12004-12-19 Sven Neumann <sven@gimp.org> 2 3 * Made 2.2.0 release. 4 52004-12-18 Sven Neumann <sven@gimp.org> 6 7 * app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label. 8 92004-12-18 Sven Neumann <sven@gimp.org> 10 11 * app/dialogs/resize-dialog.c: free the dialog's private data 12 struct using a weak reference, not in a "destroy" handler. Should 13 fix bug #161472. 14 15 * app/dialogs/print-size-dialog.c 16 * app/dialogs/scale-dialog.c: same change here. 17 182004-12-18 Sven Neumann <sven@gimp.org> 19 20 * app/dialogs/quit-dialog.c: marked a message for translation that 21 had been forgotten. Fixes bug #161596. 22 232004-12-17 Sven Neumann <sven@gimp.org> 24 25 * autogen.sh: check for gtk-doc.m4, depend on intltool > 0.31. 26 272004-12-17 Sven Neumann <sven@gimp.org> 28 29 * app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't 30 use the rect-select cursor if the tool is in move-layer mode. 31 Spotted by Joao S. O. Bueno, bug #161465. 32 332004-12-17 Simon Budig <simon@gimp.org> 34 35 * app/tools/gimpcurvestool.c: Kill some nonsensical code that 36 tried to set control points in a free form curve based on the 37 image coordinates (huh?). Update the Graph after adding a point. 38 Untabbified. 39 402004-12-17 Sven Neumann <sven@gimp.org> 41 42 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color): 43 take drawable offsets into account. Fixes bug #161508. 44 452004-12-17 Sven Neumann <sven@gimp.org> 46 47 * docs/gimp-remote.1.in 48 * docs/gimp.1.in 49 * docs/gimptool.1.in: minor tweaks. 50 512004-12-17 Simon Budig <simon@gimp.org> 52 53 * data/images/gimp-splash.png: Added new splash by 54 Bill Luhtala <bluhtala@telus.net>. 55 56 * data/images/gimp-logo.png: Added new Image for the about dialog 57 by Philip Lafleur <deathpudding@gmail.com>. 58 59 * app/dialogs/about-dialog.c: Adjusted text colors and placement 60 to the new image. 61 62 * data/images/gimp2_0_logo.png 63 * data/images/gimp2_0_splash.png: Added for historical reasons. 64 65 * data/images/gimp_logo.png: Removed (renamed to gimp-logo.png) 66 * data/images/Makefile.am: changed accordingly. 67 682004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> 69 70 * app/core/gimpgradient-load.c: reject .ggr files whose 71 segments don't properly span the range 0-1. 72 Fixes bug #161430. 73 742004-12-16 Manish Singh <yosh@gimp.org> 75 76 * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast 77 result of g_value_dup_object() to GIMP_CONTEXT(). 78 792004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> 80 81 * plug-ins/script-fu/scripts/circuit.scm: don't try to 82 desaturate a grayscale layer, fixes bug #161470. 83 842004-12-16 Sven Neumann <sven@gimp.org> 85 86 * INSTALL: updated location of fontconfig sources. 87 882004-12-16 Sven Neumann <sven@gimp.org> 89 90 * app/config/gimpconfig-dump.c 91 * docs/gimp-remote.1.in 92 * docs/gimp.1.in 93 * docs/gimprc.5.in: hyphens revisited. 94 952004-12-16 Sven Neumann <neumann@jpk.com> 96 97 * app/config/gimpconfig-dump.c (dump_gimprc_manpage): escape hyphens. 98 99 * docs/gimp.1.in: documented the way that splash images are choosen. 100 101 * docs/gimprc.5.in: regenerated. 102 1032004-12-16 Michael Natterer <mitch@gimp.org> 104 105 * app/actions/actions.c (action_data_get_*): get gimp, display or 106 image from a context only if it isn't NULL. Fixes warnings and 107 crashes when dragging around some dockables (the dockables' 108 context temporarily becomes NULL while dragging). 109 110 Reordered checks for the passed "data" to be consistent across the 111 various functions. 112 113 Removed assertions which said "#warning: remove me before 2.2" 114 1152004-12-16 Sven Neumann <neumann@jpk.com> 116 117 * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog): 118 added a note on how to use the dialog, copied from the GNOME keyboard 119 shortcuts editor. 120 1212004-12-15 Sven Neumann <sven@gimp.org> 122 123 * tools/pdbgen/pdb/text_tool.pdb: let gimp_text() and 124 gimp_text_fontname() succeed but return -1 if no layer was created. 125 Fixes bug #161272. 126 127 * app/pdb/text_tool_cmds.c 128 * libgimp/gimptexttool_pdb.c: regenerated. 129 1302004-12-15 Michael Natterer <mitch@gimp.org> 131 132 * app/core/gimpdrawable-preview.[ch]: added utility function 133 gimp_drawable_preview_bytes() and use it. Some cleanup, 134 untabified. 135 136 * app/widgets/gimpviewrendererdrawable.c: use 137 gimp_drawable_preview_bytes() instead of duplicating its code. 138 1392004-12-15 Michael Natterer <mitch@gimp.org> 140 Sven Neumann <sven@gimp.org> 141 142 * app/core/gimpdrawable-preview.c (gimp_drawable_preview_scale): 143 fixed RGBA resampling by using premultiplied values for the 144 intermediate accumulation buffer. Fixes bugs #72880 and #72881. 145 1462004-12-14 Michael Natterer <mitch@gimp.org> 147 148 * app/plug-in/plug-in-proc-frame.[ch]: added "gint ref_count" to 149 the PlugInProcFrame struct. Added new functions 150 plug_in_proc_frame_ref/unref(). 151 152 (plug_in_proc_frame_new): set the ref_count to 1. 153 154 * app/plug-in/plug-in.[ch] (plug_in_proc_frame_push): return the 155 new proc_frame. 156 157 (plug_in_proc_frame_pop): use unref() instead of free(). 158 159 * app/plug-in/plug-in-run.c (plug_in_temp_run): ref the proc_frame 160 while running its main loop. Removed the call to 161 plug_in_proc_frame_pop(). 162 163 * app/plug-in/plug-in-message.c (plug_in_handle_temp_proc_return): 164 call plug_in_proc_frame_pop() immediately after 165 plug_in_main_loop_quit() so the proc_frame goes away from the 166 stack and can't be used accidentially if the core is too busy to 167 return to the main loop before the next command arrives on the 168 wire. Really fixes bug #161114 this time. 169 1702004-12-14 Simon Budig <simon@gimp.org> 171 172 * app/vectors/gimpstroke.[ch]: Changed the "gradient" parameter 173 to "slope" to make it more clear what the returned result is (which 174 was wrong earlier). 175 * tools/pdbgen/pdb/paths.pdb: changed accordingly 176 177 * app/pdb/paths_cmds.c 178 * libgimp/gimppaths_pdb.[ch]: regenerated. 179 180 Fixes bug #161274. 181 1822004-12-14 Maurits Rijk <m.rijk@chello.nl> 183 184 * plug-ins/imagemap/imap_selection.c: don't use 185 gtk_tree_selection_get_selected with GTK_SELECTION_MULTIPLE. Should 186 finally fix bug #149157. 187 1882004-12-14 Sven Neumann <sven@gimp.org> 189 190 * libgimpwidgets/gimpstock.c (gimp_stock_init): documented. 191 1922004-12-14 Sven Neumann <sven@gimp.org> 193 194 * plug-ins/imagemap/imap_misc.c (make_toolbar_radio_icon): don't 195 call gtk_radio_tool_button_new_with_stock_from_widget() with a 196 NULL widget. Fixes bug #161210. 197 1982004-12-14 Sven Neumann <sven@gimp.org> 199 200 * configure.in: added GIMP_API_VERSION to the generated gimpversion.h. 201 202 * libgimpbase/gimpenv.c (gimp_toplevel_directory): use 203 GIMP_API_VERSION instead of GIMP_MACRO_VERSION.GIMP_MINOR_VERSION 204 when building a path to test the plug-in executable path against. 205 2062004-12-14 Michael Natterer <mitch@gimp.org> 207 208 * tools/pdbgen/pdb/drawable.pdb: added gimp_drawable_sub_thumbnail() 209 to enable plug-ins avoiding #142074-alike bugs if they need to. 210 211 * app/pdb/drawable_cmds.c 212 * app/pdb/internal_procs.c 213 * libgimp/gimpdrawable_pdb.[ch]: regenerated. 214 215 * libgimp/gimpdrawable.[ch] 216 * libgimp/gimppixbuf.[ch]: wrap it with the same convenience 217 APIs as gimp_drawable_thumbnail(). 218 219 * libgimp/gimp.def 220 * libgimp/gimpui.def: changed accordingly. 221 2222004-12-13 Sven Neumann <sven@gimp.org> 223 224 * HACKING 225 * autogen.sh 226 * configure.in: switched to using gtkdocize for the build of the 227 API docs. 228 2292004-12-13 Maurits Rijk <m.rijk@chello.nl> 230 231 * plug-ins/imagemap/imap_selection.c: don't try do to anything when 232 selection is empty. Fixes bug #149157. 233 2342004-12-13 Maurits Rijk <m.rijk@chello.nl> 235 236 * plug-ins/imagemap/imap_misc.[ch] 237 * plug-ins/imagemap/imap_selection.[ch] 238 * plug-ins/imagemap/imap_toolbar.[ch] 239 * plug-ins/imagemap/imap_tools.[ch]: removed need for 240 GTK_DISABLE_DEPRECATED. Looking at #149157 next... 241 2422004-12-13 Sven Neumann <sven@gimp.org> 243 244 * app/tools/gimpcroptool.c: don't show the Crop tool window if 245 Shift is being pressed on the initial button_press event. 246 2472004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> 248 249 * plug-ins/pygimp/gimpfu.py: display PF_RADIO options vertically 250 instead of horizontally, as suggested by Joao S. O. Bueno Calligaris. 251 Fixes bug #160546. 252 2532004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> 254 255 * plug-ins/gfig/gfig.c: make the "gfig" layer parasites persistent, 256 so that they will be saved in xcf files. Stop printing "GFig 257 parasite found" message. 258 2592004-12-13 Michael Natterer <mitch@gimp.org> 260 261 * app/widgets/gimppdbdialog.[ch]: don't forget the context we 262 were created with but rmember it as pdb_dialog->caller_context. 263 264 * app/widgets/gimpbrushselect.c 265 * app/widgets/gimpfontselect.c 266 * app/widgets/gimpgradientselect.c 267 * app/widgets/gimppaletteselect.c 268 * app/widgets/gimppatternselect.c: use the caller_context when 269 calling the temp_proc so the temp_proc's stack frame doesn't 270 contain the dialog's private context (which is just a scratch 271 model for the container views) but the plug-in's real context 272 which is fully initialized. Fixes bug #161114. 273 2742004-12-13 Sven Neumann <sven@gimp.org> 275 276 * libgimp/gimpdrawablecombobox.c: fixed gtk-doc comment. 277 2782004-12-13 DindinX <dindinx@gimp.org> 279 280 * plug-ins/gfig/gfig-dialog.c 281 * plug-ins/gfig/gfig-style.c: let objects keep their own fill_style 282 context. 283 2842004-12-13 Sven Neumann <sven@gimp.org> 285 286 * app/core/gimpimage-convert.c: applied patch from Adam D. Moss with 287 more fixed dither improvements (bug #161123). 