closing form \"%s\"?" 18496msgstr "Bestand \"%s\"%sopslaan voor het sluiten van form \"%s\"?" 18497 18498#: lazarusidestrconsts.lissavemacroas 18499msgid "Save macro as" 18500msgstr "" 18501 18502#: lazarusidestrconsts.lissavemessages 18503msgid "Save messages" 18504msgstr "" 18505 18506#: lazarusidestrconsts.lissaveproject 18507#, object-pascal-format 18508msgid "Save project %s (*%s)" 18509msgstr "" 18510 18511#: lazarusidestrconsts.lissavesessionchangestoproject 18512#, object-pascal-format 18513msgid "Save session changes to project %s?" 18514msgstr "" 18515 18516#: lazarusidestrconsts.lissavesessionfoldstate 18517msgctxt "lazarusidestrconsts.lissavesessionfoldstate" 18518msgid "Save fold info" 18519msgstr "" 18520 18521#: lazarusidestrconsts.lissavesessionfoldstatehint 18522msgid "Code editor supports folding (temporarily hiding) blocks of code." 18523msgstr "" 18524 18525#: lazarusidestrconsts.lissavesessionjumphistory 18526msgctxt "lazarusidestrconsts.lissavesessionjumphistory" 18527msgid "Save jump history" 18528msgstr "" 18529 18530#: lazarusidestrconsts.lissavesessionjumphistoryhint 18531msgid "Ctrl-Click on an identifier in code editor is stored in jump history." 18532msgstr "" 18533 18534#: lazarusidestrconsts.lissavesettings 18535msgid "Save Settings" 18536msgstr "Sla instelling op" 18537 18538#: lazarusidestrconsts.lissaveshownmessagestofile 18539msgid "Save Shown Messages to File ..." 18540msgstr "" 18541 18542#: lazarusidestrconsts.lissavespace 18543msgid "Save " 18544msgstr "Opslaan " 18545 18546#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn 18547#, object-pascal-format 18548msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s." 18549msgstr "" 18550 18551#: lazarusidestrconsts.lisscalingfactor 18552msgid "Scaling factor:" 18553msgstr "Schaal:" 18554 18555#: lazarusidestrconsts.lisscanfilesinparentdir 18556msgid "Scan files in parent directory" 18557msgstr "" 18558 18559#: lazarusidestrconsts.lisscanfilesinparentdirhint 18560msgid "Search for source files in sibling directories (parent directory and its children)" 18561msgstr "" 18562 18563#: lazarusidestrconsts.lisscanning 18564msgid "Scanning" 18565msgstr "" 18566 18567#: lazarusidestrconsts.lisscanning2 18568#, object-pascal-format 18569msgid "%s. Scanning ..." 18570msgstr "" 18571 18572#: lazarusidestrconsts.lisscanparentdir 18573msgid "Scanning parent directory" 18574msgstr "" 18575 18576#: lazarusidestrconsts.lissearchpaths2 18577msgid "Search paths" 18578msgstr "" 18579 18580#: lazarusidestrconsts.lissearchunit 18581#, object-pascal-format 18582msgid "Search Unit \"%s\"" 18583msgstr "" 18584 18585#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor 18586#, fuzzy 18587#| msgid "secondary config directory, where Lazarus searches for config template files. Default is " 18588msgid "secondary config directory where Lazarus searches for config template files. Default is " 18589msgstr "tweede configuratie directory, waar Lazarus zoekt voor configuratie template bestanden. Standaard is " 18590 18591#: lazarusidestrconsts.lissecondaryconfigpath 18592msgid "Secondary config path" 18593msgstr "" 18594 18595#: lazarusidestrconsts.lissecondtest 18596msgid "&Second test" 18597msgstr "" 18598 18599#: lazarusidestrconsts.lisseemessages 18600msgid "See messages." 18601msgstr "Zie meldingen." 18602 18603#: lazarusidestrconsts.lisseeprojectprojectinspector 18604#, object-pascal-format 18605msgid "%sSee Project -> Project Inspector" 18606msgstr "%sZie project -> Project Inspecteur" 18607 18608#: lazarusidestrconsts.lisselectahelpitem 18609msgid "Select a help item:" 18610msgstr "Selecteer een help item:" 18611 18612#: lazarusidestrconsts.lisselectanode 18613msgid "Select a node" 18614msgstr "Selecteer een node" 18615 18616#: lazarusidestrconsts.lisselectanotherlclwidgetset 18617msgid "Select another LCL widgetset (macro LCLWidgetType)" 18618msgstr "" 18619 18620#: lazarusidestrconsts.lisselectdfmfiles 18621msgid "Select Delphi form files (*.dfm)" 18622msgstr "Selecteer Delphi form bestanden (*.dfm)" 18623 18624#: lazarusidestrconsts.lisselected 18625msgctxt "lazarusidestrconsts.lisselected" 18626msgid "Selected" 18627msgstr "" 18628 18629#: lazarusidestrconsts.lisselectedaddition 18630msgid "Selected addition:" 18631msgstr "" 18632 18633#: lazarusidestrconsts.lisselectedandchildcontrols 18634msgid "Selected and child controls" 18635msgstr "" 18636 18637#: lazarusidestrconsts.lisselectedbottomneighbour 18638msgid "(selected bottom neighbour)" 18639msgstr "" 18640 18641#: lazarusidestrconsts.lisselectedcommandsmapping 18642msgid "Selected Command's Mapping" 18643msgstr "" 18644 18645#: lazarusidestrconsts.lisselectedforinstallation 18646msgid "selected for installation" 18647msgstr "" 18648 18649#: lazarusidestrconsts.lisselectedforuninstallation 18650msgid "selected for uninstallation" 18651msgstr "" 18652 18653#: lazarusidestrconsts.lisselectedleftneighbour 18654msgid "(selected left neighbour)" 18655msgstr "" 18656 18657#: lazarusidestrconsts.lisselectedmessageinmessageswindow 18658msgid "Selected message in messages window:" 18659msgstr "" 18660 18661#: lazarusidestrconsts.lisselectedmodeswerecompiled 18662#, object-pascal-format 18663msgid "Selected %d modes were successfully compiled." 18664msgstr "" 18665 18666#: lazarusidestrconsts.lisselectedrightneighbour 18667msgid "(selected right neighbour)" 18668msgstr "" 18669 18670#: lazarusidestrconsts.lisselectedtopneighbour 18671msgid "(selected top neighbour)" 18672msgstr "" 18673 18674#: lazarusidestrconsts.lisselectfile 18675msgid "Select the file" 18676msgstr "" 18677 18678#: lazarusidestrconsts.lisselectfpcpath 18679msgid "Select the path where FPC is installed" 18680msgstr "" 18681 18682#: lazarusidestrconsts.lisselectfpcsourcedirectory 18683msgid "Select FPC source directory" 18684msgstr "" 18685 18686#: lazarusidestrconsts.lisselectframe 18687msgid "Select Frame" 18688msgstr "" 18689 18690#: lazarusidestrconsts.lisselectionexceedsstringconstant 18691msgid "Selection exceeds string constant" 18692msgstr "Selectie overschrijdt string constante" 18693 18694#: lazarusidestrconsts.lisselectiontool 18695msgid "Selection tool" 18696msgstr "Selectie tool" 18697 18698#: lazarusidestrconsts.lisselectlazarussourcedirectory 18699msgid "Select Lazarus source directory" 18700msgstr "" 18701 18702#: lazarusidestrconsts.lisselectpathto 18703#, object-pascal-format 18704msgid "Select path to %s" 18705msgstr "" 18706 18707#: lazarusidestrconsts.lisselecttargetdirectory 18708msgid "Select target directory" 18709msgstr "" 18710 18711#: lazarusidestrconsts.lissetallcolors 18712msgid "Set all colors:" 18713msgstr "" 18714 18715#: lazarusidestrconsts.lissetdefault 18716msgid "Set default" 18717msgstr "" 18718 18719#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang 18720msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg." 18721msgstr "" 18722 18723#: lazarusidestrconsts.lissetupdefaultindentation 18724msgid "(Set up default indentation)" 18725msgstr "" 18726 18727#: lazarusidestrconsts.lisshort 18728msgid "Short:" 18729msgstr "" 18730 18731#: lazarusidestrconsts.lisshortnopath 18732msgid "Short, no path" 18733msgstr "" 18734 18735#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications 18736#, object-pascal-format 18737msgid "Should the component \"%s\" be auto created when the application starts?" 18738msgstr "" 18739 18740#: lazarusidestrconsts.lisshow 18741msgid "Show" 18742msgstr "" 18743 18744#: lazarusidestrconsts.lisshowabstractmethodsof 18745#, object-pascal-format 18746msgid "Show abstract methods of \"%s\"" 18747msgstr "" 18748 18749#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector 18750msgid "Show component tree" 18751msgstr "" 18752 18753#: lazarusidestrconsts.lisshowconsole 18754msgid "Show console" 18755msgstr "" 18756 18757#: lazarusidestrconsts.lisshowdeclarationhints 18758msgid "Show declaration hints" 18759msgstr "" 18760 18761#: lazarusidestrconsts.lisshowdifferencesbetweenmodes 18762msgid "Show differences between modes ..." 18763msgstr "" 18764 18765#: lazarusidestrconsts.lisshowemptyunitspackages 18766msgid "Show empty units/packages" 18767msgstr "" 18768 18769#: lazarusidestrconsts.lisshowfpcmessagelinescompiled 18770msgid "Show FPC message \"lines compiled\"" 18771msgstr "" 18772 18773#: lazarusidestrconsts.lisshowglyphsfor 18774msgid "Show Glyphs for" 18775msgstr "" 18776 18777#: lazarusidestrconsts.lisshowgutterinobjectinspector 18778msgid "Show gutter" 18779msgstr "" 18780 18781#: lazarusidestrconsts.lisshowhelp 18782msgid "Show help" 18783msgstr "" 18784 18785#: lazarusidestrconsts.lisshowhintsinobjectinspector 18786#, fuzzy 18787msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector" 18788msgid "Show hints" 18789msgstr "Toon hints in Object Inspecteur" 18790 18791#: lazarusidestrconsts.lisshowidentifiers 18792msgid "Show identifiers" 18793msgstr "" 18794 18795#: lazarusidestrconsts.lisshowinfoboxinobjectinspector 18796msgid "Show information box" 18797msgstr "" 18798 18799#: lazarusidestrconsts.lisshowmessagetypeid 18800msgid "Show Message Type ID" 18801msgstr "" 18802 18803#: lazarusidestrconsts.lisshowmultiplelines 18804msgid "Show multiple lines" 18805msgstr "" 18806 18807#: lazarusidestrconsts.lisshowonlymodified 18808msgid "Show only modified" 18809msgstr "" 18810 18811#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead 18812msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window." 18813msgstr "" 18814 18815#: lazarusidestrconsts.lisshowoutput 18816msgid "Show output" 18817msgstr "" 18818 18819#: lazarusidestrconsts.lisshowoverviewgutter 18820msgid "Show overview gutter" 18821msgstr "" 18822 18823#: lazarusidestrconsts.lisshowpackages 18824msgid "Show packages" 18825msgstr "Toon paketten" 18826 18827#: lazarusidestrconsts.lisshowpositionofsourceeditor 18828msgid "Show position of source editor" 18829msgstr "" 18830 18831#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector 18832msgid "Show property filter" 18833msgstr "" 18834 18835#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop 18836msgid "Show recently used identifiers at top" 18837msgstr "" 18838 18839#: lazarusidestrconsts.lisshowrelativepaths 18840msgid "Show relative paths" 18841msgstr "" 18842 18843#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy 18844msgid "Shows all controls in tree hierarchy." 18845msgstr "" 18846 18847#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty 18848msgid "A box at the bottom shows description for the selected property." 18849msgstr "" 18850 18851#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings 18852msgid "Show setup dialog for most important settings" 18853msgstr "" 18854 18855#: lazarusidestrconsts.lisshowspecialcharacters 18856msgid "Show special characters" 18857msgstr "" 18858 18859#: lazarusidestrconsts.lisshowstatusbarinobjectinspector 18860msgid "Show statusbar" 18861msgstr "" 18862 18863#: lazarusidestrconsts.lisshowunits 18864msgid "Show units" 18865msgstr "Toon units" 18866 18867#: lazarusidestrconsts.lisshowunitswithinitialization 18868msgid "Show units with initialization/finalization sections" 18869msgstr "" 18870 18871#: lazarusidestrconsts.lisshowunitswithinitializationhint 18872msgid "These units may initialize global data used by the program/application. Remove with care." 18873msgstr "" 18874 18875#: lazarusidestrconsts.lisshowunusedunits 18876msgid "Show unused units ..." 18877msgstr "" 18878 18879#: lazarusidestrconsts.lisshowvaluehintswhiledebugging 18880msgid "Show value hints while debugging" 18881msgstr "" 18882 18883#: lazarusidestrconsts.lisshowversionandexit 18884msgid "show version and exit" 18885msgstr "" 18886 18887#: lazarusidestrconsts.lisshrinktosmal 18888msgid "Shrink to smallest" 18889msgstr "" 18890 18891#: lazarusidestrconsts.lissibling 18892msgid "Sibling" 18893msgstr "Nakomeling" 18894 18895#: lazarusidestrconsts.lissimpleprogram 18896msgid "Simple Program" 18897msgstr "" 18898 18899#: lazarusidestrconsts.lissimpleprogramprogramdescriptor 18900msgid "A most simple Free Pascal command line program." 18901msgstr "" 18902 18903#: lazarusidestrconsts.lissimplesyntax 18904#, fuzzy 18905#| msgid "Simple Syntax" 18906msgid "Simple syntax" 18907msgstr "Eenvoudige syntax" 18908 18909#: lazarusidestrconsts.lisskiperrors 18910msgid "Skip errors" 18911msgstr "" 18912 18913#: lazarusidestrconsts.lisskipfile 18914msgid "Skip file" 18915msgstr "" 18916 18917#: lazarusidestrconsts.lisskipfileandcontinueloading 18918msgid "Skip file and continue loading" 18919msgstr "Sla bestand over en vervolg het laden" 18920 18921#: lazarusidestrconsts.lisskiploadinglastproject 18922msgid "Skip loading last project" 18923msgstr "Sla het laden van het laatste project over" 18924 18925#: lazarusidestrconsts.lisskipthesewarnings 18926msgid "Skip these warnings" 18927msgstr "" 18928 18929#: lazarusidestrconsts.lisslowerbutmoreaccurate 18930msgid "Slower but more accurate." 18931msgstr "" 18932 18933#: lazarusidestrconsts.lissmallerratherthanfaster 18934msgid "Smaller rather than faster" 18935msgstr "" 18936 18937#: lazarusidestrconsts.lissmatches 18938msgid "Matches" 18939msgstr "Komt overeen" 18940 18941#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented 18942msgid "Sorry, this type is not yet implemented" 18943msgstr "Excuses, dit type is nog niet geimplementeerd." 18944 18945#: lazarusidestrconsts.lissortforscope 18946msgid "Sort for scope" 18947msgstr "" 18948 18949#: lazarusidestrconsts.lissorting 18950msgid "Sorting" 18951msgstr "" 18952 18953#: lazarusidestrconsts.lissortselascending 18954msgid "Ascending" 18955msgstr "Neerwaarts" 18956 18957#: lazarusidestrconsts.lissortselcasesensitive 18958msgctxt "lazarusidestrconsts.lissortselcasesensitive" 18959msgid "&Case Sensitive" 18960msgstr "" 18961 18962#: lazarusidestrconsts.lissortseldescending 18963msgid "Descending" 18964msgstr "Neerwaarts" 18965 18966#: lazarusidestrconsts.lissortseldomain 18967msgid "Domain" 18968msgstr "Domein" 18969 18970#: lazarusidestrconsts.lissortselignorespace 18971msgid "Ignore Space" 18972msgstr "Negeer Space" 18973 18974#: lazarusidestrconsts.lissortsellines 18975msgid "Lines" 18976msgstr "Regels" 18977 18978#: lazarusidestrconsts.lissortseloptions 18979msgctxt "lazarusidestrconsts.lissortseloptions" 18980msgid "Options" 18981msgstr "Opties" 18982 18983#: lazarusidestrconsts.lissortselparagraphs 18984msgid "Paragraphs" 18985msgstr "Paragrafen" 18986 18987#: lazarusidestrconsts.lissortselpreview 18988msgctxt "lazarusidestrconsts.lissortselpreview" 18989msgid "Preview" 18990msgstr "Voorbeeld" 18991 18992#: lazarusidestrconsts.lissortselsort 18993msgid "Accept" 18994msgstr "Accepteer" 18995 18996#: lazarusidestrconsts.lissortselsortselection 18997msgid "Sort selection" 18998msgstr "Sorteer Selectie" 18999 19000#: lazarusidestrconsts.lissortselwords 19001msgctxt "lazarusidestrconsts.lissortselwords" 19002msgid "Words" 19003msgstr "Woorden" 19004 19005#: lazarusidestrconsts.lissortunicoderangelistalphabetically 19006msgid "Sort Unicode range list alphabetically" 19007msgstr "" 19008 19009#: lazarusidestrconsts.lissourceanddestinationaresame 19010#, object-pascal-format 19011msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory." 19012msgstr "" 19013 19014#: lazarusidestrconsts.lissourceanddestinationarethesame 19015#, object-pascal-format 19016msgid "Source and Destination are the same:%s%s" 19017msgstr "Bron en doel zijn het zelfde:%s%s" 19018 19019#: lazarusidestrconsts.lissourcebreakpoint 19020msgid "&Source Breakpoint ..." 19021msgstr "" 19022 19023#: lazarusidestrconsts.lissourcedirectorydoesnotexist 19024#, object-pascal-format, fuzzy 19025#| msgid "Source directory %s%s%s does not exist." 19026msgid "Source directory \"%s\" does not exist." 19027msgstr "Bron directory \"%s\" bestaat niet" 19028 19029#: lazarusidestrconsts.lissourceeditorwindowmanager 19030msgid "Source Editor Window Manager" 19031msgstr "" 19032 19033#: lazarusidestrconsts.lissourcemodified 19034msgid "Source modified" 19035msgstr "Bron gewijzigd" 19036 19037#: lazarusidestrconsts.lissourceofpagehaschangedsave 19038#, object-pascal-format, fuzzy 19039#| msgid "Source of page %s%s%s has changed. Save?" 19040msgid "Source of page \"%s\" has changed. Save?" 19041msgstr "Bron van pagina \"%s\" is gewijzigd. Opslaan?" 19042 19043#: lazarusidestrconsts.lissourceofpagehaschangedsaveex 19044#, object-pascal-format 19045msgid "Sources of pages have changed. Save page \"%s\"? (%d more)" 19046msgstr "" 19047 19048#: lazarusidestrconsts.lissourcepaths 19049msgid "Source paths" 19050msgstr "Bron paden" 19051 19052#: lazarusidestrconsts.lisspaceequally 19053msgid "Space equally" 19054msgstr "Gelijkmatige verdeling" 19055 19056#: lazarusidestrconsts.lissrcos 19057msgid "Src OS" 19058msgstr "" 19059 19060#: lazarusidestrconsts.lisssearching 19061msgid "Searching" 19062msgstr "Bezig met zoeken" 19063 19064#: lazarusidestrconsts.lisssearchtext 19065msgid "Search text" 19066msgstr "Zoek tekst" 19067 19068#: lazarusidestrconsts.lisstartconversion 19069msgid "Start Conversion" 19070msgstr "" 19071 19072#: lazarusidestrconsts.lisstartide 19073msgid "Start IDE" 19074msgstr "" 19075 19076#: lazarusidestrconsts.lisstartwithanewproject 19077msgid "Start with a new project" 19078msgstr "Met een nieuw project starten" 19079 19080#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass 19081msgid "Statusbar shows the property's name and the class where it is published." 19082msgstr "" 19083 19084#: lazarusidestrconsts.lisstop 19085msgctxt "lazarusidestrconsts.lisstop" 19086msgid "Stop" 19087msgstr "Stoppen" 19088 19089#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject 19090msgid "Stop current debugging and rebuild project?" 19091msgstr "Stop huidige debugsessie en het project opnieuw bouwen?" 19092 19093#: lazarusidestrconsts.lisstopdebugging 19094msgid "Stop Debugging?" 19095msgstr "Stoppen met debuggen?" 19096 19097#: lazarusidestrconsts.lisstopdebugging2 19098msgid "Stop debugging?" 19099msgstr "Stop debugsessie" 19100 19101#: lazarusidestrconsts.lisstoponexception 19102msgid "Stop on exception" 19103msgstr "" 19104 19105#: lazarusidestrconsts.lisstopthedebugging 19106msgid "Stop the debugging?" 19107msgstr "Stoppen met debuggen?" 19108 19109#: lazarusidestrconsts.lisstorepathdelimitersandas 19110msgid "Store path delimiters \\ and / as" 19111msgstr "" 19112 19113#: lazarusidestrconsts.lisstrangelpifile 19114msgid "Strange lpi file" 19115msgstr "" 19116 19117#: lazarusidestrconsts.lisstreamingerror 19118msgid "Streaming error" 19119msgstr "Fout in streaming" 19120 19121#: lazarusidestrconsts.lisstring 19122msgid "String" 19123msgstr "" 19124 19125#: lazarusidestrconsts.lisstyle 19126msgctxt "lazarusidestrconsts.lisstyle" 19127msgid "Style" 19128msgstr "" 19129 19130#: lazarusidestrconsts.lissubprocedure 19131msgid "Sub Procedure" 19132msgstr "Subprocedure" 19133 19134#: lazarusidestrconsts.lissubprocedureonsamelevel 19135msgid "Sub Procedure on same level" 19136msgstr "Subprocedure op hetzelfde niveau" 19137 19138#: lazarusidestrconsts.lissuccess 19139msgid "Success" 19140msgstr "Succes!" 19141 19142#: lazarusidestrconsts.lissuccessfullyexported 19143#, object-pascal-format 19144msgid "Successfully exported to \"%s\"." 19145msgstr "" 19146 19147#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes 19148#, object-pascal-format 19149msgid "Successfully exported %d BuildModes to \"%s\"." 19150msgstr "" 19151 19152#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions 19153#, object-pascal-format 19154msgid "Successfully exported compiler options to \"%s\"." 19155msgstr "" 19156 19157#: lazarusidestrconsts.lissuccessfullyimported 19158#, object-pascal-format 19159msgid "Successfully imported from \"%s\"." 19160msgstr "" 19161 19162#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes 19163#, object-pascal-format 19164msgid "Successfully imported %d BuildModes from \"%s\"." 19165msgstr "" 19166 19167#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions 19168#, object-pascal-format 19169msgid "Successfully imported compiler options from \"%s\"." 