1TBLASTN 2.1.2 [Oct-19-2000] 2 3 4Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 5Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 6"Gapped BLAST and PSI-BLAST: a new generation of protein database search 7programs", Nucleic Acids Res. 25:3389-3402. 8 9Query= CYS1_DICDI 10 (343 letters) 11 12Database: alu.n 13 327 sequences; 80,506 total letters 14 15Searching......................................................done 16 17 Score E 18Sequences producing significant alignments: (bits) Value 19 20gnl|alu|L13391_HSAL003871 (Alu-J) 23 0.64 21gnl|alu|M30798_HSAL001637 (Alu-J) 20 5.6 22gnl|alu|M64231_HSAL003023 (Alu-Sb) 20 5.6 23gnl|alu|Y00326_HSAL000959 (Alu-J) 19 9.5 24gnl|alu|X69908_HSAL000290 (Alu-J) 19 9.5 25gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.5 26gnl|alu|M80812_HSAL001801 (Alu-J) 19 9.5 27 28>gnl|alu|L13391_HSAL003871 (Alu-J) 29 Length = 193 30 31 Score = 23.1 bits (48), Expect = 0.64 32 Identities = 11/32 (34%), Positives = 15/32 (46%) 33 Frame = +1 34 35Query: 137 GQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQ 168 36 G CGSCW + QHF ++ LS + 37Sbjct: 19 GYCGSCW--------KSQHFGRLRQVEGLSSE 90 38 39 40>gnl|alu|M30798_HSAL001637 (Alu-J) 41 Length = 331 42 43 Score = 20.0 bits (40), Expect = 5.6 44 Identities = 6/7 (85%), Positives = 7/7 (99%) 45 Frame = +3 46 47Query: 278 PCNPNSL 284 48 PCNPN+L 49Sbjct: 12 PCNPNTL 32 50 51 52>gnl|alu|M64231_HSAL003023 (Alu-Sb) 53 Length = 257 54 55 Score = 20.0 bits (40), Expect = 5.6 56 Identities = 8/14 (57%), Positives = 9/14 (64%) 57 Frame = +3 58 59Query: 294 SAKNTIFRKNMPYW 307 60 S KNT +KN P W 61Sbjct: 72 STKNTKKKKNGPAW 113 62 63 64>gnl|alu|Y00326_HSAL000959 (Alu-J) 65 Length = 260 66 67 Score = 19.2 bits (38), Expect = 9.5 68 Identities = 6/10 (60%), Positives = 6/10 (60%) 69 Frame = -2 70 71Query: 177 CMEYEGEEAC 186 72 C EY GE C 73Sbjct: 34 CWEYRGEPPC 5 74 75 76>gnl|alu|X69908_HSAL000290 (Alu-J) 77 Length = 292 78 79 Score = 19.2 bits (38), Expect = 9.5 80 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) 81 Frame = -1 82 83Query: 118 IPTAFDWRTRGAVTPVK---NQGQCGSCWS 144 84 +P +WR ++ P Q C S WS 85Sbjct: 256 LPILDNWRDHSSLKPPAPGFKQSSCLSFWS 167 86 87 88>gnl|alu|M65235_HSAL002711 (Alu-Sx) 89 Length = 325 90 91 Score = 19.2 bits (38), Expect = 9.5 92 Identities = 5/7 (71%), Positives = 5/7 (71%) 93 Frame = -1 94 95Query: 137 GQCGSCW 143 96 G C SCW 97Sbjct: 115 GACSSCW 95 98 99 100>gnl|alu|M80812_HSAL001801 (Alu-J) 101 Length = 202 102 103 Score = 19.2 bits (38), Expect = 9.5 104 Identities = 5/10 (50%), Positives = 7/10 (70%) 105 Frame = +2 106 107Query: 168 QNLVDCDHEC 177 108 + +V CDH C 109Sbjct: 113 ETIVHCDHTC 142 110 111 112 Database: alu.n 113 Posted date: Feb 26, 2001 4:36 AM 114 Number of letters in database: 80,506 115 Number of sequences in database: 327 116 117Lambda K H 118 0.316 0.135 0.414 119 120Gapped 121Lambda K H 122 0.270 0.0470 0.230 123 124 125Matrix: BLOSUM62 126Gap Penalties: Existence: 11, Extension: 1 127Number of Hits to DB: 35241 128Number of Sequences: 327 129Number of extensions: 483 130Number of successful extensions: 7 131Number of sequences better than 10.0: 14 132Number of HSP's better than 10.0 without