288 2892004-12-13 Sven Neumann <sven@gimp.org> 290 291 * app/gui/splash.c: restrict splash image to screen size to guard us 292 from insanely large splash images. 293 2942004-12-13 Michael Natterer <mitch@gimp.org> 295 296 * app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so 297 everything except GTK_RESPONSE_OK keeps the dock open 298 (e.g. hitting escape). 299 3002004-12-12 Michael Natterer <mitch@gimp.org> 301 302 * app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview): 303 added precondition check for the coords of the src area. Some 304 cleanup and simplification. 305 306 * app/widgets/gimpviewrendererdrawable.c 307 (gimp_view_renderer_drawable_render): don't request sub-previews 308 of area outside the drawable and don't reuqest previews of zero 309 width or height. Fixes crashes with the new preview code. 310 3112004-12-12 Sven Neumann <sven@gimp.org> 312 313 Applied patch from Adam D. Moss (bug #161113): 314 315 * app/core/gimpimage-convert.c: Use a slower but much nicer 316 technique for finding the two best colours to dither between when 317 using fixed/positional dither methods. Makes positional dither 318 much less lame. 319 3202004-12-12 Sven Neumann <sven@gimp.org> 321 322 * plug-ins/common/film.c (film): push a context around code that 323 changes the foreground color. 324 3252004-12-12 Sven Neumann <sven@gimp.org> 326 327 * app/batch.c (batch_run): changed handling of the 'gimp -b -' 328 command-line. It used to spawn three instances of Script-Fu, two 329 should be more than enough. 330 3312004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu> 332 333 * app/widgets/gimpdataeditor.c: make Revert button insensitive 334 because revert is not yet implemented (bug #152259). 335 3362004-12-12 Sven Neumann <sven@gimp.org> 337 338 * app/widgets/gimpdock.c: show a confirmation dialog if a dock 339 with multiple tabs is being closed. Sorry for the new strings, 340 they were carefully copied from gnome-terminal. 341 3422004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu> 343 344 * plug-ins/common/pnm.c: make export do the right thing when 345 saving as .pgm or .ppm. Fixes bug #160045. 346 3472004-12-12 Sven Neumann <sven@gimp.org> 348 349 * libgimp/gimp.def: added gimp_edit_copy_visible. 350 351 * plug-ins/script-fu/scripts/copy-visible.scm: deprecated. 352 3532004-12-12 Sven Neumann <sven@gimp.org> 354 355 * plug-ins/common/winclipboard.c: applied patch from Brion Vibber 356 that adds an alpha channel to the pasted layer. Fixes bug #148601. 357 3582004-12-12 Sven Neumann <sven@gimp.org> 359 360 * app/base/tile-manager-crop.c: removed trailing whitespace. 361 362 * plug-ins/imagemap/imap_selection.c: need to define 363 GTK_DISABLE_DEPRECATED for gtk_toolbar_append_space(). 364 3652004-12-12 Michael Natterer <mitch@gimp.org> 366 367 * app/paint-funcs/paint-funcs.[ch]: added new function 368 copy_region_nocow() as a workaround for the fact that sharing 369 tiles with the projection is heavily broken. 370 371 * app/base/tile-manager.c (tile_invalidate): added a warning when 372 entering the code path that breaks badly. 373 374 * app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using 375 the non-COW copying function above. 376 377 * app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE. 378 379 * app/actions/edit-actions.c 380 * app/actions/edit-commands.[ch]: added action & callback for 381 "edit-copy-visible". 382 383 * menus/image-menu.xml.in: added "edit-copy-visible" to the image 384 menu. 385 386 * tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible() 387 PDB wrapper. 388 389 * app/pdb/edit_cmds.c 390 * app/pdb/internal_procs.c 391 * libgimp/gimpedit_pdb.[ch]: regenerated. 392 393 * plug-ins/script-fu/scripts/copy-visible.scm: removed all code 394 and made it a backward compat wrapper around gimp-edit-copy-visible. 395 Fixes bug #138662. 396 3972004-12-11 Michael Natterer <mitch@gimp.org> 398 399 * app/core/gimpdrawable-preview.c (gimp_drawable_preview_private): 400 implement it using gimp_drawable_get_sub_preview(). Removes 401 massive code duplication introduced by yesterday's fix. 402 4032004-12-11 Kevin Cozens <kcozens@cvs.gimp.org> 404 405 * plug-ins/script-fu/scripts/copy-visible.scm: Apply the layer mask 406 when copying a single layer with a layer mask. Fixes bug #138662. 407 408 * plug-ins/script-fu/scripts/t-o-p-logo.scm: Removed ' character. 409 4102004-12-11 Sven Neumann <sven@gimp.org> 411 412 * INSTALL 413 * NEWS 414 * README: updates for the GIMP 2.2.0 release. 415 4162004-12-11 Sven Neumann <sven@gimp.org> 417 418 * plug-ins/common/unsharp.c: got rid of a global variable. 419 420 * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): more changes 421 to restore the gimp-2.0 behaviour. 422 4232004-12-11 Michael Natterer <mitch@gimp.org> 424 425 * app/core/gimpdrawable-preview.[ch]: added new function 426 gimp_drawable_get_sub_preview() which returns a scaled preview of 427 a part of a drawable. 428 429 (gimp_drawable_preview_scale): made it work with srcPR.x and 430 srcPR.y being != 0. 431 432 * app/core/gimpimage-preview.c (gimp_image_get_new_preview) 433 * app/widgets/gimpviewrendererdrawable.c 434 (gimp_view_renderer_drawable_render): if the area of the drawable 435 preview is more than 4 times larger than the drawable itself (evil 436 heuristic, but seems to work fine), use above function to get a 437 sub-preview of the drawable instead of getting an insanely large 438 preview of the whole drawable just to use a small part of it. 439 Fixes bug #142074. 440 441 * app/core/gimpimage-preview.c (gimp_image_get_new_preview): 442 optimized by skipping layers which do not intersect with the 443 canvas. 444 4452004-12-11 Sven Neumann <sven@gimp.org> 446 447 * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): do actually 448 change the bumpmap drawable. Fixes bug #160985, hopefully without 449 reopening bug #158494. 450 4512004-12-11 Sven Neumann <sven@gimp.org> 452 453 * configure.in: set version to 2.2.0. 454 455 * tools/Makefile.am 456 * tools/authorsgen/Makefile.am 457 * tools/authorsgen/authorsgen.pl 458 * tools/authorsgen/contributors: removed authorsgen, a perl script 459 that used to be used to create AUTHORS and authors.h. 460 461 * Makefile.am 462 * authors.dtd 463 * authors.xml: added a simple XML file that lists authors and 464 contributors and a DTD to validate it. 465 466 * authors.xsl: a stylesheet to generate AUTHORS from authors.xml. 467 468 * app/dialogs/Makefile.am 469 * app/dialogs/authors.xsl: a stylesheet to generate authors.h from 470 authors.xml. 471 472 * app/dialogs/authors.h: regenerated. 473 474 * app/dialogs/about-dialog.c: added a const modifier. 475 4762004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> 477 478 * app/widgets/gimphistogrameditor.c: make histogram editor, 479 and therefore histogram dialog, use the selection. Should 480 resolve bug #72959. 481 482 * app/core/gimpdrawable-histogram.h: remove trailing whitespace. 483 4842004-12-10 Manish Singh <yosh@gimp.org> 485 486 * app/widgets/gimpdatafactoryview.c 487 * app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp() 488 4892004-12-10 Michael Natterer <mitch@gimp.org> 490 491 * app/widgets/gimpdatafactoryview.c 492 (gimp_data_factory_view_tree_name_edited) 493 * app/widgets/gimpitemtreeview.c 494 (gimp_item_tree_view_name_edited) 495 * app/widgets/gimptemplateview.c 496 (gimp_template_view_tree_name_edited): call gimp_object_set_name() 497 or gimp_item_rename() only if the item's name has actually changed 498 and restore the old text otherwise. Fixes one instance of "name is 499 not updated correctly after editing" for which I blamed GTK+ in 500 bug #145463 :-) The other instances should be fixed in GTK+ HEAD 501 and are imho unfixable with GTK+ 2.4. 502 5032004-12-10 Michael Natterer <mitch@gimp.org> 504 505 * app/widgets/gimpcontainertreeview.c 506 (gimp_container_tree_view_clear_items): clear all viewable cell 507 renderers so they don't keep pointers to layers/masks which don't 508 exist any more. Fixes the additional problem in bug #148852 but 509 not the bug itself. 510 5112004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> 512 513 * app/core/gimpbrushpipe.c (gimp_brush_pipe_select_brush): 514 Don't initialize a new random number generator every time a brush 515 is selected from a pipe. Fixes bug #148205). 516 5172004-12-09 DindinX <dindinx@gimp.org> 518 519 * plug-ins/common/cartoon.c: marked the menu entry for translation 520 (reported by Zigomar) 521 5222004-12-09 Michael Natterer <mitch@gimp.org> 523 524 * app/dialogs/print-size-dialog.c 525 * app/widgets/gimpsizebox.c: set a focus_chain on the size_entries 526 so the focus order is width->height->chain->unitmenu and not 527 width->chain->height->unitmenu. 528 529 * app/widgets/gimptemplateeditor.c: changed focus_chain code to 530 work like above (cosmetics). 531 5322004-12-09 Sven Neumann <sven@gimp.org> 533 534 * app/gui/splash.c (splash_update): only expose the area of the 535 window that actually changed. 536 537 * app/plug-in/plug-in-rc.c (plug_in_rc_write): changed the header 538 and footer to be more in line with the other rc files. 539 5402004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> 541 542 * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed): 543 Previous fix only worked if units were inches -- now seems to 544 work for all units. (fixes #159273 ?) 545 5462004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> 547 548 * plug-ins/common/randomize.c: Changed algorithm for Pick and 549 Slur to treat all channels within a pixel in the same way; 550 intended to fix bug #72852. 551 5522004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> 553 554 * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed): 555 fixed kludgy use of size entry, seems to fix bug #159273. 556 5572004-12-08 Michael Natterer <mitch@gimp.org> 558 559 * app/widgets/gimpuimanager.