19170msgstr "" 19171 19172#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase 19173msgid "Suggest default name of new file in lowercase" 19174msgstr "" 19175 19176#: lazarusidestrconsts.lissuspiciousincludepath 19177msgid "Suspicious include path" 19178msgstr "" 19179 19180#: lazarusidestrconsts.lissuspiciousunitpath 19181msgid "Suspicious unit path" 19182msgstr "" 19183 19184#: lazarusidestrconsts.lissvuoinvalidvariablename 19185msgid "Invalid variable name" 19186msgstr "Ongeldige variabele naam" 19187 19188#: lazarusidestrconsts.lissvuoisnotavalididentifier 19189#, object-pascal-format, fuzzy 19190#| msgid "%s%s%s is not a valid identifier." 19191msgid "\"%s\" is not a valid identifier." 19192msgstr "\"%s\" is geen geldige identifier." 19193 19194#: lazarusidestrconsts.lissvuooverridesystemvariable 19195msgid "Override system variable" 19196msgstr "Overrule the systeem variabele" 19197 19198#: lazarusidestrconsts.lisswitchfiltersettings 19199msgid "Switch Filter Settings" 19200msgstr "" 19201 19202#: lazarusidestrconsts.lisswitchtofavoritestabafterasking 19203msgid "Switch to Favorites tab after asking for component name." 19204msgstr "" 19205 19206#: lazarusidestrconsts.lissyntaxmode 19207msgid "Syntax mode" 19208msgstr "" 19209 19210#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg 19211msgid "system.ppu not found. Check your fpc.cfg." 19212msgstr "" 19213 19214#: lazarusidestrconsts.listab 19215msgid "Tab" 19216msgstr "Tab" 19217 19218#: lazarusidestrconsts.listaborderconfirmsort 19219#, object-pascal-format 19220msgid "Sort tab orders of all child controls of \"%s\" by their positions?" 19221msgstr "" 19222 19223#: lazarusidestrconsts.listaborderdownhint 19224msgid "Move the selected control down in tab order" 19225msgstr "" 19226 19227#: lazarusidestrconsts.listaborderof 19228#, object-pascal-format, fuzzy 19229#| msgid "Tab Order of" 19230msgid "Tab Order of %s" 19231msgstr "Tab volgorde van %s" 19232 19233#: lazarusidestrconsts.listaborderrecursionhint 19234msgid "Calculate tab order recursively for child controls" 19235msgstr "" 19236 19237#: lazarusidestrconsts.listaborderrecursively 19238msgid "recursively" 19239msgstr "" 19240 19241#: lazarusidestrconsts.listabordersorthint 19242msgid "Calculate tab order for controls by their X- and Y- positions" 19243msgstr "" 19244 19245#: lazarusidestrconsts.listaborderuphint 19246msgid "Move the selected control up in tab order" 19247msgstr "" 19248 19249#: lazarusidestrconsts.listabsfor 19250#, object-pascal-format 19251msgid "Tabs for %s" 19252msgstr "" 19253 19254#: lazarusidestrconsts.listakesnapshot 19255msgid "Take a Snapshot" 19256msgstr "" 19257 19258#: lazarusidestrconsts.listarget 19259msgid "Target:" 19260msgstr "" 19261 19262#: lazarusidestrconsts.listarget2 19263#, object-pascal-format 19264msgid ", Target: %s" 19265msgstr "" 19266 19267#: lazarusidestrconsts.listargetcpu 19268msgid "Target CPU" 19269msgstr "Doel processor" 19270 19271#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory 19272msgid "Target file name: (-o, empty = use unit output directory)" 19273msgstr "" 19274 19275#: lazarusidestrconsts.listargetfilenameo 19276msgid "Target file name (-o):" 19277msgstr "" 19278 19279#: lazarusidestrconsts.listargetfilenameofproject 19280msgid "Target filename of project" 19281msgstr "Doelbestandsnaam van het projekt" 19282 19283#: lazarusidestrconsts.listargetfilenameplusparams 19284msgid "Target filename + params" 19285msgstr "" 19286 19287#: lazarusidestrconsts.listargetisreadonly 19288msgid "Target is read only" 19289msgstr "" 19290 19291#: lazarusidestrconsts.listargetos 19292msgctxt "lazarusidestrconsts.listargetos" 19293msgid "Target OS" 19294msgstr "Doel OS" 19295 19296#: lazarusidestrconsts.listemplateeditparamcell 19297msgid "Editable Cell" 19298msgstr "" 19299 19300#: lazarusidestrconsts.listemplateeditparamcellhelp 19301#, object-pascal-format 19302msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")." 19303msgstr "" 19304 19305#: lazarusidestrconsts.listemplatefile 19306msgid "Template file" 19307msgstr "" 19308 19309#: lazarusidestrconsts.listestdirectory 19310msgid "Test directory" 19311msgstr "Testdirectorie" 19312 19313#: lazarusidestrconsts.listesturl 19314msgid "Test URL" 19315msgstr "" 19316 19317#: lazarusidestrconsts.listheapplicationbundlewascreatedfor 19318#, object-pascal-format 19319msgid "The Application Bundle was created for \"%s\"" 19320msgstr "" 19321 19322#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro 19323#, object-pascal-format, fuzzy 19324#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste." 19325msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste." 19326msgstr "De klasse \"%s\" is een TControl en kan niet op een niet control geplaatst worden.%sPlakken mislukt." 19327 19328#: lazarusidestrconsts.listhecodetoolsfoundanerror 19329#, object-pascal-format 19330msgid "The Codetools found an error:%s%s" 19331msgstr "" 19332 19333#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect 19334#, object-pascal-format 19335msgid "The compiler file \"%s\" does not look correct:%s%s" 19336msgstr "" 19337 19338#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby 19339#, object-pascal-format 19340msgid "The component %s can not be deleted because it is not owned by %s." 19341msgstr "" 19342 19343#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror 19344#, object-pascal-format 19345msgid "The component editor of class \"%s\" has created the error:%s\"%s\"" 19346msgstr "" 19347 19348#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated 19349#, object-pascal-format, fuzzy 19350#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" 19351msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\"" 19352msgstr "De component bewerker van klasse \"%s\"%saangeroepen met #%s \"%s\"%sveroorzaakte de fout:%s\"%s\"" 19353 19354#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp 19355#, object-pascal-format 19356msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." 19357msgstr "" 19358 19359#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp 19360#, object-pascal-format 19361msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there." 19362msgstr "" 19363 19364#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo 19365msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier." 19366msgstr "" 19367 19368#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted 19369msgid "The configuration will be downgraded/converted." 19370msgstr "" 19371 19372#: lazarusidestrconsts.listhecontainsanotexistingdirectory 19373#, object-pascal-format 19374msgid "The %s contains a nonexistent directory:%s%s" 19375msgstr "" 19376 19377#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch 19378#, object-pascal-format 19379msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask." 19380msgstr "" 19381 19382#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome 19383msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc." 19384msgstr "" 19385 19386#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro 19387#, object-pascal-format, fuzzy 19388#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options" 19389msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options" 19390msgstr "De debugger \"%s\"%sbestaat niet of is niet uitvoerbaar.%sZie Instellingen -> Debugger opties" 19391 19392#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive 19393#, object-pascal-format 19394msgid "The debugger executable typically has the name \"%s\". Please give the full file path." 19395msgstr "" 19396 19397#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject 19398msgid "The default mode must be stored in project, not in session." 19399msgstr "" 19400 19401#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist 19402#, object-pascal-format, fuzzy 19403#| msgid "The destination directory%s%s%s%s does not exist." 19404msgid "The destination directory%s\"%s\" does not exist." 19405msgstr "De doel directorie%s\"%s\" bestaat niet." 19406 19407#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep 19408#, object-pascal-format 19409msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options." 19410msgstr "" 19411 19412#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere 19413#, object-pascal-format 19414msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?" 19415msgstr "" 19416 19417#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi 19418#, object-pascal-format 19419msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?" 19420msgstr "" 19421 19422#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit 19423#, object-pascal-format, fuzzy 19424#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" 19425msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?" 19426msgstr "De directory \"%s\" is overbodig in het unit pad.%sDirectory verwijderen?" 19427 19428#: lazarusidestrconsts.listhedirectoryisnotwritable 19429#, object-pascal-format 19430msgid "The directory \"%s\" is not writable." 19431msgstr "" 19432 19433#: lazarusidestrconsts.listhedirectorywasnotfound 19434#, object-pascal-format 19435msgid "The directory %s was not found." 19436msgstr "" 19437 19438#: lazarusidestrconsts.listhefile 19439#, object-pascal-format, fuzzy 19440#| msgid "The file %s%s%s" 19441msgid "The file \"%s\"" 19442msgstr "Het bestand \"%s\"" 19443 19444#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile 19445#, object-pascal-format 19446msgid "The file %s does not look like a lpi file." 19447msgstr "" 19448 19449#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio 19450msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute." 19451msgstr "" 19452 19453#: lazarusidestrconsts.listhefileisasymlinkopeninstead 19454#, object-pascal-format 19455msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?" 19456msgstr "" 19457 19458#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi 19459#, object-pascal-format 19460msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?" 19461msgstr "" 19462 19463#: lazarusidestrconsts.listhefilemaskisinvalid 19464#, object-pascal-format 19465msgid "The file mask \"%s\" is invalid." 19466msgstr "" 19467 19468#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression 19469#, object-pascal-format 19470msgid "The file mask \"%s\" is not a valid regular expression." 19471msgstr "" 19472 19473#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject 19474#, object-pascal-format, fuzzy 19475#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." 19476msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source." 19477msgstr "het bestand \"%s\" lijkt een programma te zijn. %sHet huidige project sluiten, en een nieuw Lazarus project voor dit programma maken?%s\"Nee\" zal het bestand als een normale bron laden." 19478 19479#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp 19480#, object-pascal-format, fuzzy 19481#| msgid "The file %s seems to be the program file of an existing lazarus Project." 19482msgid "The file %s seems to be the program file of an existing Lazarus Project." 19483msgstr "Het bestand %s lijkt het programma bestand te zijn van een bestaand Lazarus project." 19484 19485#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac 19486#, object-pascal-format 19487msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?" 19488msgstr "" 19489 19490#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself 19491#, object-pascal-format, fuzzy 19492#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" 19493msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?" 19494msgstr "Het bestand \"%s\" is niet gevonden.%sWilt u het zelf zoeken?" 19495 19496#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject 19497#, object-pascal-format, fuzzy 19498#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." 19499msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading." 19500msgstr "Het bestand \"%s\" is niet gevonden.%sIgnore gaat door met het laden,%sAbort stopt het laden van het project." 19501 19502#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth 19503#, object-pascal-format, fuzzy 19504#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" 19505msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?" 19506msgstr "De volgende methoden gebruikt door %s zijn niet in de bron%s%s%s%s%sVerwijder deze referenties?" 19507 19508#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect 19509#, object-pascal-format 19510msgid "The FPC source directory \"%s\" does not look correct:%s%s" 19511msgstr "" 19512 19513#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename 19514#, object-pascal-format 19515msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path." 19516msgstr "" 19517 19518#: lazarusidestrconsts.listheideisstillbuilding 19519msgid "The IDE is still building." 19520msgstr "" 19521 19522#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction 19523msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." 19524msgstr "" 19525 19526#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand 19527#, object-pascal-format 19528msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?" 19529msgstr "" 19530 19531#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists 19532#, object-pascal-format 19533msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings." 19534msgstr "" 19535 19536#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta 19537#, object-pascal-format, fuzzy 19538#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" 19539msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local" 19540msgstr "Het startende programma \"%s\"%sbestaat niet of is niet uitvoerbaar.%sZie Starten -> Start paramaters -> Lokaal" 19541 19542#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth 19543#, object-pascal-format 19544msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too." 19545msgstr "" 19546 19547#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect 19548#, object-pascal-format 19549msgid "The Lazarus directory \"%s\" does not look correct:%s%s" 19550msgstr "" 19551 19552#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis 19553#, fuzzy 19554#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." 19555msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually." 19556msgstr "Het LFM (Lazarus form) bestand bevat ongeldige properties. Dit kan betekenen dat het properties/klassen bevat, die niet in de huidige LCL voorkomen. De manier om dit te repareren is deze properties te verwijderen uit de lfm en de pascal handmatig aan te passen." 19557 19558#: lazarusidestrconsts.listhemacrodoesnotbeginwith 19559#, object-pascal-format 19560msgid "The macro \"%s\" does not begin with \"%s\"." 19561msgstr "" 19562 19563#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename 19564#, object-pascal-format 19565msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path." 19566msgstr "" 19567 19568#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd 19569#, object-pascal-format 19570msgid "The new include file is not yet in the include search path.%sAdd directory %s?" 19571msgstr "" 19572 19573#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory 19574#, object-pascal-format 19575msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" 19576msgstr "" 19577 19578#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded 19579msgid "The old configuration will be upgraded." 19580msgstr "" 19581 19582#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint 19583#, object-pascal-format 19584msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s" 19585msgstr "" 19586 19587#: lazarusidestrconsts.listheoutputdirectoryismissing 19588#, object-pascal-format 19589msgid "The output directory \"%s\" is missing." 19590msgstr "" 19591 19592#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath 19593#, object-pascal-format 19594msgid "The output directory of %s is listed in the include search path of %s." 19595msgstr "" 19596 19597#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes 19598#, object-pascal-format 19599msgid "The output directory of %s is listed in the inherited include search path of %s." 19600msgstr "" 19601 19602#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear 19603#, object-pascal-format 19604msgid "The output directory of %s is listed in the inherited unit search path of %s." 19605msgstr "" 19606 19607#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof 19608#, object-pascal-format 19609msgid "The output directory of %s is listed in the unit search path of %s." 19610msgstr "" 19611 19612#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot 19613msgid " The output directory should be a separate directory and not contain any source files." 19614msgstr "" 19615 19616#: lazarusidestrconsts.listheownerclasshasthisname 19617msgid "The owner class has this name" 19618msgstr "" 19619 19620#: lazarusidestrconsts.listheownerhasthisname 19621msgid "The owner has this name" 19622msgstr "" 19623 19624#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi 19625#, object-pascal-format 19626msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package." 19627msgstr "" 19628 19629#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr 19630#, object-pascal-format 19631msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package." 19632msgstr "" 19633 19634#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname 19635msgid "The package already contains a unit with this name." 19636msgstr "" 19637 19638#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi 19639#, object-pascal-format 19640msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package." 19641msgstr "" 19642 19643#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth 19644#, object-pascal-format 19645msgid "The package %s can not be uninstalled because it is needed by the IDE itself." 19646msgstr "" 19647 19648#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi 19649#, object-pascal-format 19650msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item." 19651msgstr "" 19652 19653#: lazarusidestrconsts.listhepackageisalreadyinthelist 19654#, object-pascal-format 19655msgid "The package %s is already in the list" 19656msgstr "" 19657 19658#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall 19659#, object-pascal-format 19660msgid "The package %s is not a design time package. It cannot be installed in the IDE." 19661msgstr "" 19662 19663#: lazarusidestrconsts.listhepathofmakeisnotcorrect 19664#, object-pascal-format 19665msgid "The path of \"make\" is not correct: \"%s\"" 19666msgstr "" 19667 19668#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla 19669#, object-pascal-format, fuzzy 19670#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s" 19671msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus." 19672msgstr "Het programma \"make\" is niet gevonden.%sDit is nodig om lazarus te bouwen." 19673 19674#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain 19675msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:" 19676msgstr "" 19677 19678#: lazarusidestrconsts.listheprojectdoesnotusedwarf 19679#, object-pascal-format 19680msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf." 19681msgstr "" 19682 19683#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems 19684#, object-pascal-format 19685msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces." 19686msgstr "" 19687 19688#: lazarusidestrconsts.listheprojecthasnomainsourcefile 19689msgid "The project has no main source file." 19690msgstr "" 19691 19692#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource 19693#, object-pascal-format, fuzzy 19694#| msgid "The project info file %s%s%s%sis equal to the project main source file!" 19695msgid "The project info file \"%s\"%sis equal to the project main source file!" 19696msgstr "Het project info bestand \"%s\"%sis gelijk aan het hoofd bronbestand van het project!" 19697 19698#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk 19699#, object-pascal-format 19700msgid "The project information file \"%s\"%shas changed on disk." 19701msgstr "" 19702 19703#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest 19704#, object-pascal-format, fuzzy 19705#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" 19706msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?" 19707msgstr "Het project moet worden opgeslagen voor het bouwen%sAls je de Test Directory invuld bij de Omgeving Opties,%skun je nieuwe projecten maken en deze gelijk bouwen.%sPorject opslaan?" 