gapping: 6 133Number of HSP's successfully gapped in prelim test: 1 134Number of HSP's that attempted gapping in prelim test: 1 135Number of HSP's gapped (non-prelim): 7 136length of query: 343 137length of database: 26,835 138effective HSP length: 31 139effective length of query: 312 140effective length of database: 16,698 141effective search space: 5209776 142effective search space used: 5209776 143frameshift window, decay const: 50, 0.1 144T: 13 145A: 40 146X1: 16 ( 7.3 bits) 147X2: 38 (14.8 bits) 148X3: 64 (24.9 bits) 149S1: 36 (19.3 bits) 150S2: 38 (19.2 bits) 151TBLASTN 2.1.2 [Oct-19-2000] 152 153 154Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 155Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 156"Gapped BLAST and PSI-BLAST: a new generation of protein database search 157programs", Nucleic Acids Res. 25:3389-3402. 158 159Query= ALEU_HORVU 160 (362 letters) 161 162Database: alu.n 163 327 sequences; 80,506 total letters 164 165Searching......................................................done 166 167 Score E 168Sequences producing significant alignments: (bits) Value 169 170gnl|alu|L13391_HSAL003871 (Alu-J) 23 0.51 171gnl|alu|M59213_HSAL001809 (Alu-J) 20 7.5 172gnl|alu|M19889_HSAL002725 (Alu-J) 19 9.9 173gnl|alu|X05322_HSAL000874 (Alu-Sx) 19 9.9 174 175>gnl|alu|L13391_HSAL003871 (Alu-J) 176 Length = 193 177 178 Score = 23.5 bits (49), Expect = 0.51 179 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 3/40 (7%) 180 Frame = +1 181 182Query: 164 HCGSCWTFSTTGAL---EAAYTQATGKNISLSEQQLVDCA 200 183 +CGSCW G L E ++ G +I ++ DCA 184Sbjct: 22 YCGSCWKSQHFGRLRQVEGLSSEVRGSSIQVTVS--YDCA 135 185 186 187>gnl|alu|M59213_HSAL001809 (Alu-J) 188 Length = 339 189 190 Score = 19.6 bits (39), Expect = 7.5 191 Identities = 7/12 (58%), Positives = 7/12 (58%) 192 Frame = +2 193 194Query: 164 HCGSCWTFSTTG 175 195 HCGSC F G 196Sbjct: 8 HCGSCL*FQQFG 43 197 198 199>gnl|alu|M19889_HSAL002725 (Alu-J) 200 Length = 183 201 202 Score = 19.2 bits (38), Expect = 9.9 203 Identities = 5/8 (62%), Positives = 7/8 (87%) 204 Frame = -1 205 206Query: 236 GVNGVCHY 243 207 G NG+CH+ 208Sbjct: 54 GTNGMCHH 31 209 210 211>gnl|alu|X05322_HSAL000874 (Alu-Sx) 212 Length = 225 213 214 Score = 19.2 bits (38), Expect = 9.9 215 Identities = 6/11 (54%), Positives = 7/11 (63%) 216 Frame = -3 217 218Query: 237 VNGVCHYKAEN 247 219 + GVCHY N 220Sbjct: 163 ITGVCHYAQLN 131 221 222 223 Database: alu.n 224 Posted date: Feb 26, 2001 4:36 AM 225 Number of letters in database: 80,506 226 Number of sequences in database: 327 227 228Lambda K H 229 0.318 0.132 0.400 230 231Gapped 232Lambda K H 233 0.270 0.0470 0.230 234 235 236Matrix: BLOSUM62 237Gap Penalties: Existence: 11, Extension: 1 238Number of Hits to DB: 31527 239Number of Sequences: 327 240Number of extensions: 291 241Number of successful extensions: 6 242Number of sequences better than 10.0: 8 243Number of HSP's better than 10.0 without gapping: 4 244Number of HSP's successfully gapped in prelim test: 0 245Number of HSP's that attempted gapping in prelim test: 2 246Number of HSP's gapped (non-prelim): 4 247length of query: 362 248length of database: 26,835 249effective HSP length: 32 250effective