[ch]: renamed 560 gimp_ui_manager_get_action() to gimp_ui_manager_find_action(). 561 562 * app/widgets/gimpcolormapeditor.c 563 * app/widgets/gimpitemtreeview.c 564 * app/widgets/gimppaletteeditor.c 565 * app/widgets/gimptoolbox.c 566 * app/widgets/gimptooloptionseditor.c 567 * app/display/gimpdisplayshell-close.c: changed accordingly. 568 569 (this change is quite useless as it stands, but will help keeping 570 the diff between 2.2 and 2.3 small as soon as we're branched). 571 572 * app/widgets/gimpcolormapeditor.c 573 (gimp_colormap_preview_button_press): invoke the "edit-color", not 574 "new-color" action upon double click. 575 576 (palette_editor_select_entry): update the ui manager after 577 selecting the entry so the entry-specific actions become sensitive 578 if there was no entry selected before. 579 5802004-12-08 Michael Natterer <mitch@gimp.org> 581 582 * app/widgets/gimppropwidgets.[ch]: added new prop_widget 583 gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore 584 and allows to create views on int properties with arbitrary sets 585 of values (not just enums). 586 587 * app/widgets/gimpcontrollereditor.c 588 (gimp_controller_editor_constructor): added support for generic 589 combo boxes controlled exclusively by controller properties: if an 590 int property "foo" is followed by an object property "foo-values" 591 and the contained object is a GimpIntStore, use that store as 592 model for selecting "foo"'s values using 593 gimp_prop_int_combo_box_new(). 594 595 (Allows for more flexible controller configuration, the actual use 596 case in the midi controller is still work in progress). 597 5982004-12-06 Sven Neumann <sven@gimp.org> 599 600 * tools/authorsgen/contributors: removed duplicate entry for Roman. 601 602 * AUTHORS 603 * app/dialogs/authors.h: regenerated. 604 6052004-12-06 Roman Joost <romanofski@gimp.org> 606 607 * tools/authorsgen/contributors: added Róman Joost to 608 contributors 609 6102004-12-06 Michael Natterer <mitch@gimp.org> 611 612 * app/tools/gimptransformtool.c: applied patch from Sven Neumann 613 which removes code that prevents layers with mask from being 614 transformed. 615 616 * app/tools/gimptransformtool.[ch]: added "gboolean mask_empty" 617 parameter to GimpTransformTool::transform(). Needed because the 618 selection gets cleared by cutting from the drawable and we need 619 the selection's state before that cutting. 620 621 (gimp_transform_tool_doit): pass "mask_empty" to 622 GimpTransformTool::transform(): 623 624 * app/tools/gimptransformtool.c (gimp_transform_tool_real_transform) 625 * app/tools/gimpfliptool.c (gimp_flip_tool_transform): when 626 transforming a layer with mask and there is no selection, 627 transform the mask just as if it was a linked item. 628 Fixes bug #143837 and bug #159697. 629 6302004-12-05 Sven Neumann <sven@gimp.org> 631 632 * app/core/gimp-transform-utils.c (gimp_transform_matrix_flip_free): 633 applied patch from Joao S. O. Bueno that fixes bug #160339. 634 6352004-12-05 Sven Neumann <sven@gimp.org> 636 637 * plug-ins/help/domain.c 638 * plug-ins/help/gimp-help-lookup.c 639 * plug-ins/help/help.[ch]: if the help files are not installed, 640 uninstall the temporary procedure and quit. Fixes bug #160258. 641 6422004-12-05 Sven Neumann <sven@gimp.org> 643 644 * plug-ins/common/lic.c: applied patch from Joao S. O. Bueno that 645 sets a lower limit for the filter length (bug #160121). The patch 646 also makes the plug-in work on drawables with alpha channel. 647 6482004-12-05 Sven Neumann <sven@gimp.org> 649 650 * plug-ins/common/wmf.c: applied patch from Karine Proot that 651 limits the size of the preview in the WMF loader (bug #133521). 652 6532004-12-04 DindinX <dindinx@gimp.org> 654 655 * plug-ins/gfig/gfig-arc.c 656 * plug-ins/gfig/gfig-arc.h 657 * plug-ins/gfig/gfig-bezier.c 658 * plug-ins/gfig/gfig-bezier.h 659 * plug-ins/gfig/gfig-circle.c 660 * plug-ins/gfig/gfig-circle.h 661 * plug-ins/gfig/gfig-dobject.c 662 * plug-ins/gfig/gfig-dobject.h 663 * plug-ins/gfig/gfig-ellipse.c 664 * plug-ins/gfig/gfig-ellipse.h 665 * plug-ins/gfig/gfig-line.c 666 * plug-ins/gfig/gfig-line.h 667 * plug-ins/gfig/gfig-poly.c 668 * plug-ins/gfig/gfig-poly.h 669 * plug-ins/gfig/gfig-preview.c 670 * plug-ins/gfig/gfig-spiral.c 671 * plug-ins/gfig/gfig-spiral.h 672 * plug-ins/gfig/gfig-star.c 673 * plug-ins/gfig/gfig-star.h: updating a object is now a virtual 674 function. 675 6762004-12-03 Michael Natterer <mitch@gimp.org> 677 678 * app/core/gimpimage-undo-push.c (undo_pop_layer): when removing 679 the floating selection, call gimp_drawable_invalidate_boundary() 680 *before* setting gimage->floating_sel to NULL because otherwise 681 gimp_display_shell_selection_invis() won't clear the correct 682 selection bounds and leave garbage on screen. Fixes bug #160247. 683 6842004-12-02 Michael Natterer <mitch@gimp.org> 685 686 * app/actions/tool-options-actions.c 687 (tool_options_actions_update_presets): don't forget to initialize 688 the "value_variable" boolean of GimpEnumActionEntry. Fixes myriads 689 of warnings about wrong values for boolean properties. 690 691 * app/actions/file-actions.c (file_actions_setup): same 692 here. Fixes nothing but is cleaner. 693 6942004-12-02 Simon Budig <simon@gimp.org> 695 696 * app/vectors/gimpvectors.c: Fixed stupid typo that caused 697 distorted vectors on scaling after resizing. Spotted by 698 Joao S. O. Bueno. 699 700 Fixes bug #157852. 701 7022004-12-01 Sven Neumann <sven@gimp.org> 703 704 * autogen.sh: rephrased the warning that is shown when the 705 intltool check fails. 706 7072004-12-01 Michael Natterer <mitch@gimp.org> 708 709 * app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved 710 error message about missing XML files. 711 7122004-12-01 Michael Natterer <mitch@gimp.org> 713 714 * app/display/gimpdisplayshell-appearance.c 715 * app/display/gimpdisplayshell.c 716 * app/widgets/gimpdockable.c 717 * app/widgets/gimptexteditor.c 718 * app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get() 719 actually returns something. Prevents crashes caused by missing 720 ui manager xml files. Fixes bug #159346. 721 7222004-12-01 Michael Natterer <mitch@gimp.org> 723 724 * app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need 725 to update the ui manager here, the parent class already does it. 726 7272004-11-30 DindinX <dindinx@gimp.org> 728 729 * plug-ins/gfig/README: removed some very obsolete stuff. 730 731 * plug-ins/gfig/gfig-arc.c 732 * plug-ins/gfig/gfig-arc.h 733 * plug-ins/gfig/gfig-bezier.c 734 * plug-ins/gfig/gfig-bezier.h 735 * plug-ins/gfig/gfig-circle.c 736 * plug-ins/gfig/gfig-circle.h 737 * plug-ins/gfig/gfig-dobject.c: small cleanups 738 7392004-11-30 Michael Natterer <mitch@gimp.org> 740 741 * app/gui/themes.c (themes_init): use gtk_rc_parse() instead of 742 gtk_rc_add_default_file() to add ~/.gimp-2.2/themerc to the list 743 of files parsed by GTK+ because the latter works only before 744 gtk_init(). Fixes bug #155963. 745 7462004-11-30 Michael Natterer <mitch@gimp.org> 747 748 * app/dialogs/print-size-dialog.c: reordered prototypes to match 749 order of implementations. 750 7512004-11-30 Sven Neumann <sven@gimp.org> 752 753 * app/sanity.c: we check for the same version of freetype on all 754 platforms, no need for an ifdef here. 755 7562004-11-30 Sven Neumann <sven@gimp.org> 757 758 * libgimp/gimpexport.c: some more HIG-ification tweaks to the 759 Export dialogs. 760 7612004-11-30 Michael Natterer <mitch@gimp.org> 762 763 * app/widgets/gimpactiongroup.c 764 (gimp_action_group_set_action_color) 765 (gimp_action_group_set_action_color): allow to set color and 766 viewable to NULL, GimpAction handles this nicely. Fixes warnings 767 some foo_actions_update() functions were triggering. 768 7692004-11-30 DindinX <dindinx@gimp.org> 770 771 * plug-ins/gfig/*[ch]: code cleanup 772 7732004-11-29 Michael Natterer <mitch@gimp.org> 774 775 * tools/pdbgen/pdb/display.pdb: make it work as documented (fail 776 if the new_image already has a display). Also fail if the 777 old_image doesn't have any display (changed docs accordingly). 778 On success, take over the initial reference count of the new 779 image, just as the gimp_display_new() PDB wrapper does. 780 Fixes bug #159051. 781 782 * app/pdb/display_cmds.c 783 * libgimp/gimpdisplay_pdb.c: regenerated. 784 7852004-11-29 Sven Neumann <sven@gimp.org> 786 787 * app/file/file-save.c (file_save_as): when the image filename 788 changes, forget the filename that was last used with "save-a-copy". 789 7902004-11-29 Sven Neumann <sven@gimp.org> 791 792 * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback): 793 change the "update" property and notify listeners (in particular 794 GimpDrawablePreview) before invalidating the preview. Plug-ins 795 might (needlessly) look at the property to decide whether they 796 need to redraw. Fixes bug #159816. 797 798 * plug-ins/common/unsharp.c (preview_update): no need to look at 799 the value of the "Preview" toggle. GimpPreview takes care this. 800 8012004-11-29 DindinX <dindinx@gimp.org> 802 803 * plug-ins/gfig/gfig-dialog.c: issue a repaint after the 804 "show previous", "show next" and "show all" callbacks. 805 806 * plug-ins/gfig/gfig-style.c: fixed some comments. 807 8082004-11-29 Sven Neumann <sven@gimp.org> 809 810 * plug-ins/imagemap/imap_preview.c 811 * plug-ins/imagemap/imap_selection.c: undeprecated. 812 8132004-11-28 DindinX <dindinx@gimp.org> 814 815 * plug-ins/gfig/gfig-dobject.c: copy the style of the object when 816 pushing it to the undo stack, so undoing works as expected. 817 8182004-11-28 DindinX <dindinx@gimp.org> 819 820 * plug-ins/gfig/gfig-style.c 821 * plug-ins/gfig/gfig-style.h: create a new function to get the current 822 style instead of using a global pointer for this 823 (gfig_context_get_current_style ()) 824 825 * plug-ins/gfig/gfig-circle.c 826 * plug-ins/gfig/gfig-dialog.c 827 * plug-ins/gfig/gfig-dobject.c 828 * plug-ins/gfig/gfig.h: use this function everywhere it is needed. And 829 remove the current_style field from GfigContext. 