19708 19709#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast 19710msgid "The project uses FPC resources which require at least FPC 2.4" 19711msgstr "" 19712 19713#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar 19714#, object-pascal-format 19715msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." 19716msgstr "" 19717 19718#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe 19719#, object-pascal-format 19720msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable." 19721msgstr "" 19722 19723#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable 19724#, object-pascal-format 19725msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file." 19726msgstr "" 19727 19728#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon 19729#, object-pascal-format 19730msgid "%sThere are additional notes for this message on%s" 19731msgstr "" 19732 19733#: lazarusidestrconsts.listherearenoconflictingkeys 19734msgid "There are no conflicting keys." 19735msgstr "" 19736 19737#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename 19738#, object-pascal-format 19739msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" 19740msgstr "Er zijn andere bestanden in de directory met dezelfde naam,%salleen met andere hoofdletters:%s%s%sDeze verwijderen?" 19741 19742#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension 19743#, object-pascal-format, fuzzy 19744#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" 19745msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?" 19746msgstr "Er is een bestand met dezelfde naam en een gelijke extensie op disk%sBestand%s%sDubbel bestand %s%s verwijderen?" 19747 19748#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname 19749msgid "There is already a build mode with this name." 19750msgstr "" 19751 19752#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename 19753#, object-pascal-format 19754msgid "There is already a component class with the name %s." 19755msgstr "" 19756 19757#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname 19758msgid "There is already a component with this name" 19759msgstr "" 19760 19761#: lazarusidestrconsts.listhereisalreadyafilein 19762#, object-pascal-format 19763msgid "There is already a file%s%s%sin %s" 19764msgstr "" 19765 19766#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue 19767#, object-pascal-format 19768msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?" 19769msgstr "" 19770 19771#: lazarusidestrconsts.listhereisalreadyaformwiththename 19772#, object-pascal-format, fuzzy 19773#| msgid "There is already a form with the name %s%s%s" 19774msgid "There is already a form with the name \"%s\"" 19775msgstr "Er is al een form net de naam \"%s\"" 19776 19777#: lazarusidestrconsts.listhereisalreadyamacrowiththename 19778#, object-pascal-format 19779msgid "There is already a macro with the name \"%s\"." 19780msgstr "" 19781 19782#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename 19783#, object-pascal-format 19784msgid "There is already an IDE macro with the name \"%s\"" 19785msgstr "" 19786 19787#: lazarusidestrconsts.listhereisalreadyapackageinthelist 19788#, object-pascal-format 19789msgid "There is already a package %s in the list" 19790msgstr "" 19791 19792#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur 19793#, object-pascal-format 19794msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?" 19795msgstr "" 19796 19797#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus 19798#, object-pascal-format, fuzzy 19799#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." 19800msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique." 19801msgstr "Er is al een unit met de naam \"%s\". Pascal identifiers moeten uniek zijn." 19802 19803#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose 19804#, object-pascal-format, fuzzy 19805#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" 19806msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name" 19807msgstr "Er is een unit met de naam \"%s\" in het project.%sKies een andere naam" 19808 19809#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu 19810#, object-pascal-format 19811msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler." 19812msgstr "" 19813 19814#: lazarusidestrconsts.listheremustbeatleastonebuildmode 19815msgid "There must be at least one build mode." 19816msgstr "" 19817 19818#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor 19819#, object-pascal-format 19820msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm." 19821msgstr "" 19822 19823#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent 19824#, object-pascal-format 19825msgid "There was an error during writing the selected component %s:%s:%s%s" 19826msgstr "Er is een fout opgetreden tijdens het opslaan van het geselecteerde component %s:%s:%s%s" 19827 19828#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe 19829#, object-pascal-format 19830msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" 19831msgstr "Er is een fout opgetreden tijdens het converteren van de binaire stream van het geselecteerde component %s:%s:%s%s" 19832 19833#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli 19834#, object-pascal-format 19835msgid "There was an error while copying the component stream to clipboard:%s%s" 19836msgstr "Er is een fout opgetreden tijdens het kopiëren van de component stream naar het klembord:%s%s" 19837 19838#: lazarusidestrconsts.listherootcomponentcannotbedeleted 19839#, fuzzy 19840#| msgid "The root component can not be deleted." 19841msgid "The root component cannot be deleted." 19842msgstr "Het root component kan niet verwijderd worden." 19843 19844#: lazarusidestrconsts.listhesefileswillbedeleted 19845msgid "These files will be deleted" 19846msgstr "" 19847 19848#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject 19849msgid "These settings are stored with the project." 19850msgstr "" 19851 19852#: lazarusidestrconsts.listheseunitswerenotfound 19853msgid "These units were not found:" 19854msgstr "" 19855 19856#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro 19857#, object-pascal-format 19858msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"." 19859msgstr "" 19860 19861#: lazarusidestrconsts.listhetargetdirectoryisafile 19862#, object-pascal-format 19863msgid "The target directory is a file:%s" 19864msgstr "" 19865 19866#: lazarusidestrconsts.listhetargetfilenameisadirectory 19867msgid "The target file name is a directory." 19868msgstr "" 19869 19870#: lazarusidestrconsts.listhetargetisnotwritable 19871#, object-pascal-format 19872msgid "The target %s is not writable." 19873msgstr "" 19874 19875#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt 19876#, object-pascal-format 19877msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)" 19878msgstr "" 19879 19880#: lazarusidestrconsts.listheunitalreadyexists 19881#, object-pascal-format 19882msgid "The unit \"%s\" already exists." 19883msgstr "" 19884 19885#: lazarusidestrconsts.listheunitbelongstopackage 19886#, object-pascal-format 19887msgid "The unit belongs to package %s." 19888msgstr "" 19889 19890#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe 19891#, object-pascal-format 19892msgid "The unit %s exists twice in the unit path of the %s:" 19893msgstr "" 19894 19895#: lazarusidestrconsts.listheunithasthisname 19896msgid "The unit has this name" 19897msgstr "" 19898 19899#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler 19900#, object-pascal-format 19901msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?" 19902msgstr "" 19903 19904#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd 19905#, object-pascal-format 19906msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable." 19907msgstr "" 19908 19909#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic 19910#, object-pascal-format 19911msgid "The unit %s is used by other files.%sUpdate references automatically?" 19912msgstr "" 19913 19914#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus 19915#, object-pascal-format, fuzzy 19916#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." 19917msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique." 19918msgstr "De unit heeft zelf al de naam \"%s\". Pascal identifiers moeten uniek zijn." 19919 19920#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac 19921#, object-pascal-format 19922msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s" 19923msgstr "" 19924 19925#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki 19926#, object-pascal-format 19927msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters." 19928msgstr "" 19929 19930#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename 19931#, object-pascal-format 19932msgid "This component already contains a class with the name %s." 19933msgstr "" 19934 19935#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor 19936msgid "This function needs an open .lfm file in the source editor." 19937msgstr "" 19938 19939#: lazarusidestrconsts.listhishelpmessage 19940msgid "this help message" 19941msgstr "Dit Help bericht" 19942 19943#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage 19944msgid "This is a test project for a design time package, testing it outside the IDE." 19945msgstr "" 19946 19947#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc 19948#, object-pascal-format, fuzzy 19949#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" 19950msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" 19951msgstr "Dit lijkt op een pascal bestand.%sAangeraden wordt om alleen kleine letters te gebruiken in de bestandnaam, om problemen te voorkomen.%sHernoemen naar kleine letters?" 19952 19953#: lazarusidestrconsts.listhisprojecthasnomainsourcefile 19954msgid "This project has no main source file" 19955msgstr "" 19956 19957#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode 19958msgid "This project has only the default build mode." 19959msgstr "" 19960 19961#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis 19962#, object-pascal-format 19963msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus." 19964msgstr "" 19965 19966#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode 19967#, object-pascal-format 19968msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." 19969msgstr "Dit statement kan niet worden gedistilleerd.%sSelecteer meer code om een nieuwe procedure te distilleren." 19970 19971#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme 19972msgid "This will allow changing all build modes at once. Not implemented yet." 19973msgstr "" 19974 19975#: lazarusidestrconsts.listhiswillcreateacirculardependency 19976msgid "This will create a circular dependency." 19977msgstr "" 19978 19979#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed 19980#, object-pascal-format 19981msgid "This will put a lot of text (%s) on the clipboard.%sProceed?" 19982msgstr "" 19983 19984#: lazarusidestrconsts.listhreads 19985msgctxt "lazarusidestrconsts.listhreads" 19986msgid "Threads" 19987msgstr "" 19988 19989#: lazarusidestrconsts.listhreadscurrent 19990msgctxt "lazarusidestrconsts.listhreadscurrent" 19991msgid "Current" 19992msgstr "" 19993 19994#: lazarusidestrconsts.listhreadsfunc 19995msgctxt "lazarusidestrconsts.listhreadsfunc" 19996msgid "Function" 19997msgstr "" 19998 19999#: lazarusidestrconsts.listhreadsgoto 20000msgid "Goto" 20001msgstr "" 20002 20003#: lazarusidestrconsts.listhreadsline 20004msgctxt "lazarusidestrconsts.listhreadsline" 20005msgid "Line" 20006msgstr "Regel" 20007 20008#: lazarusidestrconsts.listhreadsnotevaluated 20009msgid "Threads not evaluated" 20010msgstr "" 20011 20012#: lazarusidestrconsts.listhreadssrc 20013msgctxt "lazarusidestrconsts.listhreadssrc" 20014msgid "Source" 20015msgstr "" 20016 20017#: lazarusidestrconsts.listhreadsstate 20018msgctxt "lazarusidestrconsts.listhreadsstate" 20019msgid "State" 20020msgstr "Status" 20021 20022#: lazarusidestrconsts.listitle 20023msgid "&Title" 20024msgstr "" 20025 20026#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus 20027msgid "Title in taskbar shows for example: project1.lpi - Lazarus" 20028msgstr "" 20029 20030#: lazarusidestrconsts.listitleleaveemptyfordefault 20031msgid "Title (leave empty for default)" 20032msgstr "" 20033 20034#: lazarusidestrconsts.listmfunctionappendpathdelimiter 20035msgid "Function: append path delimiter" 20036msgstr "Functie: toevoegen pad scheidingsteken" 20037 20038#: lazarusidestrconsts.listmfunctionchomppathdelimiter 20039#, fuzzy 20040#| msgid "Function: chomp path delimiter" 20041msgid "Function: remove trailing path delimiter" 20042msgstr "Functie: afhakken pad scheidingsteken" 20043 20044#: lazarusidestrconsts.listmfunctionextractfileextension 20045msgid "Function: extract file extension" 20046msgstr "Functie: destilleer bestandsextensie" 20047 20048#: lazarusidestrconsts.listmfunctionextractfilenameextension 20049msgid "Function: extract file name+extension" 20050msgstr "Functie: destilleer bestandsnaam+extensie" 20051 20052#: lazarusidestrconsts.listmfunctionextractfilenameonly 20053msgid "Function: extract file name only" 20054msgstr "Functie: destilleer alleen bestandsnaam" 20055 20056#: lazarusidestrconsts.listmfunctionextractfilepath 20057msgid "Function: extract file path" 20058msgstr "Functie: destilleer pad naar bestand" 20059 20060#: lazarusidestrconsts.listmunknownmacro 20061#, object-pascal-format 20062msgid "(unknown macro: %s)" 20063msgstr "(onbekende macro: %s)" 20064 20065#: lazarusidestrconsts.listofpcpath 20066msgid "Path:" 20067msgstr "Pad:" 20068 20069#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa 20070msgid "Toggle showing filenames with full path or with relative path" 20071msgstr "" 20072 20073#: lazarusidestrconsts.listoolbarconfiguration 20074msgid "Toolbar Configuration" 20075msgstr "" 20076 20077#: lazarusidestrconsts.listoolbaroptions 20078msgid "Toolbar" 20079msgstr "" 20080 20081#: lazarusidestrconsts.listoolbaroptionshighlight 20082msgid "Highlight toolbars buttons" 20083msgstr "" 20084 20085#: lazarusidestrconsts.listoolbaroptionsraise 20086msgid "Raise toolbars" 20087msgstr "" 20088 20089#: lazarusidestrconsts.listoolhasnoexecutable 20090#, object-pascal-format 20091msgid "tool \"%s\" has no executable" 20092msgstr "" 20093 20094#: lazarusidestrconsts.listoolheaderfailed 20095msgid "Tool Header: Failed" 20096msgstr "" 20097 20098#: lazarusidestrconsts.listoolheaderrunning 20099msgid "Tool Header: Running" 20100msgstr "" 20101 20102#: lazarusidestrconsts.listoolheaderscrolledup 20103msgid "Tool Header: Scrolled up" 20104msgstr "" 20105 20106#: lazarusidestrconsts.listoolheadersuccess 20107msgid "Tool Header: Success" 20108msgstr "" 20109 20110#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo 20111#, object-pascal-format 20112msgid "tool stopped with exit code %s. Use context menu to get more information." 20113msgstr "" 20114 20115#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo 20116#, object-pascal-format 20117msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information." 20118msgstr "" 20119 20120#: lazarusidestrconsts.listop 20121msgctxt "lazarusidestrconsts.listop" 20122msgid "Top" 20123msgstr "" 20124 20125#: lazarusidestrconsts.listopanchoring 20126msgid "Top anchoring" 20127msgstr "Top verankering" 20128 20129#: lazarusidestrconsts.listopborderspacespinedithint 20130msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." 20131msgstr "Top randruimte." 20132 20133#: lazarusidestrconsts.listopinfoview 20134msgid "Show Class/Procedure hint" 20135msgstr "" 20136 20137#: lazarusidestrconsts.listops 20138msgid "Tops" 20139msgstr "Tops" 20140 20141#: lazarusidestrconsts.listopsiblingcomboboxhint 20142#, fuzzy 20143#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)." 20144msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)." 20145msgstr "Dit is het verwante control waaraan de bovenzijde is verankerd. Laat het leeg voor ouders" 20146 20147#: lazarusidestrconsts.listopspaceequally 20148msgid "Top space equally" 20149msgstr "Top evenredig verdelen" 20150 20151#: lazarusidestrconsts.listotalpages 20152#, object-pascal-format 20153msgid "Total Pages: %s" 20154msgstr "" 20155 20156#: lazarusidestrconsts.listranslatetheenglishmessages 20157msgid "Translate the English Messages" 20158msgstr "" 20159 20160#: lazarusidestrconsts.listreeneedsrefresh 20161msgid "Tree needs refresh" 20162msgstr "" 20163 20164#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein 20165#, object-pascal-format 20166msgid "Two moved files will have the same file name:%s%s%s%s%sin %s" 20167msgstr "" 20168 20169#: lazarusidestrconsts.listypes 20170msgid "Types (not removed if no replacement)" 20171msgstr "" 20172 20173#: lazarusidestrconsts.lisudadditionaldirectories 20174msgid "Additional directories:" 20175msgstr "" 20176 20177#: lazarusidestrconsts.lisudallpackageunits 20178msgid "All package units" 20179msgstr "" 20180 20181#: lazarusidestrconsts.lisudallsourceeditorunits 20182msgid "All source editor units" 20183msgstr "" 20184 20185#: lazarusidestrconsts.lisudallunits 20186msgid "All units" 20187msgstr "" 20188 20189#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit 20190msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well." 20191msgstr "" 20192 20193#: lazarusidestrconsts.lisudcollapseallnodes 20194msgid "Collapse all nodes" 20195msgstr "" 20196 20197#: lazarusidestrconsts.lisudexpandallnodes 20198msgid "Expand all nodes" 20199msgstr "" 20200 20201#: lazarusidestrconsts.lisudfile 20202#, object-pascal-format 20203msgid "File: %s" 20204msgstr "" 20205 20206#: lazarusidestrconsts.lisudfilter 20207msgid "(Filter)" 20208msgstr "" 20209 20210#: lazarusidestrconsts.lisudimplementationuses 20211#, object-pascal-format 20212msgid "Implementation Uses: %s" 20213msgstr "" 20214 20215#: lazarusidestrconsts.lisudimplementationuses2 20216#, object-pascal-format 20217msgid "implementation uses: %s" 20218msgstr "" 20219 20220#: lazarusidestrconsts.lisudinterfaceuses 20221#, object-pascal-format 20222msgid "Interface Uses: %s" 20223msgstr "" 20224 20225#: lazarusidestrconsts.lisudinterfaceuses2 20226#, object-pascal-format 20227msgid "interface uses: %s" 20228msgstr "" 20229 20230#: lazarusidestrconsts.lisudprojectsandpackages 20231msgid "Projects and packages" 20232msgstr "" 20233 20234#: lazarusidestrconsts.lisudscanning 20235msgid "Scanning ..." 20236msgstr "" 20237 20238#: lazarusidestrconsts.lisudscanningunits 20239#, object-pascal-format 20240msgid "Scanning: %s units ..." 20241msgstr "" 20242 20243#: lazarusidestrconsts.lisudsearch 20244msgid "(Search)" 20245msgstr "" 20246 20247#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase 20248msgid "Find next occurrence of this phrase" 20249msgstr "" 20250 20251#: lazarusidestrconsts.lisudsearchnextunitofthisphrase 20252msgid "Find next unit with this phrase" 20253msgstr "" 20254 20255#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase 20256msgid "Find previous occurrence of this phrase" 20257msgstr "" 20258 20259#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase 20260msgid "Find previous unit with this phrase" 20261msgstr "" 20262 20263#: lazarusidestrconsts.lisudselectedunits 20264msgid "Selected units" 20265msgstr "" 20266 20267#: lazarusidestrconsts.lisudshownodesfordirectories 20268msgid "Show nodes for directories" 20269msgstr "" 20270 20271#: lazarusidestrconsts.lisudshownodesforprojectandpackages 20272msgid "Show nodes for project and packages" 20273msgstr "" 20274 20275#: lazarusidestrconsts.lisudunits 20276msgid "Units" 20277msgstr "" 20278 20279#: lazarusidestrconsts.lisudunits2 20280#, object-pascal-format 20281msgid "Units: %s" 20282msgstr "" 20283 20284#: lazarusidestrconsts.lisudusedbyimplementations 20285#, object-pascal-format 20286msgid "Used by Implementations: %s" 20287msgstr "" 20288 20289#: lazarusidestrconsts.lisudusedbyimplementations2 20290#, object-pascal-format 20291msgid "used by implementations: %s" 20292msgstr "" 20293 20294#: lazarusidestrconsts.lisudusedbyinterfaces 20295#, object-pascal-format 20296msgid "Used by Interfaces: %s" 20297msgstr "" 20298 20299#: lazarusidestrconsts.lisudusedbyinterfaces2 20300#, object-pascal-format 20301msgid "used by interfaces: %s" 20302msgstr "" 20303 20304#: lazarusidestrconsts.lisuedonotsho 20305msgid "Do not show this message again." 