length of query: 330 251effective length of database: 16,371 252effective search space: 5402430 253effective search space used: 5402430 254frameshift window, decay const: 50, 0.1 255T: 13 256A: 40 257X1: 16 ( 7.3 bits) 258X2: 38 (14.8 bits) 259X3: 64 (24.9 bits) 260S1: 36 (19.4 bits) 261S2: 38 (19.2 bits) 262TBLASTN 2.1.2 [Oct-19-2000] 263 264 265Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 266Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 267"Gapped BLAST and PSI-BLAST: a new generation of protein database search 268programs", Nucleic Acids Res. 25:3389-3402. 269 270Query= CATH_HUMAN 271 (335 letters) 272 273Database: alu.n 274 327 sequences; 80,506 total letters 275 276Searching......................................................done 277 278 Score E 279Sequences producing significant alignments: (bits) Value 280 281gnl|alu|M63796_HSAL002417 (Alu-J) 23 0.85 282gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 283gnl|alu|M65235_HSAL002711 (Alu-Sx) 21 2.5 284gnl|alu|M88005_HSAL001281 (Alu-Sx) 21 3.3 285gnl|alu|M64231_HSAL003024 (Alu-J) 20 4.3 286 287>gnl|alu|M63796_HSAL002417 (Alu-J) 288 Length = 322 289 290 Score = 22.7 bits (47), Expect = 0.85 291 Identities = 11/34 (32%), Positives = 15/34 (43%) 292 Frame = +1 293 294Query: 302 SWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV 335 295 SW P W + KN G+ A Y +P+V 296Sbjct: 76 SWRPAWASGHLIFTKNKKN*LGMVV*ACY-VPVV 174 297 298 299>gnl|alu|L13391_HSAL003871 (Alu-J) 300 Length = 193 301 302 Score = 22.3 bits (46), Expect = 1.1 303 Identities = 8/23 (34%), Positives = 11/23 (47%) 304 Frame = +1 305 306Query: 136 GACGSCWTFSTTGALESAIAIAT 158 307 G CGSCW G L +++ 308Sbjct: 19 GYCGSCWKSQHFGRLRQVEGLSS 87 309 310 311>gnl|alu|M65235_HSAL002711 (Alu-Sx) 312 Length = 325 313 314 Score = 21.2 bits (43), Expect = 2.5 315 Identities = 6/7 (85%), Positives = 6/7 (85%) 316 Frame = -1 317 318Query: 136 GACGSCW 142 319 GAC SCW 320Sbjct: 115 GACSSCW 95 321 322 323>gnl|alu|M88005_HSAL001281 (Alu-Sx) 324 Length = 225 325 326 Score = 20.8 bits (42), Expect = 3.3 327 Identities = 9/29 (31%), Positives = 16/29 (55%) 328 Frame = -1 329 330Query: 118 PSVDWRKKGNFVSPVKNQGACGSCWTFST 146 331 P++ NFV VKN+ +C W+ ++ 332Sbjct: 165 PTIPNASLTNFVFFVKNRVSCWPGWSLNS 79 333 334 335>gnl|alu|M64231_HSAL003024 (Alu-J) 336 Length = 287 337 338 Score = 20.4 bits (41), Expect = 4.3 339 Identities = 10/24 (41%), Positives = 13/24 (53%) 340 Frame = -2 341 342Query: 96 WSEPQNCSATKSNYLRGTGPYPPS 119 343 WS + A + LRG+G PPS 344Sbjct: 232 WSAVASIMAHYTLGLRGSGDPPPS 161 345 346 347 Database: alu.n 348 Posted date: Feb 26, 2001 4:36 AM 349 Number of letters in database: 80,506 350 Number of sequences in database: 327 351 352Lambda K H 353 0.319 0.134 0.436 354 355Gapped 356Lambda K H 357 0.270 0.0470 0.230 358 359 360Matrix: BLOSUM62 361Gap Penalties: Existence: 11, Extension: 1 362Number of Hits to DB: 44068 363Number of Sequences: 327 364Number of extensions: 498 365Number of successful extensions: 7 366Number of sequences better than 10.0: 10 367Number of HSP's better than 10.0 without gapping: 5 368Number of HSP's successfully gapped in prelim test: 0 369Number of HSP's that attempted gapping in