830 831 (unrelated): 832 * plug-ins/FractalExplorer/Dialogs.h 833 * plug-ins/FractalExplorer/FractalExplorer.c: small cleanups 834 8352004-11-28 Sven Neumann <sven@gimp.org> 836 837 * plug-ins/gfig/gfig-dialog.c 838 * plug-ins/gfig/gfig-style.[ch] 839 * plug-ins/gfig/gfig.h: removed unused stack of styles. Removed 840 gimp_style from GFigContext. 841 8422004-11-28 Sven Neumann <sven@gimp.org> 843 844 * plug-ins/gfig/gfig.c (run): push a context for GFig. 845 8462004-11-28 DindinX <dindinx@gimp.org> 847 848 * plug-ins/gfig/gfig-dialog.[ch] 849 * plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level. 850 Fixed the style handling when clearing the whole thing and undoing in 851 some very particular cases. The undo part should certainly be redone 852 to some extent. 853 854 Btw, this is the revision 1.10000 of the ChangeLog, yeah! 855 8562004-11-28 Bill Skaggs <weskaggs@primate.ucdavis.edu> 857 858 * plug-ins/gfig/gfig-style.c: make sure PaintType is saved and 859 loaded with the style. 860 8612004-11-28 DindinX <dindinx@gimp.org> 862 863 * plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type 864 field of the default style. 865 866 * plug-ins/gfig/gfig-style.c: don't print an useless error message 867 where no-one can see it when loading an other with no style but use 868 the default style instead. 869 8702004-11-28 Sven Neumann <sven@gimp.org> 871 872 * plug-ins/gfig/gfig-dialog.[ch] 873 * plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit 874 menu. Added a utility function to set the sensitivity of an action 875 by name. Cleaned up action callbacks. 876 877 * plug-ins/gfig/gfig-style.c: minor cleanup. 878 8792004-11-28 DindinX <dindinx@gimp.org> 880 881 * plug-ins/gfig/gfig-arc.c 882 * plug-ins/gfig/gfig-bezier.c 883 * plug-ins/gfig/gfig-circle.c 884 * plug-ins/gfig/gfig-dialog.c 885 * plug-ins/gfig/gfig-ellipse.c 886 * plug-ins/gfig/gfig-line.c 887 * plug-ins/gfig/gfig-poly.c 888 * plug-ins/gfig/gfig-spiral.c 889 * plug-ins/gfig/gfig-star.c: made the class name uppercase since it is 890 used to parse a gfig file. 891 8922004-11-28 Sven Neumann <sven@gimp.org> 893 894 * plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid 895 and Preferences dialogs are only accessed while the dialogs exist. 896 8972004-11-28 Sven Neumann <sven@gimp.org> 898 899 * plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences 900 dialogs singletons and declared them as transient to the GFig 901 window. Don't let them run their own main loop. 902 9032004-11-28 Sven Neumann <sven@gimp.org> 904 905 * plug-ins/gfig/gfig-dialog.c: added a Close menu item to the 906 menubar. Removed help buttons from popup dialogs. Set the same 907 default directory in load and save filechoosers. 908 9092004-11-27 Manish Singh <yosh@gimp.org> 910 911 * tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to 912 avoid perl trying to be so smart that it's stupid. 913 914 * app/pdb/drawable_transform_cmds.c: regenerated. 915 9162004-11-27 Manish Singh <yosh@gimp.org> 917 918 * plug-ins/common/jpeg.c (save_image): thumbnail buffer variable 919 declarations should be guarded under HAVE_EXIF. 920 9212004-11-27 Manish Singh <yosh@gimp.org> 922 923 * plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/, 924 so it doesn't clash with the perl version. 925 926 * plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change. 927 9282004-11-27 Sven Neumann <sven@gimp.org> 929 930 * plug-ins/common/jpeg.c: delay the creation of the display for 931 the export image preview until the user requests a preview. Fixes 932 bug #159376. 933 9342004-11-27 Øyvind Kolås <pippin@gimp.org> 935 936 * libgimp/gimpexport.c: minor layout adjustments for HIG compliance. 937 9382004-11-27 Kevin Cozens <kcozens@cvs.gimp.org> 939 940 * plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth 941 to be integer values. Changed default for Outer teeth to give a 942 more interesting image. Detabified file. Fixes bug #158448. 943 9442004-11-27 Sven Neumann <sven@gimp.org> 945 946 * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc): 947 don't look at the menu path to determine if the script is 948 image-based. Instead look at the number of parameters we are being 949 called with. 950 9512004-11-27 Sven Neumann <sven@gimp.org> 952 953 * app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic 954 as suggested in bug #159632. 955 9562004-11-27 Sven Neumann <sven@gimp.org> 957 958 * plug-ins/common/tiff.c (save_image): tell the user that we can't 959 handle indexed images with alpha channel (bug #159600). 960 9612004-11-27 Sven Neumann <sven@gimp.org> 962 963 * app/main.c 964 * app/widgets/gimpenumstore.h 965 * app/widgets/gimpunitstore.c 966 * plug-ins/common/retinex.c: applied patch by Tim Mooney that 967 removes extraneous ; 968 9692004-11-27 Sven Neumann <sven@gimp.org> 970 971 * plug-ins/common/wmf.c (run): applied patch by Tim Mooney that 972 increase the size of values[] to accomodate the use of 973 file_wmf_load_thumb (bug #159601). 974 9752004-11-27 Sven Neumann <sven@gimp.org> 976 977 * tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs. 978 979 * libgimp/gimpdrawable_pdb.c 980 * tools/pdbgen/pdb/drawable.pdb: regenerated. 981 9822004-11-27 Sven Neumann <sven@gimp.org> 983 984 * plug-ins/winicon/icosave.c 985 * plug-ins/winicon/main.[ch]: moved code around. 986 9872004-11-26 Manish Singh <yosh@gimp.org> 988 989 * plug-ins/common/dog.c: make sure the preview image type matches 990 the source image type. 991 9922004-11-26 Sven Neumann <sven@gimp.org> 993 994 * plug-ins/winicon/icosave.c: don't fiddle with the source image, 995 a save plug-in should save, nothing else. 996 997 * plug-ins/winicon/main.[ch]: handle all sorts of image types. 998 Fixes bug #157803. 999 10002004-11-26 Sven Neumann <sven@gimp.org> 1001 1002 * tools/pdbgen/pdb/drawable.pdb: fixed docs for 1003 gimp_drawable_type_with_alpha(). 1004 1005 * app/pdb/drawable_cmds.c 1006 * libgimp/gimpdrawable_pdb.c: regenerated. 1007 10082004-11-26 Sven Neumann <sven@gimp.org> 1009 1010 * plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf) 1011 * plug-ins/winicon/icodialog.c 1012 * plug-ins/winicon/icoload.c 1013 * plug-ins/winicon/icosave.c: fixed drawable handling. This 1014 plug-in is still a complete mess and needs a lot more work. 1015 10162004-11-26 Sven Neumann <sven@gimp.org> 1017 1018 * app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only 1019 show the Incremental toggle for tools that use it (bug #159306). 1020 10212004-11-26 Sven Neumann <sven@gimp.org> 1022 1023 * app/core/gimpdocumentlist.c (gimp_document_list_deserialize): 1024 don't add documents w/o a name to the list. Fixes bug #159510. 1025 1026 * app/core/gimpdrawable.c (gimp_drawable_resize): extended the 1027 check to take the offsets into account as well. 1028 10292004-11-25 Manish Singh <yosh@gimp.org> 1030 1031 * plug-ins/common/dog.c: Add the temporary layers to the image, so 1032 things work. Fixes bug #158895. 1033 1034 * plug-ins/common/iwarp.c: Fix same naughtiness as above. There's 1035 other naughtiness still though. 1036 1037 * plug-ins/common/sunras.c: use gboolean for byte2bit invert argument. 1038 10392004-11-25 Manish Singh <yosh@gimp.org> 1040 1041 * plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within 1042 PreviewPersistent, instead of an automatic variable in save_image. 1043 Fixes bug #159076. 1044 10452004-11-25 Simon Budig <simon@gimp.org> 1046 1047 * modules/controller_linux_input.c: Add some sample code to retrieve 1048 the name of the connected MIDI device (ALSA). 1049 Do not set the "name" when connected to Alsa, since snd_seq_name() 1050 returns an uninteresting name. 1051 10522004-11-24 Michael Natterer <mitch@gimp.org> 1053 1054 * app/gui/gui.c (gui_display_changed): if the active display 1055 becomes NULL (e.g. by closing a view), don't leave the user 1056 context with an image but no display. Instead, try to find another 1057 display of the same image and if that fails set the image to NULL. 1058 1059 Prevents the various foo_actions_update() functions from being 1060 called with a NULL display while there is still an active image in 1061 the context. 1062 1063 Fixes bug #159304. 1064 1065 (Removed #warning about being misplaced from that function because 1066 it's a typical piece of ugly glue code that belongs exactly here). 1067 10682004-11-24 Simon Budig <simon@gimp.org> 1069 1070 * modules/controller_linux_input.c: Accept >= 0 return values of the 1071 ioctl() to figure out the device name. Apparently it is the number of 1072 bytes written to the string, so we might omit the strlen() following, 1073 but I don't like to rely on that... 1074 10752004-11-24 Michael Natterer <mitch@gimp.org> 1076 1077 * libgimpwidgets/gimpcontroller.[ch]: guarded the whole header 1078 with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no 1079 fixed API yet. Added a "state" property bacause "name" was abused 1080 as the controller's state. Added "help_domain" to the controller 1081 class. 1082 1083 * libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h 1084 1085 * modules/controller_linux_input.c 1086 * modules/controller_midi.c: set the "name" property to the name 1087 retrieved from the device, or to a default string if no name is 1088 available. Store the status in the "state" property. Added and 1089 changed some strings, but it's better to have the controller 1090 strings untranslated than to have no tooltips at all or misleading 1091 labels. 1092 1093 * app/widgets/gimpcontrollerkeyboard.c 1094 * app/widgets/gimpcontrollerwheel.c: set default strings for both. 1095 1096 * app/widgets/gimpcontrollereditor.c: added a GUI for the "state" 1097 property. 