20306msgstr "Toon dit bericht niet meer." 20307 20308#: lazarusidestrconsts.lisueerrorinregularexpression 20309msgid "Error in regular expression" 20310msgstr "Fout in reguliere expressie" 20311 20312#: lazarusidestrconsts.lisuefontwith 20313msgid "Font without UTF-8" 20314msgstr "Lettertype zonder UTF-8" 20315 20316#: lazarusidestrconsts.lisuegotoline 20317#, fuzzy 20318#| msgid "Goto line :" 20319msgid "Goto line:" 20320msgstr "Ga naar regel :" 20321 20322#: lazarusidestrconsts.lisuemodeseparator 20323msgid "/" 20324msgstr "" 20325 20326#: lazarusidestrconsts.lisuenotfound 20327msgid "Not found" 20328msgstr "Niet gevonden." 20329 20330#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith 20331#, object-pascal-format, fuzzy 20332#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" 20333msgid "Replace this occurrence of \"%s\"%s with \"%s\"?" 20334msgstr "Vervang dit exemplaar van \"%s\"%s met \"%s\"?" 20335 20336#: lazarusidestrconsts.lisuesearching 20337#, object-pascal-format 20338msgid "Searching: %s" 20339msgstr "Zoek naar: %s" 20340 20341#: lazarusidestrconsts.lisuesearchstringcontinuebeg 20342msgid "Continue search from the beginning?" 20343msgstr "" 20344 20345#: lazarusidestrconsts.lisuesearchstringcontinueend 20346msgid "Continue search from the end?" 20347msgstr "" 20348 20349#: lazarusidestrconsts.lisuesearchstringnotfound 20350#, object-pascal-format 20351msgid "Search string '%s' not found!" 20352msgstr "Zoekstring '%s' niet gevonden" 20353 20354#: lazarusidestrconsts.lisuethecurre 20355#, object-pascal-format, fuzzy 20356#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." 20357msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options." 20358msgstr "Het huidige lettertype van de editor ondersteunt geen UTF-8, maar uw systeem schijnt het te gebruiken.%sNiet-ASCII karakters zullen waarschijnlijk incorrect afgebeeld worden.%sU kunt een ander lettertype in de editor-opties selecteren." 20359 20360#: lazarusidestrconsts.lisuiclearincludedbyreference 20361msgid "Clear include cache" 20362msgstr "" 20363 20364#: lazarusidestrconsts.lisuidbytes 20365#, object-pascal-format 20366msgid "%s bytes" 20367msgstr "%s bytes" 20368 20369#: lazarusidestrconsts.lisuidincludedby 20370msgid "Included by:" 20371msgstr "Opgenomen door" 20372 20373#: lazarusidestrconsts.lisuidinproject 20374#, fuzzy 20375#| msgid "in Project:" 20376msgid "In project:" 20377msgstr "in Project:" 20378 20379#: lazarusidestrconsts.lisuidlines 20380msgctxt "lazarusidestrconsts.lisuidlines" 20381msgid "Lines:" 20382msgstr "Regels:" 20383 20384#: lazarusidestrconsts.lisuidname 20385msgctxt "lazarusidestrconsts.lisuidname" 20386msgid "Name:" 20387msgstr "Naam:" 20388 20389#: lazarusidestrconsts.lisuidno 20390msgid "no" 20391msgstr "nee" 20392 20393#: lazarusidestrconsts.lisuidsize 20394msgid "Size:" 20395msgstr "Grootte" 20396 20397#: lazarusidestrconsts.lisuidtype 20398msgid "Type:" 20399msgstr "Type:" 20400 20401#: lazarusidestrconsts.lisuidyes 20402msgid "yes" 20403msgstr "Ja" 20404 20405#: lazarusidestrconsts.lisuishowcodetoolsvalues 20406msgid "Show CodeTools Values" 20407msgstr "Toon waarde van CodeTools" 20408 20409#: lazarusidestrconsts.lisunableconvertbinarystreamtotext 20410msgid "Unable convert binary stream to text" 20411msgstr "Kan binaire stream niet omzetten naar tekst" 20412 20413#: lazarusidestrconsts.lisunablecopycomponentstoclipboard 20414msgid "Unable copy components to clipboard" 20415msgstr "Kan component niet naar het klembord kopiëren" 20416 20417#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile 20418#, object-pascal-format, fuzzy 20419#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." 20420msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error." 20421msgstr "Kan het resourceheader commentaar niet toeogen aan resource bestand %s\"%s\".%sWaarschijnlijk een syntax fout." 20422 20423#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably 20424#, object-pascal-format, fuzzy 20425#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." 20426msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error." 20427msgstr "Kan resource T%s:FORMDATA niet toevoegen aan resource bestand %s\"%s\".%sWaarschijnlijk een syntax fout." 20428 20429#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread 20430#, object-pascal-format 20431msgid "Unable to add the dependency %s because the package %s has already a dependency %s" 20432msgstr "" 20433 20434#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea 20435#, object-pascal-format 20436msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s" 20437msgstr "" 20438 20439#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith 20440#, object-pascal-format, fuzzy 20441#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." 20442msgid "Unable to add %s to project because there is already a unit with the same name in the Project." 20443msgstr "Kan %s niet toevoegen aan het project omdat er al een unit met dezelfde naam in het project is." 20444 20445#: lazarusidestrconsts.lisunabletobackupfileto 20446#, object-pascal-format, fuzzy 20447#| msgid "Unable to backup file %s%s%s to %s%s%s!" 20448msgid "Unable to backup file \"%s\" to \"%s\"!" 20449msgstr "Kan het bestand \"%s\" niet backup-en naar \"%s\"!" 20450 20451#: lazarusidestrconsts.lisunabletochangeclassofto 20452#, object-pascal-format 20453msgid "%s%sUnable to change class of %s to %s" 20454msgstr "%s%sKan de klasse van %s niet wijzigen in %s" 20455 20456#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource 20457#, object-pascal-format 20458msgid "Unable to change project scaled in source.%s%s" 20459msgstr "" 20460 20461#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource 20462#, object-pascal-format 20463msgid "Unable to change project title in source.%s%s" 20464msgstr "" 20465 20466#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory 20467msgid "Unable to clean up destination directory" 20468msgstr "Kan doel directory niet opschonen" 20469 20470#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions 20471#, object-pascal-format, fuzzy 20472#| msgid "Unable to clean up %s%s%s.%sPlease check permissions." 20473msgid "Unable to clean up \"%s\".%sPlease check permissions." 20474msgstr "Kan \"%s\" niet opschonen.%sControleer de rechten." 20475 20476#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat 20477#, object-pascal-format 20478msgid "Unable to convert component text into binary format:%s%s" 20479msgstr "Kan de component tekst niet omzetten in binair formaat:%s%s" 20480 20481#: lazarusidestrconsts.lisunabletoconvertfileerror 20482#, object-pascal-format, fuzzy 20483#| msgid "Unable to convert file %s%s%s%sError: %s" 20484msgid "Unable to convert file \"%s\"%sError: %s" 20485msgstr "Kan het bestand \"%s\" niet convertere%sFout: %s" 20486 20487#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream 20488#, object-pascal-format, fuzzy 20489#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" 20490msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)" 20491msgstr "Kan de tekst form data van bestand %s\"%s\"%sniet wijzigen in een binaire stream. (%s)." 20492 20493#: lazarusidestrconsts.lisunabletoconverttoencoding 20494#, object-pascal-format 20495msgid "Unable to convert to encoding \"%s\"" 20496msgstr "" 20497 20498#: lazarusidestrconsts.lisunabletocopyfile 20499msgid "Unable to copy file" 20500msgstr "Kan het bestand niet kopiëren" 20501 20502#: lazarusidestrconsts.lisunabletocopyfileto 20503#, object-pascal-format, fuzzy 20504#| msgid "Unable to copy file %s%s%s%sto %s%s%s" 20505msgid "Unable to copy file \"%s\"%sto \"%s\"" 20506msgstr "Kan het bestand \"%s\"%s niet kopiëren naar \"%s\"" 20507 20508#: lazarusidestrconsts.lisunabletocreatedirectory 20509#, object-pascal-format, fuzzy 20510#| msgid "Unable to create directory %s%s%s." 20511msgid "Unable to create directory \"%s\"." 20512msgstr "Kan de directory \"%s\" niet maken." 20513 20514#: lazarusidestrconsts.lisunabletocreatefile 20515msgid "Unable to create file" 20516msgstr "Kan het bestand niet maken" 20517 20518#: lazarusidestrconsts.lisunabletocreatefile2 20519#, object-pascal-format, fuzzy 20520#| msgid "Unable to create file %s%s%s" 20521msgid "Unable to create file \"%s\"" 20522msgstr "Kan het bestand \"%s\" niet maken" 20523 20524#: lazarusidestrconsts.lisunabletocreatefile3 20525#, object-pascal-format 20526msgid "Unable to create file%s\"%s\"" 20527msgstr "" 20528 20529#: lazarusidestrconsts.lisunabletocreatelinkwithtarget 20530#, object-pascal-format 20531msgid "Unable to create link \"%s\" with target \"%s\"" 20532msgstr "" 20533 20534#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto 20535msgid "Unable to create new file because there is already a directory with this name." 20536msgstr "" 20537 20538#: lazarusidestrconsts.lisunabletocreatenewmethod 20539msgid "Unable to create new method." 20540msgstr "" 20541 20542#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer 20543msgid "Unable to create temporary lfm buffer." 20544msgstr "Lan geen tijdelijk lfm buffer maken." 20545 20546#: lazarusidestrconsts.lisunabletodelete 20547msgid "Unable to delete" 20548msgstr "" 20549 20550#: lazarusidestrconsts.lisunabletodeleteambiguousfile 20551#, object-pascal-format, fuzzy 20552#| msgid "Unable to delete ambiguous file %s%s%s" 20553msgid "Unable to delete ambiguous file \"%s\"" 20554msgstr "Kan het dubbele bestand \"%s\" niet verwijderen" 20555 20556#: lazarusidestrconsts.lisunabletoexecute 20557#, object-pascal-format 20558msgid "unable to execute: %s" 20559msgstr "" 20560 20561#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe 20562msgid "Unable to find a ResourceString section in this or any of the used units." 20563msgstr "" 20564 20565#: lazarusidestrconsts.lisunabletofindavalidclassnamein 20566#, object-pascal-format, fuzzy 20567#| msgid "Unable to find a valid classname in %s%s%s" 20568msgid "Unable to find a valid classname in \"%s\"" 20569msgstr "Kan geen geldige klassenaam vinden in \"%s\"" 20570 20571#: lazarusidestrconsts.lisunabletofindfile 20572#, object-pascal-format, fuzzy 20573#| msgid "Unable to find file %s%s%s." 20574msgid "Unable to find file \"%s\"." 20575msgstr "Kan het bestand \"%s\" niet vinden." 20576 20577#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption 20578#, object-pascal-format 20579msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test" 20580msgstr "" 20581 20582#: lazarusidestrconsts.lisunabletofindinlfmstream 20583#, object-pascal-format 20584msgid "Unable to find %s in LFM Stream." 20585msgstr "Kan %s niet vinden in LFM stream." 20586 20587#: lazarusidestrconsts.lisunabletofindmethod 20588msgid "Unable to find method." 20589msgstr "" 20590 20591#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile 20592#, object-pascal-format 20593msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\"" 20594msgstr "" 20595 20596#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar 20597#, object-pascal-format 20598msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s" 20599msgstr "" 20600 20601#: lazarusidestrconsts.lisunabletogathereditorchanges 20602msgid "Unable to gather editor changes." 20603msgstr "Kan de bewerker-wijzigingen niet verzamelen." 20604 20605#: lazarusidestrconsts.lisunabletogetsourcefordesigner 20606msgid "Unable to get source for designer." 20607msgstr "Kan de broncode niet vinden voor de \"designer\"." 20608 20609#: lazarusidestrconsts.lisunabletoloadfile2 20610#, object-pascal-format 20611msgid "unable to load file %s: %s" 20612msgstr "" 20613 20614#: lazarusidestrconsts.lisunabletoloadpackage 20615#, object-pascal-format 20616msgid "Unable to load package \"%s\"" 20617msgstr "" 20618 20619#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits 20620#, object-pascal-format 20621msgid "Unable to load the component class \"%s\" because it depends on itself." 20622msgstr "" 20623 20624#: lazarusidestrconsts.lisunabletoopen 20625#, object-pascal-format 20626msgid "Unable to open \"%s\"" 20627msgstr "" 20628 20629#: lazarusidestrconsts.lisunabletoopenancestorcomponent 20630msgid "Unable to open ancestor component" 20631msgstr "" 20632 20633#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades 20634#, object-pascal-format 20635msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." 20636msgstr "" 20637 20638#: lazarusidestrconsts.lisunabletoread 20639#, object-pascal-format 20640msgid "Unable to read %s" 20641msgstr "" 20642 20643#: lazarusidestrconsts.lisunabletoreadfile 20644msgid "Unable to read file" 20645msgstr "Kan het bestand niet lezen" 20646 20647#: lazarusidestrconsts.lisunabletoreadfile2 20648#, object-pascal-format, fuzzy 20649#| msgid "Unable to read file %s%s%s!" 20650msgid "Unable to read file \"%s\"." 20651msgstr "Kan het bestand \"%s\" niet lezen" 20652 20653#: lazarusidestrconsts.lisunabletoreadfileerror 20654#, object-pascal-format, fuzzy 20655#| msgid "Unable to read file %s%s%s%sError: %s" 20656msgid "Unable to read file \"%s\"%sError: %s" 20657msgstr "Kan het bestand \"%s\" niet lezen%sFout: %s" 20658 20659#: lazarusidestrconsts.lisunabletoreadlpi 20660msgid "Unable to read lpi" 20661msgstr "" 20662 20663#: lazarusidestrconsts.lisunabletoreadprocessexitstatus 20664msgid "unable to read process ExitStatus" 20665msgstr "" 20666 20667#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile 20668#, object-pascal-format 20669msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile" 20670msgid "Unable to read the project info file%s\"%s\"." 20671msgstr "" 20672 20673#: lazarusidestrconsts.lisunabletoremoveoldbackupfile 20674#, object-pascal-format, fuzzy 20675#| msgid "Unable to remove old backup file %s%s%s!" 20676msgid "Unable to remove old backup file \"%s\"!" 20677msgstr "Kan het oude backup bestand \"%s\" niet verwijderen!" 20678 20679#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource 20680#, object-pascal-format 20681msgid "Unable to remove project scaled from source.%s%s" 20682msgstr "" 20683 20684#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource 20685#, object-pascal-format 20686msgid "Unable to remove project title from source.%s%s" 20687msgstr "" 20688 20689#: lazarusidestrconsts.lisunabletorenameambiguousfileto 20690#, object-pascal-format, fuzzy 20691#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" 20692msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\"" 20693msgstr "Kan het dubbele bestand \"%s\"%sniet hernoemen in \"%s\"" 20694 20695#: lazarusidestrconsts.lisunabletorenamefile 20696msgid "Unable to rename file" 20697msgstr "Kan het bestand niet hernoemen" 20698 20699#: lazarusidestrconsts.lisunabletorenamefileto 20700#, object-pascal-format, fuzzy 20701#| msgid "Unable to rename file %s%s%s to %s%s%s!" 20702msgid "Unable to rename file \"%s\" to \"%s\"!" 20703msgstr "Kan het bestand \"%s\" niet hernoemen naar \"%s\"!" 20704 20705#: lazarusidestrconsts.lisunabletorenamefileto2 20706#, object-pascal-format, fuzzy 20707#| msgid "Unable to rename file %s%s%s%sto %s%s%s." 20708msgid "Unable to rename file \"%s\"%sto \"%s\"." 20709msgstr "Kan het bestand \"%s\"%sniet hernoemen in \"%s\"." 20710 20711#: lazarusidestrconsts.lisunabletorenameforminsource 20712msgid "Unable to rename form in source." 20713msgstr "Kan het form niet in de broncode hernoemen." 20714 20715#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag 20716msgid "Unable to rename method. Please fix the error shown in the message window." 20717msgstr "Kan de methode niet hernoemen. Herstel de fout in het mededelingen scherm." 20718 20719#: lazarusidestrconsts.lisunabletorenamevariableinsource 20720msgid "Unable to rename variable in source." 20721msgstr "Kan de variabele niet hernoemen in de broncode." 20722 20723#: lazarusidestrconsts.lisunabletorun 20724msgid "Unable to run" 20725msgstr "" 20726 20727#: lazarusidestrconsts.lisunabletorun2 20728#, object-pascal-format 20729msgid "Unable to run \"%s\"" 20730msgstr "" 20731 20732#: lazarusidestrconsts.lisunabletosetanchorsidecontrol 20733msgid "Unable to set AnchorSide Control" 20734msgstr "" 20735 20736#: lazarusidestrconsts.lisunabletoshowmethod 20737msgid "Unable to show method." 20738msgstr "" 20739 20740#: lazarusidestrconsts.lisunabletostreamselectedcomponents 20741msgid "Unable to stream selected components" 20742msgstr "Kan geselecteerde componenten niet in stream opslaan" 20743 20744#: lazarusidestrconsts.lisunabletostreamselectedcomponents2 20745msgid "Unable to stream selected components." 20746msgstr "Kan geselecteerde componenten niet in stream opslaan." 20747 20748#: lazarusidestrconsts.lisunabletostreamt 20749#, object-pascal-format 20750msgid "Unable to stream %s:T%s." 20751msgstr "Kan %s:T%s niet in stream opslaan." 20752 20753#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext 20754#, object-pascal-format 20755msgid "Unable to transform binary component stream of %s:T%s into text." 20756msgstr "Kan de binaire stream met componenten van %s:T%s niet omzetten in tekst." 20757 20758#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource 20759msgid "Unable to update CreateForm statement in project source" 20760msgstr "Kan het CreateForm statement niet wijzigen in de project broncode" 20761 20762#: lazarusidestrconsts.lisunabletowrite2 20763#, object-pascal-format 20764msgid "Unable to write \"%s\"" 20765msgstr "" 20766 20767#: lazarusidestrconsts.lisunabletowritefile 20768msgid "Unable to write file" 20769msgstr "Kan het bestand niet schrijven" 20770 20771#: lazarusidestrconsts.lisunabletowritefile2 20772#, object-pascal-format 20773msgid "Unable to write file \"%s\"." 20774msgstr "" 20775 20776#: lazarusidestrconsts.lisunabletowritefileerror 20777#, object-pascal-format, fuzzy 20778#| msgid "Unable to write file %s%s%s%sError: %s" 20779msgid "Unable to write file \"%s\"%sError: %s" 20780msgstr "Kan het bestand \"%s\" niet schrijven%sFout: %s" 20781 20782#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror 20783#, object-pascal-format 20784msgid "Unable to write the project info file%s\"%s\".%sError: %s" 20785msgstr "" 20786 20787#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror 20788#, object-pascal-format 20789msgid "Unable to write the project session file%s\"%s\".%sError: %s" 20790msgstr "" 20791 20792#: lazarusidestrconsts.lisunabletowritetofile2 20793#, object-pascal-format 20794msgid "Unable to write to file \"%s\"." 20795msgstr "" 20796 20797#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror 20798#, object-pascal-format 20799msgid "Unable to write xml stream to %s%sError: %s" 20800msgstr "" 20801 20802#: lazarusidestrconsts.lisuncheckall 20803msgid "Uncheck All" 20804msgstr "" 20805 20806#: lazarusidestrconsts.lisundo 20807msgctxt "lazarusidestrconsts.lisundo" 20808msgid "Undo" 20809msgstr "" 20810 20811#: lazarusidestrconsts.lisuninstall 20812#, object-pascal-format 20813msgid "Uninstall %s" 20814msgstr "" 20815 20816#: lazarusidestrconsts.lisuninstallimpossible 20817msgid "Uninstall impossible" 20818msgstr "" 20819 20820#: lazarusidestrconsts.lisuninstallselection 20821msgid "Uninstall selection" 20822msgstr "De-installeer Selectie" 20823 20824#: lazarusidestrconsts.lisunit 20825#, fuzzy 20826msgctxt "lazarusidestrconsts.lisunit" 20827msgid "Unit" 20828msgstr "Unit" 20829 20830#: lazarusidestrconsts.lisunithaschangedsave 20831#, object-pascal-format 20832msgid "Unit \"%s\" has changed. Save?" 20833msgstr "" 20834 20835#: lazarusidestrconsts.lisunitidentifierexists 20836msgid "Unit identifier exists" 20837msgstr "Unit identifier bestaat al" 20838 20839#: lazarusidestrconsts.lisunitinpackage 20840#, object-pascal-format 20841msgid "%s unit %s in package %s" 20842msgstr "" 20843 20844#: lazarusidestrconsts.lisunitmustsavebeforeinherit 20845#, object-pascal-format 20846msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?" 20847msgstr "" 20848 20849#: lazarusidestrconsts.lisunitnamealreadyexistscap 20850msgid "Unitname already in project" 20851msgstr "Unitname existiert bereits im Projekt" 20852 20853#: lazarusidestrconsts.lisunitnamebeginswith 20854msgid "Unit name begins with ..." 20855msgstr "Unit naam begint met ..." 20856 20857#: lazarusidestrconsts.lisunitnamecontains 20858msgid "Unit name contains ..." 20859msgstr "Unit naam bevat ..." 