prelim test: 2 370Number of HSP's gapped (non-prelim): 5 371length of query: 335 372length of database: 26,835 373effective HSP length: 29 374effective length of query: 306 375effective length of database: 17,352 376effective search space: 5309712 377effective search space used: 5309712 378frameshift window, decay const: 50, 0.1 379T: 13 380A: 40 381X1: 16 ( 7.4 bits) 382X2: 38 (14.8 bits) 383X3: 64 (24.9 bits) 384S1: 36 (19.5 bits) 385S2: 38 (19.2 bits) 386TBLASTN 2.1.2 [Oct-19-2000] 387 388 389Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 390Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 391"Gapped BLAST and PSI-BLAST: a new generation of protein database search 392programs", Nucleic Acids Res. 25:3389-3402. 393 394Query= CATH_RAT 395 (333 letters) 396 397Database: alu.n 398 327 sequences; 80,506 total letters 399 400Searching......................................................done 401 402 Score E 403Sequences producing significant alignments: (bits) Value 404 405gnl|alu|L13391_HSAL003871 (Alu-J) 24 0.36 406gnl|alu|M65235_HSAL002711 (Alu-Sx) 21 2.4 407gnl|alu|L11016_HSAL003845 (Alu-J) 19 9.2 408 409>gnl|alu|L13391_HSAL003871 (Alu-J) 410 Length = 193 411 412 Score = 23.9 bits (50), Expect = 0.36 413 Identities = 9/23 (39%), Positives = 11/23 (47%) 414 Frame = +1 415 416Query: 134 GACGSCWTFSTTGALESAVAIAS 156 417 G CGSCW G L ++S 418Sbjct: 19 GYCGSCWKSQHFGRLRQVEGLSS 87 419 420 421>gnl|alu|M65235_HSAL002711 (Alu-Sx) 422 Length = 325 423 424 Score = 21.2 bits (43), Expect = 2.4 425 Identities = 6/7 (85%), Positives = 6/7 (85%) 426 Frame = -1 427 428Query: 134 GACGSCW 140 429 GAC SCW 430Sbjct: 115 GACSSCW 95 431 432 433>gnl|alu|L11016_HSAL003845 (Alu-J) 434 Length = 197 435 436 Score = 19.2 bits (38), Expect = 9.2 437 Identities = 7/15 (46%), Positives = 10/15 (66%) 438 Frame = +3 439 440Query: 124 GNVVSPVKNQGACGS 138 441 GN+V P + +CGS 442Sbjct: 93 GNIVRPHFYKASCGS 137 443 444 445 Database: alu.n 446 Posted date: Feb 26, 2001 4:36 AM 447 Number of letters in database: 80,506 448 Number of sequences in database: 327 449 450Lambda K H 451 0.319 0.131 0.412 452 453Gapped 454Lambda K H 455 0.270 0.0470 0.230 456 457 458Matrix: BLOSUM62 459Gap Penalties: Existence: 11, Extension: 1 460Number of Hits to DB: 35152 461Number of Sequences: 327 462Number of extensions: 361 463Number of successful extensions: 10 464Number of sequences better than 10.0: 6 465Number of HSP's better than 10.0 without gapping: 3 466Number of HSP's successfully gapped in prelim test: 0 467Number of HSP's that attempted gapping in prelim test: 7 468Number of HSP's gapped (non-prelim): 3 469length of query: 333 470length of database: 26,835 471effective HSP length: 31 472effective length of query: 302 473effective length of database: 16,698 474effective search space: 5042796 475effective search space used: 5042796 476frameshift window, decay const: 50, 0.1 477T: 13 478A: 40 479X1: 16 ( 7.4 bits) 480X2: 38 (14.8 bits) 481X3: 64 (24.9 bits) 482S1: 35 (19.0 bits) 483S2: 38 (19.2 bits) 484TBLASTN 2.1.2 [Oct-19-2000] 485 486 487Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 488Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 489"Gapped BLAST and PSI-BLAST: a new generation of protein database search 490programs", Nucleic Acids Res. 25:3389-3402. 