1098 1099 * app/widgets/gimpcontrollerkeyboard.h 1100 * app/widgets/gimpcontrollerwheel.h 1101 * app/widgets/gimpcontrollerinfo.c 1102 * app/widgets/gimpcontrollers.c: #define 1103 GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files 1104 above). 1105 1106 * app/widgets/gimphelp-ids.h: added the IDs of all controller 1107 modules and also of all other modules. The defines are not 1108 actually used, but this file is the canonical place to collect all 1109 the core's help IDs. 1110 11112004-11-23 Sven Neumann <sven@gimp.org> 1112 1113 * app/core/gimp-templates.[ch] 1114 * app/dialogs/user-install-dialog.c: merge the migrated user 1115 templaterc with the system templaterc so the users who have used 1116 gimp-2.0 before get our changes to the default templates. 1117 11182004-11-23 Michael Natterer <mitch@gimp.org> 1119 1120 * app/widgets/gimpwidgets-utils.[ch]: added new function 1121 gimp_toggle_button_set_visible() which can be used as "toggled" 1122 callback on a GtkToggleButton and sets a widget (in)visible 1123 according to the toggle's "active" state. 1124 1125 * app/tools/gimpblendoptions.c 1126 * app/tools/gimppaintoptions-gui.c 1127 * app/tools/gimpselectionoptions.c: use it to hide (rather than 1128 just insensitize) the seldomly used "Feather edges", "Autoshrink 1129 selection", "Adaptive supersampling", "Fade out" and "Use color 1130 from gradient" widgets when their enabling toggle is unchecked. 1131 Makes the affected tool options much less crowded and noisy in 1132 their default appearance. Fixes bug #159008. 1133 11342004-11-23 Michael Natterer <mitch@gimp.org> 1135 1136 * app/menus/plug-in-menus.c (plug_in_menus_add_proc): create 1137 dynamic sub-menus using a separate, ui-manager-global merge_id 1138 instead of the procedure's merge_id. Has the effect that the ui 1139 manager keeps around these sub-menus forever, even if the 1140 procedure that initially registered them is unregistered. 1141 Fixes menu ordering after Script-Fu->Refresh. 1142 11432004-11-23 Michael Natterer <mitch@gimp.org> 1144 1145 * app/core/gimpparasitelist.c: cosmetics, untabified. 1146 1147 * libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s 1148 to all functions. 1149 1150 (gimp_pixpipe_params_parse): changed "gchar*" param to "const 1151 gchar*" (sortof API change, but these files are most probably only 1152 used by GIMP itself). Still uses strtok() on the internal copy, 1153 but at least not on the passed string. 1154 1155 * plug-ins/common/csource.c 1156 * plug-ins/common/gif.c 1157 * plug-ins/common/gih.c 1158 * plug-ins/common/jpeg.c 1159 * plug-ins/common/png.c 1160 * plug-ins/common/tiff.c: use parasite getters instead of 1161 accessing the scruct members directly. Always use g_strndup() 1162 instead of just g_strdup() to get strings stored in parasites 1163 because there is no guarantee that they are nul-terminated. 1164 11652004-11-23 Sven Neumann <sven@gimp.org> 1166 1167 * plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do 1168 actually use a save dialog here. Fixes bug #159194. 1169 11702004-11-23 Sven Neumann <sven@gimp.org> 1171 1172 * app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if 1173 the size doesn't change. This keeps text layers from being 1174 modified when an image is cropped and the layer is entirely inside 1175 the cropped area. 1176 1177 * menus/image-menu.xml.in: put the Quit item back for now. We 1178 should think about this again in the next development cycle. 1179 11802004-11-22 Kevin Cozens <kcozens@cvs.gimp.org> 1181 1182 * plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect 1183 comparison in if statement. Partial(?) fix for bug #138662. 1184 11852004-11-22 Manish Singh <yosh@gimp.org> 1186 1187 * plug-ins/pygimp/Makefile.am 1188 * plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears. 1189 1190 * plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout 1191 tweaks. 1192 11932004-11-22 Michael Natterer <mitch@gimp.org> 1194 1195 * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init): 1196 always create the event mapping table. Fixes tons of warnings and 1197 non-functional controller mapping dialog when an empty controller 1198 was deserialized from controllerrc. Spotted by drc. 1199 12002004-11-22 Sven Neumann <sven@gimp.org> 1201 1202 * app/app_procs.c (app_exit_after_callback): call base_exit() 1203 before quitting the application using exit(). Fixes bug #159019. 1204 1205 * app/base/tile-swap.c: moved the warning about a non-empty swap 1206 file into #ifdef GIMP_UNSTABLE ... #endif. 1207 12082004-11-22 DindinX <dindinx@gimp.org> 1209 1210 * plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising 1211 check box. Reported by Zigomar. 1212 12132004-11-22 Michael Natterer <mitch@gimp.org> 1214 1215 * plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs 1216 by their menu_paths *and* the procedure's menu_labels. Fixes menu 1217 item sorting after "Refresh". 1218 12192004-11-22 Michael Natterer <mitch@gimp.org> 1220 1221 * app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new): 1222 added a "menu_factory" parameter instead of trying to get it from 1223 the toplevel GimpDock (which does not exists if the tool options 1224 dialog does not exist). Fixes bug #159071. 1225 1226 * app/tools/gimptexttool.c (gimp_text_tool_editor): pass the 1227 menu_factory. 1228 1229 * app/dialogs/dialogs.c (dialogs_init): pass the global menu 1230 factory also when constructing the "toplevel" dialog factory so 1231 the above works. 1232 12332004-11-22 Michael Natterer <mitch@gimp.org> 1234 1235 * libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup() 1236 instead of g_strdup() if a length was passed. 1237 1238 * app/dialogs/info-window.c: g_strndup() the comment parasite's 1239 data and pass -1 as length to gimp_any_to_utf8() so we don't 1240 encounter the questionable (buggy?) behavior of g_utf8_validate() 1241 to fail upon finding '\0' within the "length" passed. 1242 Fixes bug #159051. 1243 12442004-11-22 Michael Natterer <mitch@gimp.org> 1245 1246 * plug-ins/common/struc.c: applied patch from Wolfgang Hofer 1247 which makes the plug-in use its procedure name for 1248 storing the "last_vals" struct. Fixes bug #159028. 1249 1250 * plug-ins/common/tileit.c: ditto. Fixes bug #159029. 1251 12522004-11-22 DindinX <dindinx@gimp.org> 1253 1254 * plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines 1255 half-selected. 1256 12572004-11-22 Sven Neumann <sven@gimp.org> 1258 1259 * app/dialogs/file-open-location-dialog.c: changed border-size of 1260 GimpContainerEntry to 0. 1261 12622004-11-21 Sven Neumann <sven@gimp.org> 1263 1264 * tools/gimp-remote.c: added --no-splash command-line option that 1265 is passed to gimp. Addresses Debian bug report #277989. 1266 1267 * docs/gimp-remote.1.in: document the new option. 1268 12692004-11-21 Manish Singh <yosh@gimp.org> 1270 1271 * configure.in: reverted previous change, as not all the lv.pos are 1272 in CVS yet. 1273 12742004-11-21 Peteris Krisjanis <pecisk@gmail.com> 1275 1276 * configure.in: Added Latvian (lv) language support to ALL_LINGUAS. 1277 12782004-11-21 Kevin Cozens <kcozens@cvs.gimp.org> 1279 1280 * plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM 1281 which makes the script work layers that have their top-left corner 1282 at a position other than the top-left corner of the image. 1283 Fixes bug #158863. 1284 12852004-11-21 DindinX <dindinx@gimp.org> 1286 1287 * plug-ins/gfig/gfig-arc.c 1288 * plug-ins/gfig/gfig-bezier.c 1289 * plug-ins/gfig/gfig-circle.c 1290 * plug-ins/gfig/gfig-dialog.c 1291 * plug-ins/gfig/gfig-dobject.c 1292 * plug-ins/gfig/gfig-ellipse.c 1293 * plug-ins/gfig/gfig-line.c 1294 * plug-ins/gfig/gfig-poly.c 1295 * plug-ins/gfig/gfig-spiral.c 1296 * plug-ins/gfig/gfig-star.c 1297 * plug-ins/gfig/gfig.h: makes which object is selected more obvious by 1298 using filled handles for the selected object. Not perfect, but 1299 certainly a good hint. 1300 13012004-11-21 DindinX <dindinx@gimp.org> 1302 1303 * plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the 1304 realize callback of the preview, so the gray gc of the grid works 1305 again. Reported by Zigomar. 1306 1307 * plug-ins/gfig/gfig-dobject.c 1308 * plug-ins/gfig/gfig-preview.h 1309 * plug-ins/gfig/gfig-spiral.h 1310 * plug-ins/gfig/gfig-star.h 1311 * plug-ins/gfig/notes.txt: small cosmetics fixes. 1312 13132004-11-21 Sven Neumann <sven@gimp.org> 1314 1315 * plug-ins/common/compose.c 1316 * plug-ins/common/decompose.c: transfer the image resolution to 1317 newly created images. 1318 13192004-11-21 Sven Neumann <sven@gimp.org> 1320 1321 * plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change 1322 that Hans Breuer committed here, probably accidentally. 1323 1324 * plug-ins/script-fu/script-fu.c 1325 * plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There 1326 is indeed a Script-Fu server on Win32. 1327 13282004-11-21 Sven Neumann <sven@gimp.org> 1329 1330 * menus/image-menu.xml.in: removed "Quit" from the image menu. 1331 13322004-09-21 Hans Breuer <hans@breuer.org> 1333 1334 * app/dialogs/makefile.msc : [new file] 1335 app/dialogs/Makefile.am : added to EXTRA_DIST 1336 1337 * **/makefile.msc app/gimpcore.def : updated 1338 1339 * app/gimp.rc : let wilber be first 1340 1341 * app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either 1342 1343 * libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib 1344 1345 * libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32 1346 1347 * plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h 1348 1349 * plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c : 1350 there is no script-fu-server on win32 1351 13522004-11-21 Michael Schumacher <schumaml@cvs.gnome.org> 1353 1354 * plug-ins/script-fu/scripts/addborder.scm: first resize the 1355 image, then add the border layer and then fill it 1356 13572004-11-20 Kevin Cozens <kcozens@cvs.gimp.org> 1358 1359 * plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in 1360 script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's. 1361 13622004-11-20 Michael Natterer <mitch@gimp.org> 1363 1364 * plug-ins/script-fu/script-fu-scripts.c: renamed variable 1365 "script_list" to "script_tree" because it's a GTree. 