20860 20861#: lazarusidestrconsts.lisunitnotfound 20862#, object-pascal-format 20863msgid "unit %s not found" 20864msgstr "" 20865 20866#: lazarusidestrconsts.lisunitnotfoundatnewposition 20867#, object-pascal-format 20868msgid "unit %s not found at new position \"%s\"" 20869msgstr "" 20870 20871#: lazarusidestrconsts.lisunitnotfoundinproject 20872#, object-pascal-format 20873msgid "A unit not found in project %s" 20874msgstr "" 20875 20876#: lazarusidestrconsts.lisunitoutputdirectory 20877msgid "Unit Output directory" 20878msgstr "Unit uitvoer directorie" 20879 20880#: lazarusidestrconsts.lisunitpath 20881msgid "unit path" 20882msgstr "Unitpad" 20883 20884#: lazarusidestrconsts.lisunitpaths 20885msgid "Unit paths" 20886msgstr "Unit paden" 20887 20888#: lazarusidestrconsts.lisunitrequirespackage 20889#, object-pascal-format 20890msgid "unit %s requires package %s" 20891msgstr "" 20892 20893#: lazarusidestrconsts.lisunitsnotfoundinproject 20894#, object-pascal-format 20895msgid "Units not found in project %s" 20896msgstr "" 20897 20898#: lazarusidestrconsts.lisunsigned 20899msgid "Unsigned" 20900msgstr "" 20901 20902#: lazarusidestrconsts.lisunusedunitsof 20903#, object-pascal-format 20904msgid "Unused units of %s" 20905msgstr "" 20906 20907#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor 20908msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross." 20909msgstr "" 20910 20911#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa 20912msgid "Unusual pas2js compiler file name. Usually it starts with pas2js." 20913msgstr "" 20914 20915#: lazarusidestrconsts.lisup 20916msgctxt "lazarusidestrconsts.lisup" 20917msgid "Up" 20918msgstr "Naar boven" 20919 20920#: lazarusidestrconsts.lisupdateapplicationcreateform 20921msgid "Update Application.CreateForm statements in main unit" 20922msgstr "" 20923 20924#: lazarusidestrconsts.lisupdateapplicationscaledstatement 20925msgid "Update Application.Scaled statement in main unit" 20926msgstr "" 20927 20928#: lazarusidestrconsts.lisupdateapplicationtitlestatement 20929msgid "Update Application.Title statement in main unit" 20930msgstr "" 20931 20932#: lazarusidestrconsts.lisupdateinfo 20933msgid "Update info" 20934msgstr "" 20935 20936#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha 20937msgid "Update other procedure signatures when only letter case has changed" 20938msgstr "" 20939 20940#: lazarusidestrconsts.lisupdatereferences 20941msgid "Update references?" 20942msgstr "" 20943 20944#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage 20945#, object-pascal-format 20946msgid "Updating PO files failed for package %s" 20947msgstr "" 20948 20949#: lazarusidestrconsts.lisupgrade 20950msgid "Upgrade" 20951msgstr "" 20952 20953#: lazarusidestrconsts.lisupgradeconfiguration 20954msgid "Upgrade configuration" 20955msgstr "" 20956 20957#: lazarusidestrconsts.lisuppercasestring 20958msgid "uppercase string" 20959msgstr "" 20960 20961#: lazarusidestrconsts.lisuppercasestringgivenasparameter 20962msgid "Uppercase string given as parameter." 20963msgstr "" 20964 20965#: lazarusidestrconsts.lisurlonwikithebaseurlis 20966#, object-pascal-format 20967msgid "URL on wiki (the base url is %s)" 20968msgstr "" 20969 20970#: lazarusidestrconsts.lisusagemessagehoption 20971msgid "Usage message (-h option)" 20972msgstr "" 20973 20974#: lazarusidestrconsts.lisuse 20975msgid "Use" 20976msgstr "" 20977 20978#: lazarusidestrconsts.lisuseansistrings 20979#, fuzzy 20980msgctxt "lazarusidestrconsts.lisuseansistrings" 20981msgid "Use Ansistrings" 20982msgstr "Gebruik ANSI strings" 20983 20984#: lazarusidestrconsts.lisusecheckboxforbooleanvalues 20985msgid "Use CheckBox for Boolean values" 20986msgstr "" 20987 20988#: lazarusidestrconsts.lisusecommentsincustomoptions 20989msgid "Use comments in custom options" 20990msgstr "" 20991 20992#: lazarusidestrconsts.lisusedby 20993#, object-pascal-format 20994msgid " used by %s" 20995msgstr "" 20996 20997#: lazarusidestrconsts.lisusedesigntimepackages 20998msgid "Use design time packages" 20999msgstr "" 21000 21001#: lazarusidestrconsts.lisusedforautocreatedforms 21002msgid "Used for auto-created forms." 21003msgstr "" 21004 21005#: lazarusidestrconsts.lisusefilterforextrafiles 21006msgid "Use filter to include extra files" 21007msgstr "" 21008 21009#: lazarusidestrconsts.lisuseidentifier 21010msgid "Use identifier" 21011msgstr "" 21012 21013#: lazarusidestrconsts.lisuseidentifierinat 21014#, object-pascal-format 21015msgid "Use identifier %s in %s at %s" 21016msgstr "" 21017 21018#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox 21019msgid "Launching application" 21020msgstr "Applicatie wordt gestart" 21021 21022#: lazarusidestrconsts.lisusepackageinpackage 21023#, object-pascal-format 21024msgid "Use package %s in package %s" 21025msgstr "" 21026 21027#: lazarusidestrconsts.lisusepackageinpackage2 21028msgid "Use package in package" 21029msgstr "" 21030 21031#: lazarusidestrconsts.lisusepackageinproject 21032#, object-pascal-format 21033msgid "Use package %s in project" 21034msgstr "" 21035 21036#: lazarusidestrconsts.lisusepackageinproject2 21037msgid "Use package in project" 21038msgstr "" 21039 21040#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd 21041#, object-pascal-format 21042msgid "Add to list \"%s\"" 21043msgstr "" 21044 21045#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup 21046msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup" 21047msgid "User defined text markup" 21048msgstr "" 21049 21050#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove 21051#, object-pascal-format 21052msgid "Remove from list \"%s\"" 21053msgstr "" 21054 21055#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle 21056#, object-pascal-format 21057msgid "Toggle on list \"%s\"" 21058msgstr "" 21059 21060#: lazarusidestrconsts.lisusershomedirectory 21061msgid "User's home directory" 21062msgstr "" 21063 21064#: lazarusidestrconsts.lisuseunit 21065msgctxt "lazarusidestrconsts.lisuseunit" 21066msgid "Add Unit to Uses Section" 21067msgstr "" 21068 21069#: lazarusidestrconsts.lisuseunitinunit 21070#, object-pascal-format 21071msgid "Use unit %s in unit %s" 21072msgstr "" 21073 21074#: lazarusidestrconsts.lisutf8withbom 21075msgid "UTF-8 with BOM" 21076msgstr "" 21077 21078#: lazarusidestrconsts.lisvalue 21079msgctxt "lazarusidestrconsts.lisvalue" 21080msgid "Value" 21081msgstr "Waarde" 21082 21083#: lazarusidestrconsts.lisvalue2 21084#, object-pascal-format 21085msgid "Value%s" 21086msgstr "" 21087 21088#: lazarusidestrconsts.lisvalue3 21089msgid "Value: " 21090msgstr "" 21091 21092#: lazarusidestrconsts.lisvalues 21093msgid "Values" 21094msgstr "" 21095 21096#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault 21097msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector." 21098msgstr "" 21099 21100#: lazarusidestrconsts.lisvariable 21101msgctxt "lazarusidestrconsts.lisvariable" 21102msgid "Variable" 21103msgstr "Variabele" 21104 21105#: lazarusidestrconsts.lisverbose 21106msgctxt "lazarusidestrconsts.lisverbose" 21107msgid "Verbose" 21108msgstr "" 21109 21110#: lazarusidestrconsts.lisverifymethodcalls 21111msgid "Verify method calls" 21112msgstr "" 21113 21114#: lazarusidestrconsts.lisversion 21115msgid "Version" 21116msgstr "Versie" 21117 21118#: lazarusidestrconsts.lisversionmismatch 21119msgid "Version mismatch" 21120msgstr "" 21121 21122#: lazarusidestrconsts.lisvertical 21123msgid "Vertical" 21124msgstr "Verticaal" 21125 21126#: lazarusidestrconsts.lisvertoclipboard 21127msgid "Copy version information to clipboard" 21128msgstr "" 21129 21130#: lazarusidestrconsts.lisveryverbose 21131msgid "Very Verbose" 21132msgstr "" 21133 21134#: lazarusidestrconsts.lisviewbreakpointproperties 21135msgctxt "lazarusidestrconsts.lisviewbreakpointproperties" 21136msgid "Breakpoint Properties ..." 21137msgstr "" 21138 21139#: lazarusidestrconsts.lisviewsource 21140msgid "View Source" 21141msgstr "" 21142 21143#: lazarusidestrconsts.lisviewsourcedisass 21144msgctxt "lazarusidestrconsts.lisviewsourcedisass" 21145msgid "View Assembler" 21146msgstr "" 21147 21148#: lazarusidestrconsts.lisviewsourcelfm 21149msgid "View Source (.lfm)" 21150msgstr "Toon bron (.lfm)" 21151 21152#: lazarusidestrconsts.liswarning 21153msgid "Warning: " 21154msgstr "" 21155 21156#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis 21157#, object-pascal-format, fuzzy 21158#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" 21159msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\"" 21160msgstr "Waarschuwing: dubbel bestand gevonden: \"%s\". Broncode bestand is: \"%s\"" 21161 21162#: lazarusidestrconsts.liswarnings 21163#, object-pascal-format 21164msgid ", Warnings: %s" 21165msgstr "" 21166 21167#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas 21168#, object-pascal-format 21169msgid "%sWarning: This is the main unit. The new main unit will be %s.pas." 21170msgstr "" 21171 21172#: lazarusidestrconsts.liswatch 21173msgid "&Watch" 21174msgstr "" 21175 21176#: lazarusidestrconsts.liswatchdata 21177msgid "Watch:" 21178msgstr "" 21179 21180#: lazarusidestrconsts.liswatchkind 21181msgid "Watch action" 21182msgstr "" 21183 21184#: lazarusidestrconsts.liswatchkindread 21185msgid "Read" 21186msgstr "" 21187 21188#: lazarusidestrconsts.liswatchkindreadwrite 21189msgid "Read/Write" 21190msgstr "" 21191 21192#: lazarusidestrconsts.liswatchkindwrite 21193msgid "Write" 21194msgstr "" 21195 21196#: lazarusidestrconsts.liswatchpoint 21197msgid "&Data/Watch Breakpoint ..." 21198msgstr "" 21199 21200#: lazarusidestrconsts.liswatchpointbreakpoint 21201msgid "&Data/watch Breakpoint ..." 21202msgstr "" 21203 21204#: lazarusidestrconsts.liswatchpropert 21205msgid "Watch Properties" 21206msgstr "" 21207 21208#: lazarusidestrconsts.liswatchscope 21209msgid "Watch scope" 21210msgstr "" 21211 21212#: lazarusidestrconsts.liswatchscopeglobal 21213msgctxt "lazarusidestrconsts.liswatchscopeglobal" 21214msgid "Global" 21215msgstr "" 21216 21217#: lazarusidestrconsts.liswatchscopelocal 21218msgid "Declaration" 21219msgstr "" 21220 21221#: lazarusidestrconsts.liswatchtowatchpoint 21222msgid "Create &Data/Watch Breakpoint ..." 21223msgstr "" 21224 21225#: lazarusidestrconsts.liswelcometolazaruside 21226#, object-pascal-format 21227msgid "Welcome to Lazarus IDE %s" 21228msgstr "" 21229 21230#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve 21231#, object-pascal-format 21232msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s" 21233msgstr "" 21234 21235#: lazarusidestrconsts.liswhatneedsbuilding 21236msgid "What needs building" 21237msgstr "" 21238 21239#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences 21240msgid "When a unit is renamed, update references" 21241msgstr "" 21242 21243#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew 21244msgid "When enabled the current options are saved to the template which is used when creating new projects" 21245msgstr "" 21246 21247#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed 21248msgid "When there is only one possible completion item use it immediately, without showing the completion box" 21249msgstr "" 21250 21251#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein 21252msgid "When the source editor cursor moves, show the current node in the code explorer" 21253msgstr "" 21254 21255#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform 21256msgid "Window menu shows designed form's name instead of caption" 21257msgstr "" 21258 21259#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint 21260msgid "Useful especially if the caption is left empty." 21261msgstr "" 21262 21263#: lazarusidestrconsts.liswindowstaysontop 21264msgid "Window stays on top" 21265msgstr "" 21266 21267#: lazarusidestrconsts.liswithincludes2 21268msgid ", with includes " 21269msgstr "" 21270 21271#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw 21272msgid "Without a proper compiler the code browsing and compiling will be disappointing." 21273msgstr "" 21274 21275#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing 21276msgid "Without a proper debugger, debugging will be disappointing." 21277msgstr "" 21278 21279#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn 21280msgid "Without a proper Lazarus directory you will get a lot of warnings." 21281msgstr "" 21282 21283#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis 21284msgid "Without a proper \"make\" executable the compiling of the IDE is not possible." 21285msgstr "" 21286 21287#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio 21288msgid "Without the proper FPC sources code browsing and completion will be very limited." 21289msgstr "" 21290 21291#: lazarusidestrconsts.liswithrequiredpackages 21292msgid "With required packages" 21293msgstr "Met benodigde paketten" 21294 21295#: lazarusidestrconsts.liswldeleteall 21296msgid "De&lete All" 21297msgstr "" 21298 21299#: lazarusidestrconsts.liswldisableall 21300msgid "D&isable All" 21301msgstr "" 21302 21303#: lazarusidestrconsts.liswlenableall 21304msgid "E&nable All" 21305msgstr "" 21306 21307#: lazarusidestrconsts.liswlexpression 21308msgid "Expression" 21309msgstr "Expressie" 21310 21311#: lazarusidestrconsts.liswlinspectpane 21312msgid "Inspect pane" 21313msgstr "" 21314 21315#: lazarusidestrconsts.liswlproperties 21316msgid "&Properties" 21317msgstr "&Eigenschappen" 21318 21319#: lazarusidestrconsts.liswlwatchlist 21320#, fuzzy 21321msgctxt "lazarusidestrconsts.liswlwatchlist" 21322msgid "Watches" 21323msgstr "Watches" 21324 21325#: lazarusidestrconsts.liswordatcursorincurrenteditor 21326msgid "Word at cursor in current editor" 21327msgstr "Woord bij de huidige bewerker positie" 21328 21329#: lazarusidestrconsts.lisworkingdirectoryforbuilding 21330msgid "Working directory for building" 21331msgstr "" 21332 21333#: lazarusidestrconsts.lisworkingdirectoryforrun 21334msgid "Working directory for run" 21335msgstr "" 21336 21337#: lazarusidestrconsts.liswriteerror 21338msgid "Write Error" 21339msgstr "Schrijffout" 21340 21341#: lazarusidestrconsts.liswriteerrorfile 21342#, object-pascal-format 21343msgid "Write error: %s%sFile: %s%s%s" 21344msgstr "" 21345 21346#: lazarusidestrconsts.liswritepackageinfofailed 21347msgid "Writing the package info file failed." 21348msgstr "" 21349 21350#: lazarusidestrconsts.liswriteprojectinfofailed 21351msgid "Writing the project info file failed." 21352msgstr "" 21353 21354#: lazarusidestrconsts.liswrongversionin 21355#, object-pascal-format 21356msgid "wrong version in %s: %s" 21357msgstr "" 21358 21359#: lazarusidestrconsts.lisxmlerror 21360msgid "XML Error" 21361msgstr "" 21362 21363#: lazarusidestrconsts.lisxmlparsererrorinfileerror 21364#, object-pascal-format 21365msgid "XML parser error in file %s%sError: %s" 21366msgstr "" 21367 21368#: lazarusidestrconsts.lisyes 21369msgid "Yes" 21370msgstr "" 21371 21372#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed 21373msgid "You can disable this for individual forms via the package editor" 21374msgstr "" 21375 21376#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu 21377msgid "You can disable this for individual forms via the popup menu in the project inspector" 21378msgstr "" 21379 21380#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor 21381msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory" 21382msgstr "" 21383 21384#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling 21385#, fuzzy 21386#| msgid "You can not build lazarus while debugging or compiling." 21387msgid "You cannot build Lazarus while debugging or compiling." 21388msgstr "Je kunt lazarus niet bouwen tijdens het debuggen of compileren." 21389 21390#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling 21391msgid "You cannot change the build mode while compiling." 21392msgstr "" 21393 21394#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter 21395msgid "You can select items by simply pressing underscored letters" 21396msgstr "" 21397 21398#: lazarusidestrconsts.lis_all_ 21399#, fuzzy 21400msgctxt "lazarusidestrconsts.lis_all_" 21401msgid "<All>" 21402msgstr "<Alles>" 21403 21404#: lazarusidestrconsts.locwndsrceditor 21405msgctxt "lazarusidestrconsts.locwndsrceditor" 21406msgid "Source Editor" 21407msgstr "Broncode Bewerker" 21408 21409#: lazarusidestrconsts.lrsplddeleteselected 21410msgid "Delete selected" 21411msgstr "" 21412 21413#: lazarusidestrconsts.lrspldinvalid 21414msgid "invalid" 21415msgstr "" 21416 21417#: lazarusidestrconsts.lrspldlpkfileinvalid 21418#, object-pascal-format 21419msgid "lpk file invalid (%s)" 21420msgstr "" 21421 21422#: lazarusidestrconsts.lrspldlpkfilevalid 21423#, object-pascal-format 21424msgid "lpk file valid (%s)" 21425msgstr "" 21426 21427#: lazarusidestrconsts.lrspldunabletodeletefile 21428#, object-pascal-format 21429msgid "Unable to delete file \"%s\"" 21430msgstr "" 21431 21432#: lazarusidestrconsts.lrspldvalid 21433msgid "valid" 21434msgstr "" 21435 21436#: lazarusidestrconsts.lrsrescanlplfiles 21437msgid "Rescan lpl files" 21438msgstr "" 21439 21440#: lazarusidestrconsts.lvlgraphaddhorizontalspacing 21441msgid "Add horizontal spacing between columns" 21442msgstr "" 21443 21444#: lazarusidestrconsts.lvlgraphaddverticalspacingar 21445msgid "Add vertical spacing around nodes" 21446msgstr "" 21447 21448#: lazarusidestrconsts.lvlgraphextraspacing 21449msgid "Extra spacing (x/y)" 21450msgstr "" 21451 21452#: lazarusidestrconsts.lvlgraphnamesabovenode 21453msgid "Names above node" 21454msgstr "" 21455 21456#: lazarusidestrconsts.lvlgraphoptabsolutelimi 21457msgid "Absolute limit for height of levels" 21458msgstr "" 21459 21460#: lazarusidestrconsts.lvlgraphoptcrossings 21461msgid "Crossings" 21462msgstr "" 21463 21464#: lazarusidestrconsts.lvlgraphoptedgelen 21465msgid "Edge len" 21466msgstr "" 21467 21468#: lazarusidestrconsts.lvlgraphoptedges 21469msgid "Edges" 21470msgstr "" 21471 21472#: lazarusidestrconsts.lvlgraphoptinfo 21473msgid "Info" 21474msgstr "" 21475 21476#: lazarusidestrconsts.lvlgraphoptlevels 21477#, fuzzy 21478msgctxt "lazarusidestrconsts.lvlgraphoptlevels" 21479msgid "Levels" 21480msgstr "Niveaus" 21481 21482#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl 21483msgid "Limit height of Levels" 21484msgstr "" 21485 21486#: lazarusidestrconsts.lvlgraphoptlimitrelativ 21487#, object-pascal-format 21488msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))" 21489msgstr "" 21490 21491#: lazarusidestrconsts.lvlgraphoptsplitpoints 21492msgid "Splitpoints" 21493msgstr "" 21494 21495#: lazarusidestrconsts.lvlgraphreducebackedges 21496msgid "Reduce backedges" 21497msgstr "" 21498 21499#: lazarusidestrconsts.lvlgraphshapecalculatelay 21500msgid "Calculate layout from high-edge" 21501msgstr "" 21502 21503#: lazarusidestrconsts.lvlgraphshapecurved 21504msgid "Curved" 21505msgstr "" 21506 21507#: lazarusidestrconsts.lvlgraphshapeedgesshape 21508msgid "Edges shape" 21509msgstr "" 21510 21511#: lazarusidestrconsts.lvlgraphshapeedgessplitmo 21512msgid "Edges split mode" 21513msgstr "" 21514 21515#: lazarusidestrconsts.lvlgraphshapeminimizeedge 21516msgid "Minimize edges len" 21517msgstr "" 21518 21519#: lazarusidestrconsts.lvlgraphshapenodes 21520msgid "Nodes" 21521msgstr "" 21522 21523#: lazarusidestrconsts.lvlgraphshapestraight 21524msgid "Straight" 21525msgstr "" 21526 21527#: lazarusidestrconsts.lvlgraphsplitmergeathighe 21528msgid "Merge at highest" 21529msgstr "" 21530 21531#: lazarusidestrconsts.lvlgraphsplitmergeatsourc 21532msgid "Merge at source" 21533msgstr "" 21534 21535#: lazarusidestrconsts.lvlgraphsplitmergeattarge 21536msgid "Merge at target" 21537msgstr "" 21538 21539#: lazarusidestrconsts.lvlgraphsplitnone 21540#, fuzzy 21541msgctxt "lazarusidestrconsts.lvlgraphsplitnone" 21542msgid "None" 21543msgstr "Geen" 21544 21545#: lazarusidestrconsts.lvlgraphsplitseparate 21546msgid "Separate" 21547msgstr "" 21548 21549#: lazarusidestrconsts.lvlgraphstraightengraph 21550msgid "Straighten graph" 21551msgstr "" 21552 21553#: lazarusidestrconsts.podaddpackageunittousessection 21554msgid "Add package unit to uses section" 21555msgstr "" 21556 21557#: lazarusidestrconsts.regdlgbinary 21558msgctxt "lazarusidestrconsts.regdlgbinary" 21559msgid "Binary" 21560msgstr "Binair" 21561 21562#: lazarusidestrconsts.regdlgdecimal 21563msgctxt "lazarusidestrconsts.regdlgdecimal" 21564msgid "Decimal" 21565msgstr "" 21566 21567#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters 21568msgid "Display type for selected Registers" 21569msgstr "" 21570 21571#: lazarusidestrconsts.regdlgformat 21572msgid "Format" 21573msgstr "" 21574 21575#: lazarusidestrconsts.regdlghex 21576msgid "Hex" 21577msgstr "" 21578 21579#: lazarusidestrconsts.regdlgoctal 21580msgid "Octal" 21581msgstr "" 21582 21583#: lazarusidestrconsts.regdlgraw 21584msgid "Raw" 21585msgstr "" 21586 21587#: lazarusidestrconsts.rsaddinverse 21588msgid "Add Inverse" 21589msgstr "" 21590 21591#: lazarusidestrconsts.rsaddnewterm 21592msgid "Add new term" 21593msgstr "" 21594 21595#: lazarusidestrconsts.rsattachto 21596msgid "Attach to" 21597msgstr "" 21598 21599#: lazarusidestrconsts.rsattributes 21600msgid "Attributes" 21601msgstr "" 21602 21603#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber 21604msgid "Automatically increase build number" 21605msgstr "" 21606 21607#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint 21608msgid "Increased every time the project is compiled." 