491 492Query= CATL_HUMAN 493 (333 letters) 494 495Database: alu.n 496 327 sequences; 80,506 total letters 497 498Searching......................................................done 499 500 Score E 501Sequences producing significant alignments: (bits) Value 502 503gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 504gnl|alu|M63544_HSAL002045 (Alu-J) 21 3.1 505gnl|alu|Z17809_HSAL003365 (Alu-Sx) 20 7.0 506gnl|alu|X16277_HSAL000821 (Alu-J) 19 9.2 507gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.2 508 509>gnl|alu|L13391_HSAL003871 (Alu-J) 510 Length = 193 511 512 Score = 22.3 bits (46), Expect = 1.1 513 Identities = 8/15 (53%), Positives = 8/15 (53%) 514 Frame = +1 515 516Query: 133 GQCGSCWAFSATGAL 147 517 G CGSCW G L 518Sbjct: 19 GYCGSCWKSQHFGRL 63 519 520 521>gnl|alu|M63544_HSAL002045 (Alu-J) 522 Length = 265 523 524 Score = 20.8 bits (42), Expect = 3.1 525 Identities = 9/22 (40%), Positives = 14/22 (62%), Gaps = 2/22 (9%) 526 Frame = -2 527 528Query: 260 KEGIYFEP--DCSSEDMDHGVL 279 529 ++G+ P +CSS MDH +L 530Sbjct: 252 RQGLALSPRLECSSAIMDHCIL 187 531 532 533>gnl|alu|Z17809_HSAL003365 (Alu-Sx) 534 Length = 207 535 536 Score = 19.6 bits (39), Expect = 7.0 537 Identities = 6/14 (42%), Positives = 10/14 (70%) 538 Frame = -3 539 540Query: 174 GNEGCNGGLMDYAF 187 541 G +GC GLM +++ 542Sbjct: 172 GVQGCGHGLMGFSY 131 543 544 545>gnl|alu|X16277_HSAL000821 (Alu-J) 546 Length = 287 547 548 Score = 19.2 bits (38), Expect = 9.2 549 Identities = 6/14 (42%), Positives = 11/14 (77%) 550 Frame = +3 551 552Query: 64 QEYREGKHSFTMAM 77 553 QE+ G+HS T+++ 554Sbjct: 72 QEFEPGQHSETLSL 113 555 556 557>gnl|alu|M65235_HSAL002711 (Alu-Sx) 558 Length = 325 559 560 Score = 19.2 bits (38), Expect = 9.2 561 Identities = 5/7 (71%), Positives = 5/7 (71%) 562 Frame = -1 563 564Query: 133 GQCGSCW 139 565 G C SCW 566Sbjct: 115 GACSSCW 95 567 568 569 Database: alu.n 570 Posted date: Feb 26, 2001 4:36 AM 571 Number of letters in database: 80,506 572 Number of sequences in database: 327 573 574Lambda K H 575 0.317 0.133 0.417 576 577Gapped 578Lambda K H 579 0.270 0.0470 0.230 580 581 582Matrix: BLOSUM62 583Gap Penalties: Existence: 11, Extension: 1 584Number of Hits to DB: 39061 585Number of Sequences: 327 586Number of extensions: 451 587Number of successful extensions: 9 588Number of sequences better than 10.0: 10 589Number of HSP's better than 10.0 without gapping: 5 590Number of HSP's successfully gapped in prelim test: 0 591Number of HSP's that attempted gapping in prelim test: 4 592Number of HSP's gapped (non-prelim): 5 593length of query: 333 594length of database: 26,835 595effective HSP length: 31 596effective length of query: 302 597effective length of database: 16,698 598effective search space: 5042796 599effective search space used: 5042796 600frameshift window, decay const: 50, 0.1 601T: 13 602A: 40 603X1: 16 ( 7.3 bits) 604X2: 38 (14.8 bits) 605X3: 64 (24.9 bits) 606S1: 36 (19.3 bits) 607S2: 38 (19.2 bits) 608TBLASTN 2.1.2 [Oct-19-2000] 609 610 611Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 612Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 613"Gapped BLAST and PSI-BLAST: a new generation of protein database search 614programs", Nucleic Acids Res. 25:3389-3402. 