1366 1367 (script_fu_remove_script): g_list_free() the right list (don't 1368 leak all lists of scripts at the tree leaves). 1369 13702004-11-20 Sven Neumann <sven@gimp.org> 1371 1372 * Made 2.2-pre2 release. 1373 13742004-11-20 Sven Neumann <sven@gimp.org> 1375 1376 * plug-ins/common/glob.c: added an (optional) parameter that 1377 allows to request the output in the filesystem encoding. 1378 13792004-11-19 Sven Neumann <sven@gimp.org> 1380 1381 * plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare): 1382 compare the menu paths, not the struct pointers. 1383 13842004-11-19 Sven Neumann <sven@gimp.org> 1385 1386 * plug-ins/common/glob.c: added a naive glob() implementation 1387 which handles the most common use case and is certainly better 1388 than nothing. Closes bug #143661 again. 1389 13902004-11-19 Sven Neumann <sven@gimp.org> 1391 1392 * libgimp/gimp.c: converted a g_warning() to g_printerr(). 1393 13942004-11-19 Sven Neumann <sven@gimp.org> 1395 1396 * plug-ins/common/xpm.c: just some minor code cleanup. 1397 13982004-11-19 Sven Neumann <sven@gimp.org> 1399 1400 * plug-ins/gfig/gfig-dialog.c 1401 * plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a 1402 single one. 1403 14042004-11-19 Sven Neumann <sven@gimp.org> 1405 1406 * plug-ins/common/noisify.c: applied a (modified) patch that adds 1407 the possibility to correlate the noise with the signal. Adds the 1408 new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700. 1409 1410 * plug-ins/helpbrowser/dialog.c: set a reasonable default size. 1411 14122004-11-19 Sven Neumann <sven@gimp.org> 1413 1414 * plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of 1415 fread(). Unfortunately this slowed down the plug-in again. 1416 Disabled the code that reads the pipe to the end. This brings it 1417 back to speed. Seems to work fine for me, let's see if this causes 1418 problems for anyone... 1419 14202004-11-19 Sven Neumann <sven@gimp.org> 1421 1422 * plug-ins/script-fu/scripts/selection-round.scm: moved into the 1423 <Image>/Select/Modify menu now that we can safely use placeholders 1424 from Script-Fu. 1425 14262004-11-19 Michael Natterer <mitch@gimp.org> 1427 1428 * tools/pdbgen/lib.pl 1429 * tools/pdbgen/stddefs.pdb: added support for deprecated procedures 1430 without any replacement. 1431 1432 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added 1433 a special warning for procedures without replacement. 1434 1435 * tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image() 1436 without any replacement and made it a nop (which fails if the 1437 passed image is different from the drawable's image). It's not 1438 needed any longer since 2.0 and moreover dangerous to use. 1439 1440 * app/pdb/drawable_cmds.c 1441 * libgimp/gimpdrawable_pdb.[ch]: regenerated. 1442 1443 * app/core/gimpitem.c (gimp_item_set_image): replaced assertion 1444 for gimp_item_is_floating() by !gimp_item_is_attached(). The 1445 former warned when adding a layer with already added mask to the 1446 image (which is a perfectly valid operation). 1447 14482004-11-18 Sven Neumann <sven@gimp.org> 1449 1450 * plug-ins/common/wmf.c: added a thumbnail load procedure 1451 (bug #158193). 1452 14532004-11-18 Michael Natterer <mitch@gimp.org> 1454 1455 Script-Fu string cleanup/simplification: apply the same fix for 1456 menu path translation that was done for plug-ins a while ago. 1457 1458 * plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use 1459 gimp_plugin_menu_register() on the "Refresh" temp_proc. 1460 1461 * plug-ins/script-fu/scripts/*.scm: ported all scripts to use 1462 script-fu-menu-register and pass just the menu label in 1463 script-fu-register. Cleaned up all register calls to share a 1464 somewhat similar formatting. 1465 14662004-11-18 Sven Neumann <sven@gimp.org> 1467 1468 * plug-ins/common/postscript.c: changed the default to load only 1469 the first page of the document and added a tooltip describing how 1470 to specify what pages to get. 1471 14722004-11-18 Sven Neumann <sven@gimp.org> 1473 1474 * app/file/file-open.c (file_open_thumbnail): fixed check for 1475 number of return values. 1476 14772004-11-18 Sven Neumann <sven@gimp.org> 1478 1479 * plug-ins/common/postscript.c: speed up loading of multi-page 1480 documents significantly by skipping in large chunks instead of using 1481 fgetc() to crawl through the stream. 1482 14832004-11-18 Sven Neumann <sven@gimp.org> 1484 1485 * app/file/file-open.c (file_open_thumbnail): check the number of 1486 return values. Only retrieve width and height if the thumbnail 1487 load procedure does actually provide this information. 1488 1489 * plug-ins/common/postscript.c: added a procedure to load a 1490 thumbnail. For now it only renders the first page of the 1491 document at low resolution. It should be extended to load an 1492 embedded thumbnail if one is available. 1493 1494 * plug-ins/common/jpeg.c 1495 * plug-ins/common/svg.c: no need to register a menu label for the 1496 thumbnail loaders. Allocate the return_vals array large enough to 1497 hold all return values. 1498 14992004-11-18 Michael Natterer <mitch@gimp.org> 1500 1501 * app/widgets/gimpenumaction.[ch]: added boolean property 1502 "value-variable" which specifies if the GimpEnumAction::selected() 1503 signal may be emitted with arbirtary values (value-variable = TRUE) 1504 or *only* with enum_action->value (value-variable = FALSE). 1505 1506 * app/widgets/gimpactiongroup.[ch]: added "gboolean 1507 value_variable" to GimpEnumActionEntry and set it in 1508 gimp_action_group_add_enum_actions(). 1509 1510 * app/actions/channels-actions.c 1511 * app/actions/colormap-editor-actions.c 1512 * app/actions/context-actions.c 1513 * app/actions/drawable-actions.c 1514 * app/actions/edit-actions.c 1515 * app/actions/error-console-actions.c 1516 * app/actions/gradient-editor-actions.c 1517 * app/actions/image-actions.c 1518 * app/actions/layers-actions.c 1519 * app/actions/palette-editor-actions.c 1520 * app/actions/plug-in-actions.c 1521 * app/actions/vectors-actions.c 1522 * app/actions/view-actions.c: set "variable" to FALSE for all enum 1523 actions except those which are used with the GIMP_ACTION_SELECT_SET 1524 voodoo. 1525 1526 * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped): 1527 fall back to gtk_action_activate() if the action specified in a 1528 GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables 1529 triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events 1530 (like midi note-on and note-off). 1531 15322004-11-18 Michael Natterer <mitch@gimp.org> 1533 1534 * acinclude.m4: pasted the complete alsa.m4 so compiling from 1535 CVS doesn't require alsa.m4 to be installed. 1536 1537 * configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA 1538 if found. 1539 1540 * modules/Makefile.am: build controller_midi with ALSA_CFLAGS 1541 and ALSA_LIBS. 1542 1543 * modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/. 1544 15452004-11-18 Michael Natterer <mitch@gimp.org> 1546 1547 * plug-ins/common/compressor.c (compressors): added back the 1548 .xcf.gz and .xcf.bz2 extensions because they are the only way 1549 to figure the special nature of this plug-in's extensions. 1550 1551 * app/widgets/gimpfileprocview.[ch]: keep a list of "meta 1552 extensions" (extensions which have a '.' themselves). 1553 1554 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): 1555 try to replace the whole extension if the last extension is one of 1556 the meta extensions kept by GimpFileProcView. Fixes bug #158377. 1557 15582004-11-18 Sven Neumann <sven@gimp.org> 1559 1560 * plug-ins/maze/maze.[ch] 1561 * plug-ins/maze/maze_face.c: removed the extra help button from 1562 the Maze plug-in. Fixes bug #158605. 1563 15642004-11-18 Michael Natterer <mitch@gimp.org> 1565 1566 The following fixes have no visible effect because nobody 1567 uses gimp_plugin_menu_register() on temp_procs yet: 1568 1569 * app/actions/plug-in-actions.[ch]: added 1570 plug_in_actions_add_path() which just adds the actions needed for 1571 a given menu math, but not the procedure action itself. 1572 1573 * app/gui/gui-vtable.c (gui_menus_create_entry): create the 1574 menu_path's actions using above function so adding of submenus to 1575 existing ui managers works. 1576 1577 * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker): 1578 don't add a menu if "no_interface" is TRUE. 1579 1580 * app/pdb/plug_in_cmds.c: regenerated. 1581 1582 * plug-ins/script-fu/script-fu-scripts.c: pass untranslated 1583 menu_paths to the core, not translated ones. Don't store the 1584 scripts directly in the "script_list" tree but use a list of 1585 scripts per key because there can be identical keys for different 1586 scripts now. Fixed sorting of menu entries and menus. 1587 15882004-11-18 Simon Budig <simon@gimp.org> 1589 1590 * modules/controller_midi.c: implemented support for ALSA-midi, 1591 currently disabled. Needs a configure-check and proper linking 1592 against libasound. 1593 15942004-11-17 Dave Neary <bolsh@gimp.org> 1595 1596 * plug-ins/common/bumpmap.c: Fixed initialisation issue 1597 that was crashing the plug-in on repeat runs. Fixes bug 1598 #158494. 1599 16002004-11-17 Sven Neumann <sven@gimp.org> 1601 1602 * app/dialogs/print-size-dialog.c: added missing callbacks for the 1603 size entries. Needs some more work though... 1604 16052004-11-17 Manish Singh <yosh@gimp.org> 1606 1607 * plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled 1608 library. 1609 1610 * plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer 1611 for GimpProcBrowserApplyCallback. 