21609msgstr "" 21610 21611#: lazarusidestrconsts.rsbuild 21612msgid "&Build:" 21613msgstr "" 21614 21615#: lazarusidestrconsts.rscharacterset 21616msgid "Character set:" 21617msgstr "" 21618 21619#: lazarusidestrconsts.rscloseall 21620msgid "Close all pages" 21621msgstr "" 21622 21623#: lazarusidestrconsts.rsclosecurrentpage 21624msgid "Close current page" 21625msgstr "" 21626 21627#: lazarusidestrconsts.rscloseleft 21628msgid "Close page(s) on the left" 21629msgstr "" 21630 21631#: lazarusidestrconsts.rscloseothers 21632msgid "Close other page(s)" 21633msgstr "" 21634 21635#: lazarusidestrconsts.rscloseright 21636msgid "Close page(s) on the right" 21637msgstr "" 21638 21639#: lazarusidestrconsts.rsconditionaldefines 21640msgid "Conditional defines" 21641msgstr "" 21642 21643#: lazarusidestrconsts.rscreatenewdefine 21644msgid "Create new define" 21645msgstr "" 21646 21647#: lazarusidestrconsts.rsenablei18n 21648msgid "Enable i18n" 21649msgstr "" 21650 21651#: lazarusidestrconsts.rsenterpid 21652msgid "Enter PID" 21653msgstr "" 21654 21655#: lazarusidestrconsts.rsfilterthelistwithstring 21656msgid "Filter the lines in list with a string" 21657msgstr "" 21658 21659#: lazarusidestrconsts.rsfoundbutnotlistedhere 21660msgid "Found but not listed here: " 21661msgstr "" 21662 21663#: lazarusidestrconsts.rsi18nexcluded 21664msgid "Excluded" 21665msgstr "" 21666 21667#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild 21668msgid "Force update PO files on next build" 21669msgstr "" 21670 21671#: lazarusidestrconsts.rsi18nidentifiers 21672msgid "Identifiers:" 21673msgstr "" 21674 21675#: lazarusidestrconsts.rsi18noptions 21676msgid "i18n Options" 21677msgstr "" 21678 21679#: lazarusidestrconsts.rsi18noriginals 21680msgid "Originals:" 21681msgstr "" 21682 21683#: lazarusidestrconsts.rsincludeversioninfohint 21684msgid "Version info is stored if the executable format supports it." 21685msgstr "" 21686 21687#: lazarusidestrconsts.rsincludeversioninfoinexecutable 21688msgid "Include version info in executable" 21689msgstr "" 21690 21691#: lazarusidestrconsts.rslanguageafrikaans 21692msgid "Afrikaans" 21693msgstr "" 21694 21695#: lazarusidestrconsts.rslanguagearabic 21696msgid "Arabic" 21697msgstr "Arabisch" 21698 21699#: lazarusidestrconsts.rslanguageautomatic 21700#, fuzzy 21701#| msgid "Automatic (or english)" 21702msgid "Automatic (or English)" 21703msgstr "Automatisch (of Engels)" 21704 21705#: lazarusidestrconsts.rslanguagecatalan 21706msgid "Catalan" 21707msgstr "Catalaans" 21708 21709#: lazarusidestrconsts.rslanguagechinese 21710msgid "Chinese" 21711msgstr "Chinees" 21712 21713#: lazarusidestrconsts.rslanguageczech 21714msgid "Czech" 21715msgstr "" 21716 21717#: lazarusidestrconsts.rslanguagedutch 21718msgid "Dutch" 21719msgstr "Nederlands" 21720 21721#: lazarusidestrconsts.rslanguageenglish 21722msgid "English" 21723msgstr "Engels" 21724 21725#: lazarusidestrconsts.rslanguagefinnish 21726msgid "Finnish" 21727msgstr "Fins" 21728 21729#: lazarusidestrconsts.rslanguagefrench 21730msgid "French" 21731msgstr "Frans" 21732 21733#: lazarusidestrconsts.rslanguagegerman 21734msgid "German" 21735msgstr "Duits" 21736 21737#: lazarusidestrconsts.rslanguagehebrew 21738msgid "Hebrew" 21739msgstr "Hebreeuws" 21740 21741#: lazarusidestrconsts.rslanguagehungarian 21742msgid "Hungarian" 21743msgstr "" 21744 21745#: lazarusidestrconsts.rslanguageindonesian 21746msgid "Indonesian" 21747msgstr "Indonesisch" 21748 21749#: lazarusidestrconsts.rslanguageitalian 21750msgid "Italian" 21751msgstr "Itiliaans" 21752 21753#: lazarusidestrconsts.rslanguagejapanese 21754msgid "Japanese" 21755msgstr "Japans" 21756 21757#: lazarusidestrconsts.rslanguagelithuanian 21758msgid "Lithuanian" 21759msgstr "" 21760 21761#: lazarusidestrconsts.rslanguageoptions 21762msgid "Language options" 21763msgstr "" 21764 21765#: lazarusidestrconsts.rslanguagepolish 21766msgid "Polish" 21767msgstr "Pools" 21768 21769#: lazarusidestrconsts.rslanguageportuguese 21770msgid "Portuguese" 21771msgstr "" 21772 21773#: lazarusidestrconsts.rslanguageportuguesebr 21774msgid "Brazilian Portuguese" 21775msgstr "" 21776 21777#: lazarusidestrconsts.rslanguagerussian 21778msgid "Russian" 21779msgstr "Russisch" 21780 21781#: lazarusidestrconsts.rslanguageselection 21782msgid "Language selection:" 21783msgstr "" 21784 21785#: lazarusidestrconsts.rslanguageslovak 21786msgid "Slovak" 21787msgstr "" 21788 21789#: lazarusidestrconsts.rslanguagespanish 21790msgid "Spanish" 21791msgstr "Spaans" 21792 21793#: lazarusidestrconsts.rslanguageturkish 21794msgid "Turkish" 21795msgstr "" 21796 21797#: lazarusidestrconsts.rslanguageukrainian 21798msgid "Ukrainian" 21799msgstr "Oekraiens" 21800 21801#: lazarusidestrconsts.rsmajorversion 21802msgid "&Major version:" 21803msgstr "" 21804 21805#: lazarusidestrconsts.rsminorversion 21806msgid "Mi&nor version:" 21807msgstr "" 21808 21809#: lazarusidestrconsts.rsnewsearchwithsamecriteria 21810msgid "New search with same criteria" 21811msgstr "" 21812 21813#: lazarusidestrconsts.rsotherinfo 21814msgid "Other info" 21815msgstr "" 21816 21817#: lazarusidestrconsts.rspooutputdirectory 21818msgid "PO Output Directory:" 21819msgstr "" 21820 21821#: lazarusidestrconsts.rsrefreshthesearch 21822msgid "Refresh the search" 21823msgstr "" 21824 21825#: lazarusidestrconsts.rsresource 21826msgid "Resource" 21827msgstr "" 21828 21829#: lazarusidestrconsts.rsresourceclear 21830msgid "Delete all resources?" 21831msgstr "" 21832 21833#: lazarusidestrconsts.rsresourcefilename 21834msgid "File name" 21835msgstr "" 21836 21837#: lazarusidestrconsts.rsresourcetype 21838msgctxt "lazarusidestrconsts.rsresourcetype" 21839msgid "Type" 21840msgstr "Type" 21841 21842#: lazarusidestrconsts.rsrevision 21843msgid "&Revision:" 21844msgstr "" 21845 21846#: lazarusidestrconsts.rsselectaninheritedentry 21847msgid "Select an inherited entry" 21848msgstr "" 21849 21850#: lazarusidestrconsts.rsversionnumbering 21851msgid "Version numbering" 21852msgstr "" 21853 21854#: lazarusidestrconsts.showoptions 21855msgid "Show options" 21856msgstr "" 21857 21858#: lazarusidestrconsts.srkmcarhelpmenu 21859msgid "Help menu commands" 21860msgstr "Help menu acties" 21861 21862#: lazarusidestrconsts.srkmcatcmdcmd 21863msgid "Command commands" 21864msgstr "Opdrachtopdrachten" 21865 21866#: lazarusidestrconsts.srkmcatcodetools 21867msgid "CodeTools commands" 21868msgstr "CodeToolscommando's" 21869 21870#: lazarusidestrconsts.srkmcatcolselection 21871msgid "Text column selection commands" 21872msgstr "" 21873 21874#: lazarusidestrconsts.srkmcatcursormoving 21875msgid "Cursor moving commands" 21876msgstr "Cursor beweeg commando's" 21877 21878#: lazarusidestrconsts.srkmcatediting 21879msgid "Text editing commands" 21880msgstr "Tekstverwerkingsopdrachten" 21881 21882#: lazarusidestrconsts.srkmcatfilemenu 21883msgid "File menu commands" 21884msgstr "Bestandsmenu acties" 21885 21886#: lazarusidestrconsts.srkmcatfold 21887msgid "Text folding commands" 21888msgstr "" 21889 21890#: lazarusidestrconsts.srkmcatmacrorecording 21891msgctxt "lazarusidestrconsts.srkmcatmacrorecording" 21892msgid "Macros" 21893msgstr "Macros" 21894 21895#: lazarusidestrconsts.srkmcatmarker 21896#, fuzzy 21897#| msgid "Text marker commands" 21898msgid "Text bookmark commands" 21899msgstr "Tekstmarkering opdrachten" 21900 21901#: lazarusidestrconsts.srkmcatmulticaret 21902msgid "Multi caret commands" 21903msgstr "" 21904 21905#: lazarusidestrconsts.srkmcatpackagemenu 21906msgid "Package menu commands" 21907msgstr "" 21908 21909#: lazarusidestrconsts.srkmcatprojectmenu 21910msgid "Project menu commands" 21911msgstr "Project menu commandos" 21912 21913#: lazarusidestrconsts.srkmcatrunmenu 21914msgid "Run menu commands" 21915msgstr "Start menu commando's" 21916 21917#: lazarusidestrconsts.srkmcatsearchreplace 21918msgid "Text search and replace commands" 21919msgstr "Tekstzoek- en vervangopdrachten" 21920 21921#: lazarusidestrconsts.srkmcatselection 21922msgid "Text selection commands" 21923msgstr "Tekstselectieopdrachten" 21924 21925#: lazarusidestrconsts.srkmcatsrcnotebook 21926msgid "Source Notebook commands" 21927msgstr "Bron notitieblok opdrachten" 21928 21929#: lazarusidestrconsts.srkmcatsyncroedit 21930msgid "Syncron Editing" 21931msgstr "" 21932 21933#: lazarusidestrconsts.srkmcatsyncroeditoff 21934msgid "Syncron Editing (not in Cell)" 21935msgstr "" 21936 21937#: lazarusidestrconsts.srkmcatsyncroeditsel 21938msgid "Syncron Editing (while selecting)" 21939msgstr "" 21940 21941#: lazarusidestrconsts.srkmcattemplateedit 21942msgid "Template Editing" 21943msgstr "" 21944 21945#: lazarusidestrconsts.srkmcattemplateeditoff 21946msgid "Template Editing (not in Cell)" 21947msgstr "" 21948 21949#: lazarusidestrconsts.srkmcattoolmenu 21950msgid "Tools menu commands" 21951msgstr "Hulpmiddelen menu commando's" 21952 21953#: lazarusidestrconsts.srkmcatviewmenu 21954msgid "View menu commands" 21955msgstr "Toon Menu commando's" 21956 21957#: lazarusidestrconsts.srkmcommand 21958msgctxt "lazarusidestrconsts.srkmcommand" 21959msgid "Command:" 21960msgstr "Opdracht:" 21961 21962#: lazarusidestrconsts.srkmconflic 21963msgid "Conflict " 21964msgstr "Conflict " 21965 21966#: lazarusidestrconsts.srkmecabortbuild 21967msgid "abort build" 21968msgstr "Bouw afbreken" 21969 21970#: lazarusidestrconsts.srkmecabstractmethods 21971msgid "Abstract Methods ..." 21972msgstr "" 21973 21974#: lazarusidestrconsts.srkmecaddbpaddress 21975msgid "add address breakpoint" 21976msgstr "" 21977 21978#: lazarusidestrconsts.srkmecaddbpsource 21979msgid "add source breakpoint" 21980msgstr "" 21981 21982#: lazarusidestrconsts.srkmecaddbpwatchpoint 21983msgid "add data/watchpoint" 21984msgstr "" 21985 21986#: lazarusidestrconsts.srkmecaddjumppoint 21987#, fuzzy 21988#| msgid "Add jump point" 21989msgid "Add Jump Point" 21990msgstr "Springpunt toevoegen" 21991 21992#: lazarusidestrconsts.srkmecaddwatch 21993msgid "add watch" 21994msgstr "Watch toevoegen" 21995 21996#: lazarusidestrconsts.srkmecattach 21997msgid "Attach to program" 21998msgstr "" 21999 22000#: lazarusidestrconsts.srkmecautocompletion 22001msgid "Code template completion" 22002msgstr "Broncodesjablooncompletering" 22003 22004#: lazarusidestrconsts.srkmecblockcopy 22005msgid "Copy Block" 22006msgstr "" 22007 22008#: lazarusidestrconsts.srkmecblockdelete 22009msgid "Delete Block" 22010msgstr "" 22011 22012#: lazarusidestrconsts.srkmecblockgotobegin 22013msgid "Goto Block begin" 22014msgstr "" 22015 22016#: lazarusidestrconsts.srkmecblockgotoend 22017msgid "Goto Block end" 22018msgstr "" 22019 22020#: lazarusidestrconsts.srkmecblockhide 22021msgid "Hide Block" 22022msgstr "" 22023 22024#: lazarusidestrconsts.srkmecblockindent 22025msgid "Indent block" 22026msgstr "Blok Inspringen" 22027 22028#: lazarusidestrconsts.srkmecblockmove 22029msgid "Move Block" 22030msgstr "" 22031 22032#: lazarusidestrconsts.srkmecblocksetbegin 22033msgid "Set block begin" 22034msgstr "" 22035 22036#: lazarusidestrconsts.srkmecblocksetend 22037msgid "Set block end" 22038msgstr "" 22039 22040#: lazarusidestrconsts.srkmecblockshow 22041msgid "Show Block" 22042msgstr "" 22043 22044#: lazarusidestrconsts.srkmecblocktogglehide 22045msgid "Toggle block" 22046msgstr "" 22047 22048#: lazarusidestrconsts.srkmecblockunindent 22049msgid "Unindent block" 22050msgstr "Unindent Blok" 22051 22052#: lazarusidestrconsts.srkmecbuild 22053msgid "build program/project" 22054msgstr "Bouw programma/project" 22055 22056#: lazarusidestrconsts.srkmecbuildfile 22057msgid "build file" 22058msgstr "Bouw bestand" 22059 22060#: lazarusidestrconsts.srkmecbuildlazarus 22061#, fuzzy 22062#| msgid "Build lazarus" 22063msgid "Build Lazarus" 22064msgstr "Bouw Lazarus" 22065 22066#: lazarusidestrconsts.srkmecbuildmanymodes 22067msgid "build many modes" 22068msgstr "" 22069 22070#: lazarusidestrconsts.srkmecchar 22071msgid "Char" 22072msgstr "Karakter" 22073 22074#: lazarusidestrconsts.srkmeccleanupandbuild 22075msgid "clean up and build" 22076msgstr "" 22077 22078#: lazarusidestrconsts.srkmecclearall 22079msgid "Delete whole text" 22080msgstr "Verwijder gehele tekst" 22081 22082#: lazarusidestrconsts.srkmecclearallbookmark 22083msgid "Clear all Bookmarks" 22084msgstr "" 22085 22086#: lazarusidestrconsts.srkmecclearbookmarkforfile 22087msgid "Clear Bookmarks for current file" 22088msgstr "" 22089 22090#: lazarusidestrconsts.srkmeccolseldown 22091msgid "Column Select Down" 22092msgstr "" 22093 22094#: lazarusidestrconsts.srkmeccolseleditorbottom 22095msgid "Column Select to absolute end" 22096msgstr "" 22097 22098#: lazarusidestrconsts.srkmeccolseleditortop 22099msgid "Column Select to absolute beginning" 22100msgstr "" 22101 22102#: lazarusidestrconsts.srkmeccolselleft 22103msgid "Column Select Left" 22104msgstr "" 22105 22106#: lazarusidestrconsts.srkmeccolsellineend 22107msgid "Column Select Line End" 22108msgstr "" 22109 22110#: lazarusidestrconsts.srkmeccolsellinestart 22111msgid "Column Select Line Start" 22112msgstr "" 22113 22114#: lazarusidestrconsts.srkmeccolsellinetextstart 22115msgid "Column Select to text start in line" 22116msgstr "" 22117 22118#: lazarusidestrconsts.srkmeccolselpagebottom 22119msgid "Column Select Page Bottom" 22120msgstr "" 22121 22122#: lazarusidestrconsts.srkmeccolselpagedown 22123msgid "Column Select Page Down" 22124msgstr "" 22125 22126#: lazarusidestrconsts.srkmeccolselpagetop 22127msgid "Column Select Page Top" 22128msgstr "" 22129 22130#: lazarusidestrconsts.srkmeccolselpageup 22131msgid "Column Select Page Up" 22132msgstr "" 22133 22134#: lazarusidestrconsts.srkmeccolselright 22135msgid "Column Select Right" 22136msgstr "" 22137 22138#: lazarusidestrconsts.srkmeccolselup 22139msgid "Column Select Up" 22140msgstr "" 22141 22142#: lazarusidestrconsts.srkmeccolselwordleft 22143msgid "Column Select Word Left" 22144msgstr "" 22145 22146#: lazarusidestrconsts.srkmeccolselwordright 22147msgid "Column Select Word Right" 22148msgstr "" 22149 22150#: lazarusidestrconsts.srkmeccolumnselect 22151msgid "Column selection mode" 22152msgstr "Kolom selectie methode" 22153 22154#: lazarusidestrconsts.srkmeccompile 22155msgid "compile program/project" 22156msgstr "" 22157 22158#: lazarusidestrconsts.srkmecconfigbuildfile 22159msgid "config build file" 22160msgstr "Configureer bouwbestand" 22161 22162#: lazarusidestrconsts.srkmeccopy 22163#, fuzzy 22164#| msgid "Copy selection to clipboard" 22165msgctxt "lazarusidestrconsts.srkmeccopy" 22166msgid "Copy" 22167msgstr "Kopieer selectie naar klembord" 22168 22169#: lazarusidestrconsts.srkmeccopyadd 22170msgid "Copy (Add to Clipboard)" 22171msgstr "" 22172 22173#: lazarusidestrconsts.srkmeccopyaddcurrentline 22174msgid "Copy current line (Add to Clipboard)" 22175msgstr "" 22176 22177#: lazarusidestrconsts.srkmeccopycurrentline 22178msgid "Copy current line" 22179msgstr "" 22180 22181#: lazarusidestrconsts.srkmeccopyeditornewwindow 22182msgid "Copy editor to new window" 22183msgstr "" 22184 22185#: lazarusidestrconsts.srkmeccopyeditornextwindow 22186msgid "Copy editor to next free window" 22187msgstr "" 22188 22189#: lazarusidestrconsts.srkmeccopyeditorprevwindow 22190msgid "Copy editor to prior free window" 22191msgstr "" 22192 22193#: lazarusidestrconsts.srkmeccut 22194#, fuzzy 22195#| msgid "Cut selection to clipboard" 22196msgctxt "lazarusidestrconsts.srkmeccut" 22197msgid "Cut" 22198msgstr "Knip selectie naar klembord" 22199 22200#: lazarusidestrconsts.srkmeccutadd 22201msgid "Cut (Add to Clipboard)" 22202msgstr "" 22203 22204#: lazarusidestrconsts.srkmeccutaddcurrentline 22205msgid "Cut current line (Add to Clipboard)" 22206msgstr "" 22207 22208#: lazarusidestrconsts.srkmeccutcurrentline 22209msgid "Cut current line" 22210msgstr "" 22211 22212#: lazarusidestrconsts.srkmecdeletebol 22213msgid "Delete to beginning of line" 22214msgstr "Verwijder tot het begin van de regel" 22215 22216#: lazarusidestrconsts.srkmecdeletechar 22217msgid "Delete char at cursor" 22218msgstr "Verwijder karakter bij cursor" 22219 22220#: lazarusidestrconsts.srkmecdeleteeol 22221msgid "Delete to end of line" 22222msgstr "Verwijder tot het eind van de regel" 22223 22224#: lazarusidestrconsts.srkmecdeletelastchar 22225msgid "Delete Last Char" 22226msgstr "Verwijder laatste karakter" 22227 22228#: lazarusidestrconsts.srkmecdeletelastword 22229msgid "Delete to start of word" 22230msgstr "Verwijder tot het begin van het woord" 22231 22232#: lazarusidestrconsts.srkmecdeleteline 22233msgid "Delete current line" 22234msgstr "Verwijder huidige regel" 22235 22236#: lazarusidestrconsts.srkmecdeleteword 22237msgid "Delete to end of word" 22238msgstr "Verwijder tot het eind van het woord" 22239 22240#: lazarusidestrconsts.srkmecdetach 22241msgid "Detach from program" 22242msgstr "" 22243 22244#: lazarusidestrconsts.srkmecdiff 22245msgctxt "lazarusidestrconsts.srkmecdiff" 22246msgid "Diff" 22247msgstr "Verschil" 22248 22249#: lazarusidestrconsts.srkmecdown 22250msgid "Move cursor down" 22251msgstr "" 22252 22253#: lazarusidestrconsts.srkmecduplicateline 22254msgid "Duplicate line (or lines in selection)" 22255msgstr "" 22256 22257#: lazarusidestrconsts.srkmecduplicateselection 22258msgid "Duplicate selection" 22259msgstr "" 22260 22261#: lazarusidestrconsts.srkmeceditorbottom 22262msgid "Move cursor to absolute end" 22263msgstr "Verplaats cursor naar het absolute eind" 22264 22265#: lazarusidestrconsts.srkmeceditortop 22266msgid "Move cursor to absolute beginning" 22267msgstr "Verplaats cursor naar het absolute begin" 22268 22269#: lazarusidestrconsts.srkmecemptymethods 22270msgid "Empty Methods ..." 22271msgstr "" 22272 22273#: lazarusidestrconsts.srkmecenvironmentoptions 22274msgid "IDE options" 22275msgstr "" 22276 22277#: lazarusidestrconsts.srkmecevaluate 22278msgid "evaluate/modify" 22279msgstr "bereken/wijzig" 22280 22281#: lazarusidestrconsts.srkmecextractproc 22282#, fuzzy 22283#| msgid "Extract procedure" 22284msgctxt "lazarusidestrconsts.srkmecextractproc" 22285msgid "Extract Procedure" 22286msgstr "Destilleer procedure" 22287 22288#: lazarusidestrconsts.srkmecexttool 22289#, object-pascal-format 22290msgid "External tool %d" 22291msgstr "Extern gereedschap %d" 22292 22293#: lazarusidestrconsts.srkmecexttoolsettings 22294msgid "External tools settings" 22295msgstr "Externe hulpmiddelen instellingen" 22296 22297#: lazarusidestrconsts.srkmecfind 22298#, fuzzy 22299#| msgid "Find text" 22300msgid "Find Text" 22301msgstr "Zoek tekst" 22302 22303#: lazarusidestrconsts.srkmecfindblockotherend 22304msgid "Find block other end" 22305msgstr "Zoek blok Einde" 22306 22307#: lazarusidestrconsts.srkmecfindblockstart 22308msgid "Find block start" 22309msgstr "Zoek blok Start" 22310 22311#: lazarusidestrconsts.srkmecfinddeclaration 22312#, fuzzy 22313#| msgid "Find declaration" 22314msgid "Find Declaration" 22315msgstr "Zoek Declaratie" 22316 22317#: lazarusidestrconsts.srkmecfindidentifierrefs 22318#, fuzzy 22319#| msgid "Find identifier references" 22320msgid "Find Identifier References" 22321msgstr "Vind identifier referenties" 22322 22323#: lazarusidestrconsts.srkmecfindinfiles 22324#, fuzzy 22325#| msgid "Find in files" 22326msgid "Find in Files" 22327msgstr "Vind in bestanden" 22328 22329#: lazarusidestrconsts.srkmecfindnext 22330#, fuzzy 22331#| msgid "Find next" 22332msgctxt "lazarusidestrconsts.srkmecfindnext" 22333msgid "Find Next" 22334msgstr "Vind volgende" 22335 22336#: lazarusidestrconsts.srkmecfindnextwordoccurrence 22337msgid "Find Next Word Occurrence" 22338msgstr "" 22339 22340#: lazarusidestrconsts.srkmecfindoverloads 22341msgid "Find Overloads" 22342msgstr "" 22343 22344#: lazarusidestrconsts.srkmecfindoverloadscapt 22345msgid "Find Overloads ..." 