615 616Query= CATL_RAT 617 (334 letters) 618 619Database: alu.n 620 327 sequences; 80,506 total letters 621 622Searching......................................................done 623 624 Score E 625Sequences producing significant alignments: (bits) Value 626 627gnl|alu|Z17809_HSAL003365 (Alu-Sx) 22 1.4 628gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.9 629gnl|alu|Z30166_HSAL006097 (Alu-J) 21 2.5 630gnl|alu|L26953_HSAL004755 (Alu-Sx) 20 4.2 631gnl|alu|M65235_HSAL002711 (Alu-Sx) 19 9.5 632 633>gnl|alu|Z17809_HSAL003365 (Alu-Sx) 634 Length = 207 635 636 Score = 21.9 bits (45), Expect = 1.4 637 Identities = 8/14 (57%), Positives = 10/14 (71%) 638 Frame = -3 639 640Query: 174 GNQGCNGGLMDFAF 187 641 G QGC GLM F++ 642Sbjct: 172 GVQGCGHGLMGFSY 131 643 644 645>gnl|alu|L13391_HSAL003871 (Alu-J) 646 Length = 193 647 648 Score = 21.6 bits (44), Expect = 1.9 649 Identities = 6/7 (85%), Positives = 6/7 (85%) 650 Frame = +1 651 652Query: 133 GQCGSCW 139 653 G CGSCW 654Sbjct: 19 GYCGSCW 39 655 656 657>gnl|alu|Z30166_HSAL006097 (Alu-J) 658 Length = 168 659 660 Score = 21.2 bits (43), Expect = 2.5 661 Identities = 8/22 (36%), Positives = 12/22 (54%) 662 Frame = -2 663 664Query: 108 EPLMLQIPKTVDWREKGCVTPV 129 665 +P L +PK D+R C P+ 666Sbjct: 77 DPAHLSLPKCWDYRLSHCAWPL 12 667 668 669>gnl|alu|L26953_HSAL004755 (Alu-Sx) 670 Length = 337 671 672 Score = 20.4 bits (41), Expect = 4.2 673 Identities = 6/9 (66%), Positives = 7/9 (77%) 674 Frame = +1 675 676Query: 171 HDQGNQGCN 179 677 HD G +GCN 678Sbjct: 223 HDPGGRGCN 249 679 680 681>gnl|alu|M65235_HSAL002711 (Alu-Sx) 682 Length = 325 683 684 Score = 19.2 bits (38), Expect = 9.5 685 Identities = 5/7 (71%), Positives = 5/7 (71%) 686 Frame = -1 687 688Query: 133 GQCGSCW 139 689 G C SCW 690Sbjct: 115 GACSSCW 95 691 692 693 Database: alu.n 694 Posted date: Feb 26, 2001 4:36 AM 695 Number of letters in database: 80,506 696 Number of sequences in database: 327 697 698Lambda K H 699 0.317 0.134 0.426 700 701Gapped 702Lambda K H 703 0.270 0.0470 0.230 704 705 706Matrix: BLOSUM62 707Gap Penalties: Existence: 11, Extension: 1 708Number of Hits to DB: 36291 709Number of Sequences: 327 710Number of extensions: 428 711Number of successful extensions: 8 712Number of sequences better than 10.0: 10 713Number of HSP's better than 10.0 without gapping: 5 714Number of HSP's successfully gapped in prelim test: 0 715Number of HSP's that attempted gapping in prelim test: 3 716Number of HSP's gapped (non-prelim): 5 717length of query: 334 718length of database: 26,835 719effective HSP length: 30 720effective length of query: 304 721effective length of database: 17,025 722effective search space: 5175600 723effective search space used: 5175600 724frameshift window, decay const: 50, 0.1 725T: 13 726A: 40 727X1: 16 ( 7.3 bits) 728X2: 38 (14.8 bits) 729X3: 64 (24.9 bits) 730S1: 36 (19.4 bits) 731S2: 38 (19.2 bits) 732TBLASTN 2.1.2 [Oct-19-2000] 733 734 735Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 736Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 737"Gapped BLAST and PSI-BLAST: a new generation of protein database search 738programs", Nucleic Acids Res. 25:3389-3402. 