1612 1613 * plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to 1614 scheme style if scheme_names in the proc info pane too. 1615 1616 * plug-ins/dbbrowser/procedure-browser.c 1617 * plug-ins/script-fu/script-fu-console.c: pass NULL as user_data. 1618 1619 * plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la. 1620 1621 * plug-ins/pygimp/Makefile.am 1622 * plug-ins/pygimp/procbrowser.c: new module, which wraps 1623 libgimprocbrowser. 1624 1625 * plug-ins/pygimp/gimpmodule.c 1626 * plug-ins/pygimp/pygimp.h 1627 * plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other 1628 modules can use it. 1629 1630 * plug-ins/pygimp/plug-ins/pdbbrowse.py 1631 * plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser. 1632 16332004-11-17 Sven Neumann <sven@gimp.org> 1634 1635 * plug-ins/script-fu/script-fu-interface.c: added a utility 1636 function to reduce code duplication. 1637 16382004-11-17 Michael Natterer <mitch@gimp.org> 1639 1640 * plug-ins/script-fu/script-fu-scripts.[ch] 1641 * plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin 1642 Cozens which adds (script-fu-menu-register) and allows scripts to 1643 register their menu_paths the same undeprecated way as plug-ins. 1644 Fixes bug #158117. 1645 1646 * plug-ins/script-fu/scripts/test-sphere.scm: example how to use 1647 the new API. Doesn't change strings because test-shpere.scm is an 1648 untranslated example script. 1649 16502004-11-17 Michael Natterer <mitch@gimp.org> 1651 1652 Made plug-in menu registration work the same way for ordinary and 1653 temporary procedures. Addresses bug #158117. 1654 1655 * app/core/gimp-gui.[ch]: added "const gchar *menu_path" to 1656 gimp_menus_create_entry(). 1657 1658 * app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is 1659 NULL, behave as before and create an action and its menu entries 1660 for all the procedure's menu_paths. If it is non-NULL, skip action 1661 creation and create a menu entry just for that path. 1662 1663 * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call 1664 gimp_menus_create_entry() with a NULL menu path and call it if 1665 proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so 1666 it creates at least the procedure's action, even if it has 1667 no menu_path (yet). 1668 1669 * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both 1670 the list of procs and temp_procs when trying to register the 1671 entry. Allow ordinary procedures and extensions to install stuff 1672 at query() and init() time and allow temp_procs to install stuff 1673 at any time. 1674 1675 * app/pdb/plug_in_cmds.c: regenerated. 1676 16772004-11-17 Michael Natterer <mitch@gimp.org> 1678 1679 * plug-ins/dbbrowser/gimpprocbox.c 1680 * plug-ins/dbbrowser/gimpprocbrowser.[ch] 1681 * plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation 1682 of moving it to a more public place. 1683 1684 * plug-ins/dbbrowser/procedure-browser.c 1685 * plug-ins/script-fu/script-fu-console.c: changed accordingly. 1686 16872004-11-17 Sven Neumann <sven@gimp.org> 1688 1689 * Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc 1690 here since it only causes 'make distcheck' to break earlier as usual. 1691 16922004-11-17 Sven Neumann <sven@gimp.org> 1693 1694 * plug-ins/rcm/Makefile.am 1695 * plug-ins/rcm/rcm_callback.c 1696 * plug-ins/rcm/rcm_dialog.c 1697 * plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot 1698 that replaces the XPM icons with stock icons (bug #140202). 1699 1700 * plug-ins/rcm/pixmaps/*.xpm: removed. 1701 1702 * plug-ins/Lighting/lighting_stock.c 1703 * plug-ins/MapObject/mapobject_stock.c 1704 * plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake 1705 in the icon factory code. 1706 17072004-11-16 Manish Singh <yosh@gimp.org> 1708 1709 * app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under 1710 be_verbose. 1711 17122004-11-16 Manish Singh <yosh@gimp.org> 1713 1714 * plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp 1715 objects (bug #158392). Patch by Joao S. O. Bueno. 1716 17172004-11-16 Manish Singh <yosh@gimp.org> 1718 1719 * plug-ins/pygimp/gimpui.py: Use img.name if filename is not 1720 available (bug #158392). Patch by Joao S. O. Bueno. 1721 17222004-11-16 Manish Singh <yosh@gimp.org> 1723 1724 * plug-ins/pygimp/gimpfu.py 1725 * plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325). 1726 Patch by Joao S. O. Bueno. 1727 17282004-11-16 Manish Singh <yosh@gimp.org> 1729 1730 * plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103). 1731 Patch by Joao S. O. Bueno. 1732 17332004-11-16 Manish Singh <yosh@gimp.org> 1734 1735 * plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts. 1736 17372004-11-16 Manish Singh <yosh@gimp.org> 1738 1739 * configure.in: 1740 * plug-ins/pygimp/Makefile.am: Compile pygimp with 1741 -fno-strict-aliasing if the compiler supports it. 1742 1743 * plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for 1744 everything but the filesel, for slightly more consistency with 1745 script-fu. Addresses #124791. 1746 1747 * plug-ins/pygimp/gimpmodule.c: Wrapped 1748 gimp_context_{get,set}_gradient and 1749 gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated 1750 versions of these, and rewrote them in terms of the new functions. 1751 17522004-11-17 Michael Natterer <mitch@gimp.org> 1753 1754 * app/plug-in/plug-in.c (plug_in_close): replaced the 1755 while(plug_in->temp_procs) "loop" which called 1756 plug_in_proc_frame_quit() by a real for()-loop iterating over the 1757 list of PlugInProcFrames, calling g_main_loop_quit() on each main 1758 loop. The old version did not unroll the stack but looped 1759 infinitely. Spotted by Yosh. 1760 17612004-11-17 Sven Neumann <sven@gimp.org> 1762 1763 * plug-ins/imagemap/imap_selection.c 1764 * plug-ins/imagemap/imap_preferences.c: silent the compiler. 1765 17662004-11-17 Michael Natterer <mitch@gimp.org> 1767 1768 * plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund 1769 which adds EXIF thumbnail loading and saving. 1770 Fixes bugs #155761 and #158190. 1771 17722004-11-16 DindinX <dindinx@gimp.org> 1773 1774 * plug-ins/gfig/gfig-arc.c 1775 * plug-ins/gfig/gfig-bezier.c 1776 * plug-ins/gfig/gfig-circle.c 1777 * plug-ins/gfig/gfig-dialog.c 1778 * plug-ins/gfig/gfig-ellipse.c 1779 * plug-ins/gfig/gfig-line.c 1780 * plug-ins/gfig/gfig-poly.c 1781 * plug-ins/gfig/gfig-spiral.c 1782 * plug-ins/gfig/gfig-star.c 1783 * plug-ins/gfig/gfig-style.c 1784 * plug-ins/gfig/gfig-style.h 1785 * plug-ins/gfig/gfig-types.h 1786 * plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke 1787 the painting or not. 1788 17892004-11-16 DindinX <dindinx@gimp.org> 1790 1791 * plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a 1792 shapeburst blend. This is very slow, but I dont see how it could be 1793 done otherwise. 1794 17952004-11-16 Michael Natterer <mitch@gimp.org> 1796 1797 * app/widgets/gimpfgbgeditor.c: get rid of the 1798 gimp_fg_bg_editor_context_changed() callback and 1799 g_signal_connect_swapped() gtk_widget_queue_draw() directly. 1800 18012004-11-16 Michael Natterer <mitch@gimp.org> 1802 1803 * app/widgets/gimpchanneltreeview.c: implement 1804 GimpDockedInterface::set_context() and set the context of the 1805 embedded GimpComponentEditor. Fixes NULL-context crashes in 1806 action callbacks when invoked from the component editor. 1807 Spotted by Jimmac. 1808 1809 Unrelated: 1810 1811 * app/widgets/gimpitemtreeview.c: get rid of the 1812 gimp_item_tree_view_context_changed() callback and 1813 g_signal_connect_swapped() gimp_item_tree_view_set_image() 1814 directly. 1815 18162004-11-16 Sven Neumann <sven@gimp.org> 1817 1818 * plug-ins/common/jigsaw.c: added missing braces around initializer. 1819 18202004-11-16 Michael Natterer <mitch@gimp.org> 1821 1822 * tools/pdbgen/pdb/drawable_transform.pdb: renamed the new 1823 drawable_foo_defaults() functions to drawable_foo_default() to be 1824 consistent with paintbrush_default() and friends. 1825 1826 * tools/pdbgen/pdb/transform_tools.pdb 1827 * libgimp/gimp.def: changed accordingly. 1828 1829 * app/pdb/drawable_transform_cmds.c 1830 * app/pdb/transform_tools_cmds.c 1831 * libgimp/gimpdrawabletransform_pdb.[ch] 1832 * libgimp/gimptransformtools_pdb.c: regenerated. 1833 1834 * plug-ins/script-fu/scripts/coolmetal-logo.scm 1835 * plug-ins/script-fu/scripts/image-structure.scm 1836 * plug-ins/script-fu/scripts/text-circle.scm: follow the API change. 1837 18382004-11-16 Sven Neumann <sven@gimp.org> 1839 1840 * app/config/gimpbaseconfig.c: increased default tile-cache-size 1841 to 128MB. 1842 1843 * app/config/gimpcoreconfig.c: increased default undo size to 16MB. 1844 18452004-11-16 Michael Natterer <mitch@gimp.org> 1846 1847 * tools/pdbgen/pdb/image.pdb 1848 * tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated 1849 functions "selection_clear", "image_set_cmap" and "image_get_cmap". 1850 1851 * app/pdb/procedural_db.c: and added them to the compat hash table 1852 because they have undeprecated replacements with identical 1853 signature. 1854 1855 * libgimp/gimpselection.[ch]: added gimp_selection_clear() here 1856 instead because we need the symbol in libgimp. 1857 1858 * app/pdb/image_cmds.c 1859 * app/pdb/internal_procs.c 1860 * app/pdb/selection_cmds.c 1861 * libgimp/gimpselection_pdb.[ch]: regenerated. 1862 18632004-11-16 DindinX <dindinx@gimp.org> 1864 1865 * plug-ins/gfig/gfig-dobject.h: renamed the DObject type to 1866 GfigObject, according to our common type naming. This type will 1867 certainly become an abstract class in a near future. 1868 1869 * plug-ins/gfig/gfig-arc.c 1870 * plug-ins/gfig/gfig-bezier.c 1871 * plug-ins/gfig/gfig-bezier.h 1872 * plug-ins/gfig/gfig-circle.c 1873 * plug-ins/gfig/gfig-dialog.c 1874 * plug-ins/gfig/gfig-dobject.c 1875 * plug-ins/gfig/gfig-ellipse.c 1876 * plug-ins/gfig/gfig-line.c 1877 * plug-ins/gfig/gfig-line.h 1878 * plug-ins/gfig/gfig-poly.c 1879 * plug-ins/gfig/gfig-poly.h 1880 * plug-ins/gfig/gfig-spiral.c 1881 * plug-ins/gfig/gfig-star.c 1882 * plug-ins/gfig/gfig-types.h 1883 * plug-ins/gfig/gfig.c 1884 * plug-ins/gfig/gfig.h: changed accordingly. 