22346msgstr "" 22347 22348#: lazarusidestrconsts.srkmecfindprevious 22349#, fuzzy 22350#| msgid "Find previous" 22351msgid "Find Previous" 22352msgstr "Vind vorige" 22353 22354#: lazarusidestrconsts.srkmecfindprevwordoccurrence 22355msgid "Find Previous Word Occurrence" 22356msgstr "" 22357 22358#: lazarusidestrconsts.srkmecfindproceduredefinition 22359#, fuzzy 22360#| msgid "Find procedure definiton" 22361msgid "Find Procedure Definiton" 22362msgstr "Vind procedure definitie" 22363 22364#: lazarusidestrconsts.srkmecfindproceduremethod 22365#, fuzzy 22366#| msgid "Find procedure method" 22367msgid "Find Procedure Method" 22368msgstr "Vind procedure methode" 22369 22370#: lazarusidestrconsts.srkmecfoldcurrent 22371msgid "Fold at Cursor" 22372msgstr "" 22373 22374#: lazarusidestrconsts.srkmecfoldlevel 22375#, object-pascal-format 22376msgid "Fold to Level %d" 22377msgstr "" 22378 22379#: lazarusidestrconsts.srkmecgotoeditor 22380#, object-pascal-format 22381msgid "Go to editor %d" 22382msgstr "Ga naar tekstverwerker %d" 22383 22384#: lazarusidestrconsts.srkmecgotoincludedirective 22385#, fuzzy 22386#| msgid "Go to to include directive of current include file" 22387msgid "Go to include directive of current include file" 22388msgstr "Ga naar include opdracht van huidig include bestand" 22389 22390#: lazarusidestrconsts.srkmecgotolinenumber 22391#, fuzzy 22392#| msgid "Go to line number" 22393msgid "Go to Line Number" 22394msgstr "Ga naar lijn nummer" 22395 22396#: lazarusidestrconsts.srkmecgotomarker 22397#, object-pascal-format, fuzzy 22398#| msgid "Go to Marker %d" 22399msgid "Go to bookmark %d" 22400msgstr "Ga naar Marker %d" 22401 22402#: lazarusidestrconsts.srkmecgotoxy 22403msgid "Goto XY" 22404msgstr "Ga naar XY" 22405 22406#: lazarusidestrconsts.srkmecguessmisplacedifdef 22407#, fuzzy 22408#| msgid "Guess misplaced $IFDEF" 22409msgid "Guess Misplaced $IFDEF" 22410msgstr "Corrigeer verkeerde $IFDEF" 22411 22412#: lazarusidestrconsts.srkmechalfwordleft 22413msgid "Move cursor part-word left (e.g. CamelCase)" 22414msgstr "" 22415 22416#: lazarusidestrconsts.srkmechalfwordright 22417msgid "Move cursor part-word right (e.g. CamelCase)" 22418msgstr "" 22419 22420#: lazarusidestrconsts.srkmecimestr 22421msgid "Ime Str" 22422msgstr "Ime Str" 22423 22424#: lazarusidestrconsts.srkmecinsertchangelogentry 22425msgid "Insert ChangeLog entry" 22426msgstr "ChangeLog item toevoegen" 22427 22428#: lazarusidestrconsts.srkmecinsertcharacter 22429msgid "Insert from Charactermap" 22430msgstr "Invoegen vanaf de karaktermap" 22431 22432#: lazarusidestrconsts.srkmecinsertcvsauthor 22433msgid "Insert CVS keyword Author" 22434msgstr "Invoegen CVS Keyword Auteur" 22435 22436#: lazarusidestrconsts.srkmecinsertcvsdate 22437msgid "Insert CVS keyword Date" 22438msgstr "Invoegen CVS keyword Datum" 22439 22440#: lazarusidestrconsts.srkmecinsertcvsheader 22441msgid "Insert CVS keyword Header" 22442msgstr "Invoegen CVS keyword Header" 22443 22444#: lazarusidestrconsts.srkmecinsertcvsid 22445msgid "Insert CVS keyword ID" 22446msgstr "Invoegen CVS keyword ID" 22447 22448#: lazarusidestrconsts.srkmecinsertcvslog 22449msgid "Insert CVS keyword Log" 22450msgstr "Invoegen CVS keyword Log" 22451 22452#: lazarusidestrconsts.srkmecinsertcvsname 22453msgid "Insert CVS keyword Name" 22454msgstr "Invoegen CVS keyword Naam" 22455 22456#: lazarusidestrconsts.srkmecinsertcvsrevision 22457msgid "Insert CVS keyword Revision" 22458msgstr "Invoegen CVS keyword Revisie" 22459 22460#: lazarusidestrconsts.srkmecinsertcvssource 22461msgid "Insert CVS keyword Source" 22462msgstr "Invoegen CVS keyword Broncode" 22463 22464#: lazarusidestrconsts.srkmecinsertdatetime 22465msgid "Insert current date and time" 22466msgstr "Huidige datum tijd invoegen" 22467 22468#: lazarusidestrconsts.srkmecinsertfilename 22469msgid "Insert Full Filename" 22470msgstr "" 22471 22472#: lazarusidestrconsts.srkmecinsertgplnotice 22473msgid "Insert GPL notice" 22474msgstr "Invoegen GPL notice" 22475 22476#: lazarusidestrconsts.srkmecinsertgplnoticetranslated 22477msgid "Insert GPL notice (translated)" 22478msgstr "" 22479 22480#: lazarusidestrconsts.srkmecinsertguid 22481msgid "Insert a GUID" 22482msgstr "" 22483 22484#: lazarusidestrconsts.srkmecinsertlgplnotice 22485msgid "Insert LGPL notice" 22486msgstr "LGPL melding invoegen" 22487 22488#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated 22489msgid "Insert LGPL notice (translated)" 22490msgstr "" 22491 22492#: lazarusidestrconsts.srkmecinsertline 22493msgid "Break line, leave cursor" 22494msgstr "Breek lijn, verlaat cursor" 22495 22496#: lazarusidestrconsts.srkmecinsertmitnotice 22497msgid "Insert MIT notice" 22498msgstr "" 22499 22500#: lazarusidestrconsts.srkmecinsertmitnoticetranslated 22501msgid "Insert MIT notice (translated)" 22502msgstr "" 22503 22504#: lazarusidestrconsts.srkmecinsertmode 22505msgid "Insert Mode" 22506msgstr "Invoeg mode" 22507 22508#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice 22509msgid "Insert modified LGPL notice" 22510msgstr "" 22511 22512#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated 22513msgid "Insert modified LGPL notice (translated)" 22514msgstr "" 22515 22516#: lazarusidestrconsts.srkmecinsertusername 22517msgid "Insert current username" 22518msgstr "Huidige gebruikers naam invoegen" 22519 22520#: lazarusidestrconsts.srkmecinspect 22521msgid "inspect" 22522msgstr "inspecteer" 22523 22524#: lazarusidestrconsts.srkmecinvertassignment 22525#, fuzzy 22526#| msgid "Invert assignment" 22527msgctxt "lazarusidestrconsts.srkmecinvertassignment" 22528msgid "Invert Assignment" 22529msgstr "Draai toekenning om" 22530 22531#: lazarusidestrconsts.srkmeckeymapleft 22532#, fuzzy 22533msgctxt "lazarusidestrconsts.srkmeckeymapleft" 22534msgid "Left" 22535msgstr "Links" 22536 22537#: lazarusidestrconsts.srkmeckeymapright 22538#, fuzzy 22539msgctxt "lazarusidestrconsts.srkmeckeymapright" 22540msgid "Right" 22541msgstr "Rechts" 22542 22543#: lazarusidestrconsts.srkmecleft 22544msgid "Move cursor left" 22545msgstr "" 22546 22547#: lazarusidestrconsts.srkmeclinebreak 22548msgid "Break line and move cursor" 22549msgstr "Breek lijn, en verplaats cursor" 22550 22551#: lazarusidestrconsts.srkmeclineend 22552msgid "Move cursor to line end" 22553msgstr "Verplaats cursor naar regeleinde" 22554 22555#: lazarusidestrconsts.srkmeclineselect 22556msgid "Line selection mode" 22557msgstr "Regelselectie mode" 22558 22559#: lazarusidestrconsts.srkmeclinestart 22560msgid "Move cursor to line start" 22561msgstr "Verplaats cursor naar regelbegin" 22562 22563#: lazarusidestrconsts.srkmeclinetextstart 22564msgid "Move cursor to text start in line" 22565msgstr "" 22566 22567#: lazarusidestrconsts.srkmeclockeditor 22568msgid "Lock Editor" 22569msgstr "" 22570 22571#: lazarusidestrconsts.srkmecmakeresourcestring 22572#, fuzzy 22573#| msgid "Make resource string" 22574msgid "Make Resource String" 22575msgstr "Maak resource string" 22576 22577#: lazarusidestrconsts.srkmecmatchbracket 22578msgid "Go to matching bracket" 22579msgstr "Ga naar bijpassende haak" 22580 22581#: lazarusidestrconsts.srkmecmoveeditorleft 22582msgid "Move editor left" 22583msgstr "Editor naar links" 22584 22585#: lazarusidestrconsts.srkmecmoveeditorleftmost 22586msgid "Move editor leftmost" 22587msgstr "" 22588 22589#: lazarusidestrconsts.srkmecmoveeditornewwindow 22590msgid "Move editor to new window" 22591msgstr "" 22592 22593#: lazarusidestrconsts.srkmecmoveeditornextwindow 22594msgid "Move editor to next free window" 22595msgstr "" 22596 22597#: lazarusidestrconsts.srkmecmoveeditorprevwindow 22598msgid "Move editor to prior free window" 22599msgstr "" 22600 22601#: lazarusidestrconsts.srkmecmoveeditorright 22602msgid "Move editor right" 22603msgstr "Editor naar rechts" 22604 22605#: lazarusidestrconsts.srkmecmoveeditorrightmost 22606msgid "Move editor rightmost" 22607msgstr "" 22608 22609#: lazarusidestrconsts.srkmecmovelinedown 22610msgid "Move line down" 22611msgstr "" 22612 22613#: lazarusidestrconsts.srkmecmovelineup 22614msgid "Move line up" 22615msgstr "" 22616 22617#: lazarusidestrconsts.srkmecmoveselectdown 22618msgid "Move selection down" 22619msgstr "" 22620 22621#: lazarusidestrconsts.srkmecmoveselectleft 22622msgid "Move selection left" 22623msgstr "" 22624 22625#: lazarusidestrconsts.srkmecmoveselectright 22626msgid "Move selection right" 22627msgstr "" 22628 22629#: lazarusidestrconsts.srkmecmoveselectup 22630msgid "Move selection up" 22631msgstr "" 22632 22633#: lazarusidestrconsts.srkmecmultipaste 22634msgctxt "lazarusidestrconsts.srkmecmultipaste" 22635msgid "MultiPaste" 22636msgstr "" 22637 22638#: lazarusidestrconsts.srkmecnextbookmark 22639msgid "Next Bookmark" 22640msgstr "Volgend bookmark" 22641 22642#: lazarusidestrconsts.srkmecnexteditor 22643msgid "Go to next editor" 22644msgstr "Ga naar volgende tekstverwerker" 22645 22646#: lazarusidestrconsts.srkmecnexteditorinhistory 22647msgid "Go to next editor in history" 22648msgstr "" 22649 22650#: lazarusidestrconsts.srkmecnextsharededitor 22651msgid "Go to next editor with same Source" 22652msgstr "" 22653 22654#: lazarusidestrconsts.srkmecnextwindow 22655msgid "Go to next window" 22656msgstr "" 22657 22658#: lazarusidestrconsts.srkmecnormalselect 22659msgid "Normal selection mode" 22660msgstr "Normale selectie modus" 22661 22662#: lazarusidestrconsts.srkmecopenfileatcursor 22663#, fuzzy 22664#| msgid "Open file at cursor" 22665msgid "Open File at Cursor" 22666msgstr "Open bestand (op cursor)" 22667 22668#: lazarusidestrconsts.srkmecoverwritemode 22669msgid "Overwrite Mode" 22670msgstr "Overschrijf mode" 22671 22672#: lazarusidestrconsts.srkmecpagebottom 22673msgid "Move cursor to bottom of page" 22674msgstr "Verplaats cursor naar de onderkant van de pagina" 22675 22676#: lazarusidestrconsts.srkmecpagedown 22677msgid "Move cursor down one page" 22678msgstr "Verplaats cursor een pagina omlaag" 22679 22680#: lazarusidestrconsts.srkmecpageleft 22681msgid "Move cursor left one page" 22682msgstr "Verplaats cursor een pagina naar links" 22683 22684#: lazarusidestrconsts.srkmecpageright 22685msgid "Move cursor right one page" 22686msgstr "Verplaats cursor een pagina naar rechts" 22687 22688#: lazarusidestrconsts.srkmecpagetop 22689msgid "Move cursor to top of page" 22690msgstr "Verplaats cursor naar de top van de pagina" 22691 22692#: lazarusidestrconsts.srkmecpageup 22693msgid "Move cursor up one page" 22694msgstr "Verplaats cursor een pagina omhoog" 22695 22696#: lazarusidestrconsts.srkmecpaste 22697#, fuzzy 22698#| msgid "Paste clipboard to current position" 22699msgctxt "lazarusidestrconsts.srkmecpaste" 22700msgid "Paste" 22701msgstr "Plak klembord op de huidige positie" 22702 22703#: lazarusidestrconsts.srkmecpasteascolumns 22704msgid "Paste (as Columns)" 22705msgstr "" 22706 22707#: lazarusidestrconsts.srkmecpause 22708msgid "pause program" 22709msgstr "pauzeer programma" 22710 22711#: lazarusidestrconsts.srkmecpluginmulticaretclearall 22712msgid "Clear all extra carets" 22713msgstr "" 22714 22715#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove 22716msgid "Cursor keys clear all extra carets" 22717msgstr "" 22718 22719#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall 22720msgid "Cursor keys move all extra carets" 22721msgstr "" 22722 22723#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret 22724msgid "Add extra caret" 22725msgstr "" 22726 22727#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret 22728msgid "Toggle extra caret" 22729msgstr "" 22730 22731#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret 22732msgid "Remove extra caret" 22733msgstr "" 22734 22735#: lazarusidestrconsts.srkmecprevbookmark 22736msgid "Previous Bookmark" 22737msgstr "Vorig Bookmark" 22738 22739#: lazarusidestrconsts.srkmecpreveditor 22740msgid "Go to prior editor" 22741msgstr "Ga naar vorige tekstverwerker" 22742 22743#: lazarusidestrconsts.srkmecpreveditorinhistory 22744msgid "Go to previous editor in history" 22745msgstr "" 22746 22747#: lazarusidestrconsts.srkmecprevsharededitor 22748msgid "Go to prior editor with same Source" 22749msgstr "" 22750 22751#: lazarusidestrconsts.srkmecprevwindow 22752msgid "Go to prior window" 22753msgstr "" 22754 22755#: lazarusidestrconsts.srkmecquickcompile 22756msgid "quick compile, no linking" 22757msgstr "Snel-compilatie, geen linking" 22758 22759#: lazarusidestrconsts.srkmecremovebreakpoint 22760#, fuzzy 22761#| msgid "remove break point" 22762msgid "remove breakpoint" 22763msgstr "verwijder breekpunt" 22764 22765#: lazarusidestrconsts.srkmecremoveemptymethods 22766msgid "Remove Empty Methods" 22767msgstr "" 22768 22769#: lazarusidestrconsts.srkmecremoveunusedunits 22770msgid "Remove Unused Units" 22771msgstr "" 22772 22773#: lazarusidestrconsts.srkmecrenameidentifier 22774#, fuzzy 22775#| msgid "Rename identifier" 22776msgid "Rename Identifier" 22777msgstr "Hernoem identifier" 22778 22779#: lazarusidestrconsts.srkmecreplace 22780#, fuzzy 22781#| msgid "Replace text" 22782msgid "Replace Text" 22783msgstr "Vervang tekst" 22784 22785#: lazarusidestrconsts.srkmecreportingbug 22786msgctxt "lazarusidestrconsts.srkmecreportingbug" 22787msgid "Reporting a bug" 22788msgstr "" 22789 22790#: lazarusidestrconsts.srkmecresetdebugger 22791msgid "reset debugger" 22792msgstr "reset debugger" 22793 22794#: lazarusidestrconsts.srkmecright 22795msgid "Move cursor right" 22796msgstr "" 22797 22798#: lazarusidestrconsts.srkmecrun 22799msgid "run program" 22800msgstr "voer programma uit" 22801 22802#: lazarusidestrconsts.srkmecrunfile 22803msgid "run file" 22804msgstr "voer bestand uit" 22805 22806#: lazarusidestrconsts.srkmecrunparameters 22807msgid "run parameters" 22808msgstr "uitvoer parameters" 22809 22810#: lazarusidestrconsts.srkmecrunwithoutdebugging 22811msgid "run without debugging" 22812msgstr "" 22813 22814#: lazarusidestrconsts.srkmecscrolldown 22815msgid "Scroll down one line" 22816msgstr "Scroll een regel naar beneden" 22817 22818#: lazarusidestrconsts.srkmecscrollleft 22819msgid "Scroll left one char" 22820msgstr "Scroll een karakter naar links" 22821 22822#: lazarusidestrconsts.srkmecscrollright 22823msgid "Scroll right one char" 22824msgstr "Scroll een karakter naar rechts" 22825 22826#: lazarusidestrconsts.srkmecscrollup 22827msgid "Scroll up one line" 22828msgstr "Scroll een regel omhoog" 22829 22830#: lazarusidestrconsts.srkmecseldown 22831msgid "Select Down" 22832msgstr "Selecteer naar beneden" 22833 22834#: lazarusidestrconsts.srkmecselectall 22835msgctxt "lazarusidestrconsts.srkmecselectall" 22836msgid "Select All" 22837msgstr "Selecteer Alles" 22838 22839#: lazarusidestrconsts.srkmecselectiontabs2spaces 22840msgid "Convert tabs to spaces in selection" 22841msgstr "Converteer tabs naar spaties in selectie" 22842 22843#: lazarusidestrconsts.srkmecseleditorbottom 22844msgid "Select to absolute end" 22845msgstr "Selecteer tot eind" 22846 22847#: lazarusidestrconsts.srkmecseleditortop 22848msgid "Select to absolute beginning" 22849msgstr "Selecteer tot begin" 22850 22851#: lazarusidestrconsts.srkmecselgotoxy 22852msgid "Select Goto XY" 22853msgstr "Selecteer Goto XY" 22854 22855#: lazarusidestrconsts.srkmecselhalfwordleft 22856msgid "Select part-word left (e.g. CamelCase)" 22857msgstr "" 22858 22859#: lazarusidestrconsts.srkmecselhalfwordright 22860msgid "Select part-word right (e.g. CamelCase)" 22861msgstr "" 22862 22863#: lazarusidestrconsts.srkmecselleft 22864#, fuzzy 22865#| msgid "SelLeft" 22866msgid "Select Left" 22867msgstr "SelLinks" 22868 22869#: lazarusidestrconsts.srkmecsellineend 22870msgctxt "lazarusidestrconsts.srkmecsellineend" 22871msgid "Select Line End" 22872msgstr "Selecteer regel einde" 22873 22874#: lazarusidestrconsts.srkmecsellinestart 22875msgctxt "lazarusidestrconsts.srkmecsellinestart" 22876msgid "Select Line Start" 22877msgstr "Selecteer regel begin" 22878 22879#: lazarusidestrconsts.srkmecsellinetextstart 22880msgid "Select to text start in line" 22881msgstr "" 22882 22883#: lazarusidestrconsts.srkmecselpagebottom 22884msgctxt "lazarusidestrconsts.srkmecselpagebottom" 22885msgid "Select Page Bottom" 22886msgstr "Selecteer onderkant Pagina" 22887 22888#: lazarusidestrconsts.srkmecselpagedown 22889msgid "Select Page Down" 22890msgstr "Selecteer pagina naar beneden" 22891 22892#: lazarusidestrconsts.srkmecselpageleft 22893msgid "Select Page Left" 22894msgstr "Selecteer pagina Links" 22895 22896#: lazarusidestrconsts.srkmecselpageright 22897msgid "Select Page Right" 22898msgstr "Selecteer pagina rechts" 22899 22900#: lazarusidestrconsts.srkmecselpagetop 22901msgctxt "lazarusidestrconsts.srkmecselpagetop" 22902msgid "Select Page Top" 22903msgstr "Select bovenkant pagina" 22904 22905#: lazarusidestrconsts.srkmecselpageup 22906msgid "Select Page Up" 22907msgstr "Selecteer pagina omhoog" 22908 22909#: lazarusidestrconsts.srkmecselright 22910#, fuzzy 22911#| msgid "SelRight" 22912msgid "Select Right" 22913msgstr "SelRechts" 22914 22915#: lazarusidestrconsts.srkmecselsmartwordleft 22916msgid "Smart select word left (start/end of word)" 22917msgstr "" 22918 22919#: lazarusidestrconsts.srkmecselsmartwordright 22920msgid "Smart select word right (start/end of word)" 22921msgstr "" 22922 22923#: lazarusidestrconsts.srkmecselsticky 22924msgid "Start sticky selecting" 22925msgstr "" 22926 22927#: lazarusidestrconsts.srkmecselstickycol 22928msgid "Start sticky selecting (Columns)" 22929msgstr "" 22930 22931#: lazarusidestrconsts.srkmecselstickyline 22932msgid "Start sticky selecting (Line)" 22933msgstr "" 22934 22935#: lazarusidestrconsts.srkmecselstickystop 22936msgid "Stop sticky selecting" 22937msgstr "" 22938 22939#: lazarusidestrconsts.srkmecselup 22940msgid "Select Up" 22941msgstr "Selecteer omhoog" 22942 22943#: lazarusidestrconsts.srkmecselwordendleft 22944msgid "Select word-end left" 22945msgstr "" 22946 22947#: lazarusidestrconsts.srkmecselwordendright 22948msgid "Select word-end right" 22949msgstr "" 22950 22951#: lazarusidestrconsts.srkmecselwordleft 22952msgctxt "lazarusidestrconsts.srkmecselwordleft" 22953msgid "Select Word Left" 22954msgstr "Selecteer linker woord" 22955 22956#: lazarusidestrconsts.srkmecselwordright 22957msgctxt "lazarusidestrconsts.srkmecselwordright" 22958msgid "Select Word Right" 22959msgstr "Selecteer rechter woord" 22960 22961#: lazarusidestrconsts.srkmecsetfreebookmark 22962msgctxt "lazarusidestrconsts.srkmecsetfreebookmark" 22963msgid "Set a free Bookmark" 22964msgstr "" 22965 22966#: lazarusidestrconsts.srkmecsetmarker 22967#, object-pascal-format, fuzzy 22968#| msgid "Set Marker %d" 22969msgid "Set bookmark %d" 22970msgstr "Zet markering %d" 22971 22972#: lazarusidestrconsts.srkmecshifttab 22973msgid "Shift Tab" 22974msgstr "Shift Tab" 22975 22976#: lazarusidestrconsts.srkmecshowabstractmethods 22977msgid "Show Abstract Methods" 22978msgstr "" 22979 22980#: lazarusidestrconsts.srkmecshowcodecontext 22981#, fuzzy 22982#| msgid "Show code context" 22983msgid "Show Code Context" 22984msgstr "Toon code samenhang" 22985 22986#: lazarusidestrconsts.srkmecshowexecutionpoint 22987msgid "show execution point" 22988msgstr "" 22989 22990#: lazarusidestrconsts.srkmecsmartwordleft 22991msgid "Smart move cursor left (start/end of word)" 22992msgstr "" 22993 22994#: lazarusidestrconsts.srkmecsmartwordright 22995msgid "Smart move cursor right (start/end of word)" 22996msgstr "" 22997 22998#: lazarusidestrconsts.srkmecstopprogram 22999msgid "stop program" 23000msgstr "Stop programma" 23001 23002#: lazarusidestrconsts.srkmecsynmacroplay 23003msgid "Play Macro" 23004msgstr "" 23005 23006#: lazarusidestrconsts.srkmecsynmacrorecord 23007msgid "Record Macro" 23008msgstr "" 23009 23010#: lazarusidestrconsts.srkmecsynpsyncroedcellend 23011msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend" 23012msgid "Goto last pos in cell" 23013msgstr "" 23014 23015#: lazarusidestrconsts.srkmecsynpsyncroedcellhome 23016msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome" 23017msgid "Goto first pos in cell" 23018msgstr "" 23019 23020#: lazarusidestrconsts.srkmecsynpsyncroedcellselect 23021msgid "Select