739 740Query= PAPA_CARPA 741 (345 letters) 742 743Database: alu.n 744 327 sequences; 80,506 total letters 745 746Searching......................................................done 747 748 Score E 749Sequences producing significant alignments: (bits) Value 750 751gnl|alu|L13391_HSAL003871 (Alu-J) 22 1.1 752gnl|alu|X68486_HSAL004968 (Alu-J) 20 5.7 753gnl|alu|M65235_HSAL002711 (Alu-Sx) 20 5.7 754gnl|alu|M78078_HSAL003530 (Alu-Sc) 19 9.8 755gnl|alu|M63322_HSAL001805 (Alu-J) 19 9.8 756 757>gnl|alu|L13391_HSAL003871 (Alu-J) 758 Length = 193 759 760 Score = 22.3 bits (46), Expect = 1.1 761 Identities = 9/21 (42%), Positives = 12/21 (56%), Gaps = 3/21 (14%) 762 Frame = +1 763 764Query: 153 GSCGSCWA---FSAVVTIEGI 170 765 G CGSCW F + +EG+ 766Sbjct: 19 GYCGSCWKSQHFGRLRQVEGL 81 767 768 769>gnl|alu|X68486_HSAL004968 (Alu-J) 770 Length = 249 771 772 Score = 20.0 bits (40), Expect = 5.7 773 Identities = 11/49 (22%), Positives = 20/49 (40%), Gaps = 10/49 (20%) 774 Frame = -2 775 776Query: 14 AICLFVYMGLSFGDFSIVGYS----------QNDLTSTERLIQLFESWM 52 777 A+CLF++ FG + + N L + + + ESW+ 778Sbjct: 149 AVCLFIFSFFFFGRNGLFAHVAQAGLALLG*SNPLALASQSLGITESWV 3 779 780 781>gnl|alu|M65235_HSAL002711 (Alu-Sx) 782 Length = 325 783 784 Score = 20.0 bits (40), Expect = 5.7 785 Identities = 5/7 (71%), Positives = 6/7 (85%) 786 Frame = -1 787 788Query: 153 GSCGSCW 159 789 G+C SCW 790Sbjct: 115 GACSSCW 95 791 792 793>gnl|alu|M78078_HSAL003530 (Alu-Sc) 794 Length = 158 795 796 Score = 19.2 bits (38), Expect = 9.8 797 Identities = 7/14 (50%), Positives = 10/14 (71%) 798 Frame = -1 799 800Query: 204 ALQLVAQYGIHYRN 217 801 + LVAQ G+ +RN 802Sbjct: 104 SFNLVAQAGVQWRN 63 803 804 805>gnl|alu|M63322_HSAL001805 (Alu-J) 806 Length = 345 807 808 Score = 19.2 bits (38), Expect = 9.8 809 Identities = 6/15 (40%), Positives = 11/15 (73%) 810 Frame = +2 811 812Query: 73 KDNLKYIDETNKKNN 87 813 K+ +KY+ + NKK + 814Sbjct: 284 KNKIKYVFKNNKKKS 328 815 816 817 Database: alu.n 818 Posted date: Feb 26, 2001 4:36 AM 819 Number of letters in database: 80,506 820 Number of sequences in database: 327 821 822Lambda K H 823 0.318 0.138 0.428 824 825Gapped 826Lambda K H 827 0.270 0.0470 0.230 828 829 830Matrix: BLOSUM62 831Gap Penalties: Existence: 11, Extension: 1 832Number of Hits to DB: 33866 833Number of Sequences: 327 834Number of extensions: 356 835Number of successful extensions: 7 836Number of sequences better than 10.0: 10 837Number of HSP's better than 10.0 without gapping: 5 838Number of HSP's successfully gapped in prelim test: 0 839Number of HSP's that attempted gapping in prelim test: 2 840Number of HSP's gapped (non-prelim): 5 841length of query: 345 842length of database: 26,835 843effective HSP length: 30 844effective length of query: 315 845effective length of database: 17,025 846effective search space: 5362875 847effective search space used: 5362875 848frameshift window, decay const: 50, 0.1 849T: 13 850A: 40 851X1: 16 ( 7.3 bits) 852X2: 38 (14.8 bits) 853X3: 64 (24.9 bits) 854S1: 36 (19.4 bits) 855S2: 38 (19.2 bits) 856