Cell" 23022msgstr "" 23023 23024#: lazarusidestrconsts.srkmecsynpsyncroedescape 23025msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape" 23026msgid "Escape" 23027msgstr "" 23028 23029#: lazarusidestrconsts.srkmecsynpsyncroednextcell 23030msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell" 23031msgid "Next Cell" 23032msgstr "" 23033 23034#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel 23035msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel" 23036msgid "Next Cell (all selected)" 23037msgstr "" 23038 23039#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell 23040msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell" 23041msgid "Next Cell (firsts only)" 23042msgstr "" 23043 23044#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel 23045msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel" 23046msgid "Next Cell (all selected / firsts only)" 23047msgstr "" 23048 23049#: lazarusidestrconsts.srkmecsynpsyncroedprevcell 23050msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell" 23051msgid "Previous Cell" 23052msgstr "" 23053 23054#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel 23055msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel" 23056msgid "Previous Cell (all selected)" 23057msgstr "" 23058 23059#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell 23060msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell" 23061msgid "Previous Cell (firsts only)" 23062msgstr "" 23063 23064#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel 23065msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel" 23066msgid "Previous Cell (all selected / firsts only)" 23067msgstr "" 23068 23069#: lazarusidestrconsts.srkmecsynpsyncroedstart 23070msgid "Start Syncro edit" 23071msgstr "" 23072 23073#: lazarusidestrconsts.srkmecsynptmpledcellend 23074msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend" 23075msgid "Goto last pos in cell" 23076msgstr "" 23077 23078#: lazarusidestrconsts.srkmecsynptmpledcellhome 23079msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome" 23080msgid "Goto first pos in cell" 23081msgstr "" 23082 23083#: lazarusidestrconsts.srkmecsynptmpledcellselect 23084msgid "Select cell" 23085msgstr "" 23086 23087#: lazarusidestrconsts.srkmecsynptmpledescape 23088msgctxt "lazarusidestrconsts.srkmecsynptmpledescape" 23089msgid "Escape" 23090msgstr "" 23091 23092#: lazarusidestrconsts.srkmecsynptmpledfinish 23093msgid "Finish" 23094msgstr "" 23095 23096#: lazarusidestrconsts.srkmecsynptmplednextcell 23097msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell" 23098msgid "Next Cell" 23099msgstr "" 23100 23101#: lazarusidestrconsts.srkmecsynptmplednextcellrotate 23102msgid "Next Cell (rotate)" 23103msgstr "" 23104 23105#: lazarusidestrconsts.srkmecsynptmplednextcellsel 23106msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel" 23107msgid "Next Cell (all selected)" 23108msgstr "" 23109 23110#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate 23111msgid "Next Cell (rotate / all selected)" 23112msgstr "" 23113 23114#: lazarusidestrconsts.srkmecsynptmplednextfirstcell 23115msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell" 23116msgid "Next Cell (firsts only)" 23117msgstr "" 23118 23119#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate 23120msgid "Next Cell (rotate / firsts only)" 23121msgstr "" 23122 23123#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel 23124msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel" 23125msgid "Next Cell (all selected / firsts only)" 23126msgstr "" 23127 23128#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate 23129msgid "Next Cell (rotate / all selected / firsts only)" 23130msgstr "" 23131 23132#: lazarusidestrconsts.srkmecsynptmpledprevcell 23133msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell" 23134msgid "Previous Cell" 23135msgstr "" 23136 23137#: lazarusidestrconsts.srkmecsynptmpledprevcellsel 23138msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel" 23139msgid "Previous Cell (all selected)" 23140msgstr "" 23141 23142#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell 23143msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell" 23144msgid "Previous Cell (firsts only)" 23145msgstr "" 23146 23147#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel 23148msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel" 23149msgid "Previous Cell (all selected / firsts only)" 23150msgstr "" 23151 23152#: lazarusidestrconsts.srkmecsyntaxcheck 23153#, fuzzy 23154#| msgid "Syntax check" 23155msgid "Syntax Check" 23156msgstr "Syntax controleren" 23157 23158#: lazarusidestrconsts.srkmectoggleassembler 23159msgid "View assembler" 23160msgstr "" 23161 23162#: lazarusidestrconsts.srkmectogglebreakpoint 23163msgid "toggle breakpoint" 23164msgstr "" 23165 23166#: lazarusidestrconsts.srkmectogglebreakpointenabled 23167msgid "enable/disable breakpoint" 23168msgstr "" 23169 23170#: lazarusidestrconsts.srkmectogglebreakpoints 23171msgid "View breakpoints" 23172msgstr "Toon Breekpunten" 23173 23174#: lazarusidestrconsts.srkmectogglecallstack 23175msgid "View call stack" 23176msgstr "Toon Call Stack" 23177 23178#: lazarusidestrconsts.srkmectogglecodebrowser 23179msgid "View code browser" 23180msgstr "" 23181 23182#: lazarusidestrconsts.srkmectogglecodeexpl 23183msgid "View Code Explorer" 23184msgstr "Toon Code Verkenner" 23185 23186#: lazarusidestrconsts.srkmectogglecomppalette 23187msgid "View component palette" 23188msgstr "Toon component palette" 23189 23190#: lazarusidestrconsts.srkmectoggledebuggerout 23191msgid "View debugger output" 23192msgstr "Toon Debugger output " 23193 23194#: lazarusidestrconsts.srkmectoggleformunit 23195msgid "Switch between form and unit" 23196msgstr "Schakel tussen form en unit" 23197 23198#: lazarusidestrconsts.srkmectogglefpdoceditor 23199msgid "View Documentation Editor" 23200msgstr "" 23201 23202#: lazarusidestrconsts.srkmectoggleidespeedbtns 23203msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns" 23204msgid "View IDE speed buttons" 23205msgstr "Toon IDE speed buttons" 23206 23207#: lazarusidestrconsts.srkmectogglelocals 23208msgid "View local variables" 23209msgstr "Toon lokale variabelen" 23210 23211#: lazarusidestrconsts.srkmectogglemarker 23212#, object-pascal-format 23213msgid "Toggle bookmark %d" 23214msgstr "" 23215 23216#: lazarusidestrconsts.srkmectogglemarkupword 23217msgid "Toggle Current-Word highlight" 23218msgstr "" 23219 23220#: lazarusidestrconsts.srkmectogglemessages 23221msgid "View messages" 23222msgstr "Toon Berichten" 23223 23224#: lazarusidestrconsts.srkmectogglemode 23225msgid "Toggle Mode" 23226msgstr "Wissel mode" 23227 23228#: lazarusidestrconsts.srkmectoggleobjectinsp 23229msgid "View Object Inspector" 23230msgstr "Toon Object Inspecteur" 23231 23232#: lazarusidestrconsts.srkmectoggleregisters 23233msgid "View registers" 23234msgstr "" 23235 23236#: lazarusidestrconsts.srkmectogglerestrictionbrowser 23237msgid "View restriction browser" 23238msgstr "" 23239 23240#: lazarusidestrconsts.srkmectogglesearchresults 23241msgid "View Search Results" 23242msgstr "Toon zoek resultaten" 23243 23244#: lazarusidestrconsts.srkmectogglesourceeditor 23245msgid "View Source Editor" 23246msgstr "Toon Broncode Bewerker" 23247 23248#: lazarusidestrconsts.srkmectogglewatches 23249msgid "View watches" 23250msgstr "Toon Watches" 23251 23252#: lazarusidestrconsts.srkmecunfoldall 23253msgctxt "lazarusidestrconsts.srkmecunfoldall" 23254msgid "Unfold all" 23255msgstr "" 23256 23257#: lazarusidestrconsts.srkmecunfoldcurrent 23258msgid "Unfold at Cursor" 23259msgstr "" 23260 23261#: lazarusidestrconsts.srkmecunknown 23262msgid "unknown editor command" 23263msgstr "Onbekend bewerker-commando" 23264 23265#: lazarusidestrconsts.srkmecunusedunits 23266msgid "Unused Units ..." 23267msgstr "" 23268 23269#: lazarusidestrconsts.srkmecup 23270msgid "Move cursor up" 23271msgstr "" 23272 23273#: lazarusidestrconsts.srkmecviewanchoreditor 23274msgid "View anchor editor" 23275msgstr "Toon anker bewerker" 23276 23277#: lazarusidestrconsts.srkmecviewcomponents 23278msgid "View components" 23279msgstr "" 23280 23281#: lazarusidestrconsts.srkmecvieweditormacros 23282msgid "View editor macros" 23283msgstr "" 23284 23285#: lazarusidestrconsts.srkmecviewforms 23286msgid "View forms" 23287msgstr "Toon Forms" 23288 23289#: lazarusidestrconsts.srkmecviewhistory 23290msgctxt "lazarusidestrconsts.srkmecviewhistory" 23291msgid "View History" 23292msgstr "" 23293 23294#: lazarusidestrconsts.srkmecviewpseudoterminal 23295msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal" 23296msgid "View console in/output" 23297msgstr "" 23298 23299#: lazarusidestrconsts.srkmecviewtaborder 23300msgid "View Tab Order" 23301msgstr "" 23302 23303#: lazarusidestrconsts.srkmecviewthreads 23304msgctxt "lazarusidestrconsts.srkmecviewthreads" 23305msgid "View Threads" 23306msgstr "" 23307 23308#: lazarusidestrconsts.srkmecviewunitdependencies 23309msgid "View unit dependencies" 23310msgstr "Toon Unit Afhankelijkheden" 23311 23312#: lazarusidestrconsts.srkmecviewunitinfo 23313msgid "View unit information" 23314msgstr "Toon Unit informatie" 23315 23316#: lazarusidestrconsts.srkmecviewunits 23317msgid "View units" 23318msgstr "Toon Units" 23319 23320#: lazarusidestrconsts.srkmecwordcompletion 23321#, fuzzy 23322#| msgid "Word completion" 23323msgid "Word Completion" 23324msgstr "Woord completering" 23325 23326#: lazarusidestrconsts.srkmecwordendleft 23327msgid "Move cursor word-end left" 23328msgstr "" 23329 23330#: lazarusidestrconsts.srkmecwordendright 23331msgid "Move cursor word-end right" 23332msgstr "" 23333 23334#: lazarusidestrconsts.srkmecwordleft 23335msgid "Move cursor word left" 23336msgstr "Verplaats cursor een woord naar links" 23337 23338#: lazarusidestrconsts.srkmecwordright 23339msgid "Move cursor word right" 23340msgstr "Verplaats cursor een woord naar rechts" 23341 23342#: lazarusidestrconsts.srkmeczoomin 23343msgid "Zoom in" 23344msgstr "" 23345 23346#: lazarusidestrconsts.srkmeczoomout 23347msgid "Zoom out" 23348msgstr "" 23349 23350#: lazarusidestrconsts.srkmeditforcmd 23351msgid "Edit keys of command" 23352msgstr "" 23353 23354#: lazarusidestrconsts.synfcontinuewithnextmouseupaction 23355msgid "Continue with next mouse up action" 23356msgstr "" 23357 23358#: lazarusidestrconsts.synffoldcomments 23359msgid "Fold comments" 23360msgstr "" 23361 23362#: lazarusidestrconsts.synffoldcommentsinselection 23363msgid "Fold comments in selection" 23364msgstr "" 23365 23366#: lazarusidestrconsts.synffoldinactiveifdef 23367msgid "Fold inactive Ifdef" 23368msgstr "" 23369 23370#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate 23371msgid "Fold inactive Ifdef (exclude mixed state)" 23372msgstr "" 23373 23374#: lazarusidestrconsts.synffoldinactiveifdefinselection 23375msgid "Fold inactive Ifdef in selection" 23376msgstr "" 23377 23378#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate 23379msgid "Fold inactive Ifdef in selection (exclude mixed state)" 23380msgstr "" 23381 23382#: lazarusidestrconsts.synfhidecomments 23383msgid "Hide comments" 23384msgstr "" 23385 23386#: lazarusidestrconsts.synfhidecommentsinselection 23387msgid "Hide comments in selection" 23388msgstr "" 23389 23390#: lazarusidestrconsts.synfmatchactionbuttonofmousedown 23391msgid "Match action button of mouse down" 23392msgstr "" 23393 23394#: lazarusidestrconsts.synfmatchactionlineofmousedown 23395msgid "Match action line of mouse down" 23396msgstr "" 23397 23398#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown 23399msgid "Match action modifiers of mouse down" 23400msgstr "" 23401 23402#: lazarusidestrconsts.synfmatchactionposofmousedown 23403msgid "Match action pos of mouse down" 23404msgstr "" 23405 23406#: lazarusidestrconsts.synfsearchallactionofmousedown 23407msgid "Search all action of mouse down" 23408msgstr "" 23409 23410#: lazarusidestrconsts.synfunfoldactiveifdef 23411msgid "Unfold active Ifdef" 23412msgstr "" 23413 23414#: lazarusidestrconsts.synfunfoldactiveifdefinselection 23415msgid "Unfold active Ifdef in selection" 23416msgstr "" 23417 23418#: lazarusidestrconsts.synfunfoldall 23419msgctxt "lazarusidestrconsts.synfunfoldall" 23420msgid "Unfold all" 23421msgstr "" 23422 23423#: lazarusidestrconsts.synfunfoldallifdef 23424msgid "Unfold all Ifdef" 23425msgstr "" 23426 23427#: lazarusidestrconsts.synfunfoldallifdefinselection 23428msgid "Unfold all Ifdef in selection" 23429msgstr "" 23430 23431#: lazarusidestrconsts.synfunfoldallinselection 23432msgid "Unfold all in selection" 23433msgstr "" 23434 23435#: lazarusidestrconsts.synfunfoldcomments 23436msgid "Unfold comments" 23437msgstr "" 23438 23439#: lazarusidestrconsts.synfunfoldcommentsinselection 23440msgid "Unfold comments in selection" 23441msgstr "" 23442 23443#: lazarusidestrconsts.synfunfoldinactiveifdef 23444msgid "Unfold inactive Ifdef" 23445msgstr "" 23446 23447#: lazarusidestrconsts.synfunfoldinactiveifdefinselection 23448msgid "Unfold inactive Ifdef in selection" 23449msgstr "" 23450 23451#: lazarusidestrconsts.uefilerocap 23452msgid "File is readonly" 23453msgstr "Bestand is alleen-lezen" 23454 23455#: lazarusidestrconsts.uefilerotext1 23456msgid "The file \"" 23457msgstr "Het bestand \"" 23458 23459#: lazarusidestrconsts.uefilerotext2 23460msgid "\" is not writable." 23461msgstr "\" is niet beschrijfbaar." 23462 23463#: lazarusidestrconsts.uelocked 23464msgid "Locked" 23465msgstr "" 23466 23467#: lazarusidestrconsts.uemacrorecording 23468msgid "Recording" 23469msgstr "" 23470 23471#: lazarusidestrconsts.uemacrorecordingpaused 23472msgid "Rec-pause" 23473msgstr "" 23474 23475#: lazarusidestrconsts.uemaddwatchatcursor 23476msgid "Add &Watch At Cursor" 23477msgstr "&Kijk op positie cursor toevoegen" 23478 23479#: lazarusidestrconsts.uemaddwatchpointatcursor 23480msgid "Add Watch&Point At Cursor" 23481msgstr "" 23482 23483#: lazarusidestrconsts.uembookmarknset 23484#, object-pascal-format 23485msgid "Bookmark &%s: %s" 23486msgstr "" 23487 23488#: lazarusidestrconsts.uembookmarknunset 23489#, object-pascal-format 23490msgid "Bookmark &%s" 23491msgstr "" 23492 23493#: lazarusidestrconsts.uembookmarknunsetdisabled 23494#, object-pascal-format 23495msgid "Bookmark %s" 23496msgstr "" 23497 23498#: lazarusidestrconsts.uemcloseotherpages 23499msgid "Close All &Other Pages" 23500msgstr "" 23501 23502#: lazarusidestrconsts.uemcloseotherpagesplain 23503msgid "Close All Other Pages" 23504msgstr "" 23505 23506#: lazarusidestrconsts.uemcloseotherpagesright 23507msgid "Close Pages on the &Right" 23508msgstr "" 23509 23510#: lazarusidestrconsts.uemcloseotherpagesrightplain 23511msgid "Close Pages on the Right" 23512msgstr "" 23513 23514#: lazarusidestrconsts.uemclosepage 23515msgid "&Close Page" 23516msgstr "&Sluit Pagina" 23517 23518#: lazarusidestrconsts.uemcopyfilename 23519#, fuzzy 23520#| msgid "Copy filename" 23521msgid "Copy Filename" 23522msgstr "Kopieer bestandsnaam" 23523 23524#: lazarusidestrconsts.uemcopytonewwindow 23525msgid "Clone to New Window" 23526msgstr "" 23527 23528#: lazarusidestrconsts.uemcopytootherwindow 23529msgid "Clone to Other Window" 23530msgstr "" 23531 23532#: lazarusidestrconsts.uemcopytootherwindownew 23533msgctxt "lazarusidestrconsts.uemcopytootherwindownew" 23534msgid "New Window" 23535msgstr "" 23536 23537#: lazarusidestrconsts.uemdebugword 23538msgctxt "lazarusidestrconsts.uemdebugword" 23539msgid "Debug" 23540msgstr "Debug" 23541 23542#: lazarusidestrconsts.uemencoding 23543msgid "Encoding" 23544msgstr "" 23545 23546#: lazarusidestrconsts.uemevaluatemodify 23547msgid "&Evaluate/Modify ..." 23548msgstr "" 23549 23550#: lazarusidestrconsts.uemfinddeclaration 23551msgid "&Find Declaration" 23552msgstr "&Zoek declaratie" 23553 23554#: lazarusidestrconsts.uemfindinotherwindow 23555msgid "Find in other Window" 23556msgstr "" 23557 23558#: lazarusidestrconsts.uemgotobookmark 23559msgid "&Goto Bookmark" 23560msgstr "&Ga naar bladwijzer" 23561 23562#: lazarusidestrconsts.uemgotobookmarks 23563msgid "Goto Bookmark ..." 23564msgstr "" 23565 23566#: lazarusidestrconsts.uemhighlighter 23567msgid "Highlighter" 23568msgstr "" 23569 23570#: lazarusidestrconsts.ueminspect 23571#, fuzzy 23572msgctxt "lazarusidestrconsts.ueminspect" 23573msgid "&Inspect ..." 23574msgstr "Inspecteer ..." 23575 23576#: lazarusidestrconsts.ueminvertassignment 23577#, fuzzy 23578msgctxt "lazarusidestrconsts.ueminvertassignment" 23579msgid "Invert Assignment" 23580msgstr "Draai toekenning om" 23581 23582#: lazarusidestrconsts.uemlineending 23583msgid "Line Ending" 23584msgstr "" 23585 23586#: lazarusidestrconsts.uemlockpage 23587msgid "&Lock Page" 23588msgstr "" 23589 23590#: lazarusidestrconsts.uemmovepageleft 23591msgid "Move Page Left" 23592msgstr "" 23593 23594#: lazarusidestrconsts.uemmovepageleftmost 23595msgid "Move Page Leftmost" 23596msgstr "" 23597 23598#: lazarusidestrconsts.uemmovepageright 23599msgid "Move Page Right" 23600msgstr "" 23601 23602#: lazarusidestrconsts.uemmovepagerightmost 23603msgid "Move Page Rightmost" 23604msgstr "" 23605 23606#: lazarusidestrconsts.uemmovetonewwindow 23607msgid "Move to New Window" 23608msgstr "" 23609 23610#: lazarusidestrconsts.uemmovetootherwindow 23611msgid "Move to Other Window" 23612msgstr "" 23613 23614#: lazarusidestrconsts.uemmovetootherwindownew 23615msgctxt "lazarusidestrconsts.uemmovetootherwindownew" 23616msgid "New Window" 23617msgstr "" 23618 23619#: lazarusidestrconsts.uemnextbookmark 23620#, fuzzy 23621#| msgid "Goto next Bookmark" 23622msgid "Goto Next Bookmark" 23623msgstr "Ga naar volgend Bookmark" 23624 23625#: lazarusidestrconsts.uemodified 23626msgid "Modified" 23627msgstr "Gewijzigd" 23628 23629#: lazarusidestrconsts.uemopenfileatcursor 23630#, fuzzy 23631#| msgid "&Open file at cursor" 23632msgid "&Open File at Cursor" 23633msgstr "&Open bestand op positie van cursor" 23634 23635#: lazarusidestrconsts.uemprevbookmark 23636#, fuzzy 23637#| msgid "Goto previous Bookmark" 23638msgid "Goto Previous Bookmark" 23639msgstr "Ga naar vorig Bookmark" 23640 23641#: lazarusidestrconsts.uemprocedurejump 23642msgid "Procedure Jump" 23643msgstr "Procedure sprong" 23644 23645#: lazarusidestrconsts.uemreadonly 23646msgctxt "lazarusidestrconsts.uemreadonly" 23647msgid "Read Only" 23648msgstr "Niet wijzigbaar" 23649 23650#: lazarusidestrconsts.uemrefactor 23651msgid "Refactoring" 23652msgstr "Refactoring" 23653 23654#: lazarusidestrconsts.uemsetfreebookmark 23655#, fuzzy 23656#| msgid "Set a free Bookmark" 23657msgctxt "lazarusidestrconsts.uemsetfreebookmark" 23658msgid "Set a Free Bookmark" 23659msgstr "Plaats een beschikbaar Bookmark" 23660 23661#: lazarusidestrconsts.uemshowlinenumbers 23662msgid "Show Line Numbers" 23663msgstr "Toon regelnummers" 23664 23665#: lazarusidestrconsts.uemsource 23666msgctxt "lazarusidestrconsts.uemsource" 23667msgid "Source" 23668msgstr "" 23669 23670#: lazarusidestrconsts.uemtogglebookmark 23671msgid "&Toggle Bookmark" 23672msgstr "" 23673 23674#: lazarusidestrconsts.uemtogglebookmarknset 23675#, object-pascal-format 23676msgid "Toggle Bookmark &%s: %s" 23677msgstr "" 23678 23679#: lazarusidestrconsts.uemtogglebookmarknunset 23680#, object-pascal-format 23681msgid "Toggle Bookmark &%s" 23682msgstr "" 23683 23684#: lazarusidestrconsts.uemtogglebookmarks 23685msgid "Toggle Bookmark ..." 23686msgstr "" 23687 23688#: lazarusidestrconsts.uemtogglebreakpoint 23689msgid "Toggle &Breakpoint" 23690msgstr "" 23691 23692#: lazarusidestrconsts.uemviewcallstack 23693msgctxt "lazarusidestrconsts.uemviewcallstack" 23694msgid "View Call Stack" 23695msgstr "Toon Call Stack" 23696 23697#: lazarusidestrconsts.uenotimplcap 23698msgid "Not implemented yet" 23699msgstr "Nog niet geimplementeerd" 23700 23701#: lazarusidestrconsts.uepins 23702msgid "INS" 23703msgstr "INS" 23704 23705#: lazarusidestrconsts.uepovr 23706msgid "OVR" 23707msgstr "OVR" 23708 23709#: lazarusidestrconsts.uepreadonly 23710msgid "Readonly" 23711msgstr "Niet wijzigbaar" 23712 23713#: lazarusidestrconsts.unitdepoptionsforpackage 23714msgid "Options for Package graph" 23715msgstr "" 23716 23717#: lazarusidestrconsts.unitdepoptionsforunit 23718msgid "Options for Unit graph" 23719msgstr "" 23720 23721#: lazarusidestrconsts.versioninfotitle 23722msgid "Version Info" 23723msgstr "Versie informatie" 23724 23725