1885 18862004-11-16 Michael Natterer <mitch@gimp.org> 1887 1888 * app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list): 1889 removed redundant "gimage" parameter. 1890 1891 * app/tools/gimpeditselectiontool.c: changed accordingly. 1892 18932004-11-16 Michael Natterer <mitch@gimp.org> 1894 1895 * app/core/gimpchannel-select.c 1896 * app/core/gimpchannel.c 1897 * app/core/gimpdrawable-desaturate.c 1898 * app/core/gimpdrawable-equalize.c 1899 * app/core/gimpdrawable-histogram.c 1900 * app/core/gimpdrawable-invert.c 1901 * app/core/gimpdrawable-levels.c 1902 * app/core/gimpdrawable-offset.c 1903 * app/core/gimpdrawable-stroke.c 1904 * app/core/gimpdrawable-transform.c 1905 * app/core/gimpdrawable.c 1906 * app/core/gimpitem-linked.c 1907 * app/core/gimpitem.c 1908 * app/core/gimplayer.c 1909 * app/core/gimpselection.c 1910 * app/paint/gimppaintcore-stroke.c 1911 * app/text/gimptextlayer.c: in all functions which somehow 1912 (explicitely or implicitely) touch undo, either g_return_if_fail() 1913 on gimp_item_is_attached() or simply don't push an undo step if 1914 feasible (e.g. for simple stuff like layer opacity). 1915 1916 * tools/pdbgen/pdb/color.pdb 1917 * tools/pdbgen/pdb/drawable.pdb 1918 * tools/pdbgen/pdb/image.pdb 1919 * tools/pdbgen/pdb/layer.pdb 1920 * tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail 1921 accordingly so they don't run into the assertions added above. 1922 1923 * app/pdb/color_cmds.c 1924 * app/pdb/drawable_cmds.c 1925 * app/pdb/image_cmds.c 1926 * app/pdb/layer_cmds.c 1927 * app/pdb/paint_tools_cmds.c: regenerated. 1928 19292004-11-16 Sven Neumann <sven@gimp.org> 1930 1931 * app/actions/file-commands.c 1932 * app/dialogs/file-save-dialog.c 1933 * app/file/file-save.[ch] 1934 * app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and 1935 "set_image_clean" parameters into a single "save_a_copy" 1936 parameter. When saving a copy, attach the used URI to the image and 1937 let the "Save a Copy" file chooser default to the last used value. 1938 19392004-11-16 Sven Neumann <sven@gimp.org> 1940 1941 * plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425). 1942 19432004-11-15 DindinX <dindinx@gimp.org> 1944 1945 * plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan. 1946 1947 * plug-ins/gfig/gfig-line.[ch]: smallish style fix. 1948 19492004-11-15 DindinX <dindinx@gimp.org> 1950 1951 * plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse 1952 tool (a lot more elliptical) by Jimmac and Zigomar. 1953 19542004-11-15 Sven Neumann <sven@gimp.org> 1955 1956 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): 1957 limit the number of file extensions that are added to the file 1958 filter menu to keep the file dialog from growing too wide. 1959 19602004-11-15 Philip Lafleur <plafleur@cvs.gnome.org> 1961 1962 * app/display/gimpdisplayshell-preview.c: Further optimization of 1963 perspective tool preview - never calculate the same vertex more 1964 than once. 1965 19662004-11-15 Sven Neumann <sven@gimp.org> 1967 1968 * app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc) 1969 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): 1970 better fix for bug #158369. 1971 19722004-11-15 Sven Neumann <sven@gimp.org> 1973 1974 * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): 1975 return early if gimp_file_proc_view_get_proc() didn't return a file 1976 procedure. Should fix bug #158369. 1977 19782004-11-15 Øyvind Kolås <pippin@gimp.org> 1979 1980 * docs/gimp.txt: removed, outdated. 1981 * docs/make_todo: removed, unused. 1982 19832004-11-15 Sven Neumann <sven@gimp.org> 1984 1985 * app/dialogs/print-size-dialog.c: started to redo this dialog 1986 without using a GimpSizeBox. The widgets aren't connected, so it 1987 isn't usable yet. 1988 1989 * app/widgets/gimpprogressbox.c 1990 * app/widgets/gimpprogressdialog.c 1991 * app/widgets/gimpsizebox.c: trivial cleanups. 1992 1993 * data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac. 1994 19952004-11-14 Sven Neumann <sven@gimp.org> 1996 1997 * app/actions/image-commands.c: converted error messages that should 1998 never appear to warnings. 1999 20002004-11-14 DindinX <dindinx@gimp.org> 2001 2002 * plug-ins/gfig/gfig-dialog.c 2003 * plug-ins/gfig/gfig-dobject.c 2004 * plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by 2005 this sequence: draw a line, delete it, redraw something), and 2006 corrected some ui spacing. 2007 20082004-11-14 Sven Neumann <sven@gimp.org> 2009 2010 * app/core/gimppalette-import.c: applied a (slightly modified) 2011 patch from Nickolay V. Shmyrev that changes the palette import 2012 function to not only read palettes in the RIFF format but also 2013 GIMP and Photoshop ACT palette files (bug #158297). 2014 20152004-11-14 Sven Neumann <sven@gimp.org> 2016 2017 * Makefile.am (EXTRA_DIST) 2018 * MAINTAINERS 2019 * PLUGIN_MAINTAINERS 2020 * TODO.xml: removed these files from the tarball and from CVS. 2021 Doesn't make sense to keep unmaintained files around that provide 2022 outdated and in large parts wrong information. 2023 20242004-11-14 Sven Neumann <sven@gimp.org> 2025 2026 * plug-ins/gfig/gfig-dialog.c (load_button_callback): use the 2027 proper parent widget. 2028 20292004-11-14 DindinX <dindinx@gimp.org> 2030 2031 * plug-ins/gfig/gfig-dialog.c 2032 * plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven. 2033 20342004-11-14 Sven Neumann <sven@gimp.org> 2035 2036 * configure.in 2037 * plug-ins/rcm/Makefile.am 2038 * plug-ins/rcm/images/Makefile.am 2039 * plug-ins/rcm/images/rcm-360.png 2040 * plug-ins/rcm/images/rcm-a-b.png 2041 * plug-ins/rcm/images/rcm-ccw.png 2042 * plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM 2043 icons used by the RCM plug-in. Added rules to build a header file 2044 that can be used to get rid of the XPM files (bug #140202). 2045 20462004-11-14 DindinX <dindinx@gimp.org> 2047 2048 * plug-ins/gfig/gfig-dialog.c 2049 * plug-ins/gfig/gfig-dialog.h 2050 * plug-ins/gfig/gfig-dobject.c 2051 * plug-ins/gfig/gfig-dobject.h 2052 * plug-ins/gfig/gfig-types.h 2053 * plug-ins/gfig/gfig.c 2054 * plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList. 2055 Makes the code cleaner and less error prone. 2056 20572004-11-14 Sven Neumann <sven@gimp.org> 2058 2059 * plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot 2060 that replaces the XPM icons with pixbufs (bug #140202). 2061 2062 * plug-ins/pagecurl/curl[0-7].xpm: removed. 2063 20642004-11-14 Sven Neumann <sven@gimp.org> 2065 2066 * plug-ins/gimpressionist/Makefile.am: fixed typo. 2067 2068 * plug-ins/pagecurl/Makefile.am 2069 * plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM 2070 icons used by the PageCurl plug-in. Added rules to build a header 2071 file that can be used to get rid of the XPM files (bug #140202). 2072 20732004-11-14 Philip Lafleur <plafleur@cvs.gnome.org> 2074 2075 * app/display/gimpdisplayshell-preview.c: Eliminated about 396 2076 floating-point divides per frame in the persective preview. 2077 20782004-11-13 Manish Singh <yosh@gimp.org> 2079 2080 Fix a bunch of warnings from Sparse: 2081 2082 * app/actions/dockable-commands.c 2083 * app/actions/layers-actions.c 2084 * app/actions/view-commands.c 2085 * app/base/pixel-surround.c 2086 * app/config/gimpconfig-utils.c 2087 * app/config/gimpscanner.c 2088 * app/core/gimpbrushgenerated.c 2089 * app/core/gimpcontainer.c 2090 * app/core/gimpimage.c 2091 * app/dialogs/palette-import-dialog.c 2092 * app/file/gimprecentlist.c 2093 * app/plug-in/plug-in-params.c 2094 * app/text/gimptext-compat.c 2095 * app/text/gimptext-parasite.c 2096 * app/vectors/gimpbezierstroke.c 2097 * app/vectors/gimpstroke.c 2098 * app/widgets/gimpcellrendereraccel.c 2099 * app/widgets/gimpselectiondata.c 2100 * app/xcf/xcf.c 2101 * libgimp/gimp.c 2102 * libgimpthumb/gimpthumb-utils.c 2103 * libgimpthumb/gimpthumbnail.c 2104 * modules/cdisplay_proof.c 2105 * plug-ins/Lighting/lighting_ui.c 2106 * plug-ins/common/csource.c 2107 * plug-ins/common/glasstile.c 2108 * plug-ins/common/nova.c 2109 * plug-ins/common/pcx.c 2110 * plug-ins/common/pnm.c 2111 * plug-ins/common/randomize.c 2112 * plug-ins/common/screenshot.c 2113 * plug-ins/common/sel_gauss.c 2114 * plug-ins/common/spheredesigner.c 2115 * plug-ins/common/wind.c 2116 * plug-ins/gfig/gfig-dialog.c 2117 * plug-ins/gfig/gfig-dobject.c 2118 * plug-ins/gimpressionist/gimpressionist.c 2119 * plug-ins/ifscompose/ifscompose.c 2120 * plug-ins/print/gimp_main_window.c 2121 * plug-ins/print/print.c: Cleanup integer vs. pointer confusion. 2122 2123 * app/base/temp-buf.c 2124 * app/dialogs/about-dialog.c 2125 * plug-ins/common/bumpmap.c 2126 * plug-ins/common/jigsaw.c 2127 * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups. 2128 2129 * app/config/gimpconfig-deserialize.c 2130 * app/config/gimpconfig-path.c 2131 * app/config/gimpconfigwriter.c 2132 * app/core/gimpgradient.c 2133 * app/tools/gimpdrawtool.c 2134 * plug-ins/common/nlfilt.c 2135 * plug-ins/common/unsharp.c 2136 * plug-ins/common/zealouscrop.c: Define inline functions before they 2137 are used. 2138 2139 * app/core/gimpdrawable-blend.c: PixelRegion definition was changed 2140 some time ago, but the initialization here didn't change. Fix it. 2141 2142 * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to 2143 assign token twice in a row. 2144 2145 * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No 2146 need to initialize file_data, since the code fills out all the fields. 2147 2148 * plug-ins/common/CML_explorer.c 2149 * plug-ins/common/vpropagate.c: Declare function pointers fully. 2150 2151 * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed, 2152 we assume we can use the "inline" keyword always. 2153 2154 * plug-ins/common/psd_save.c 2155 * plug-ins/common/vinvert.c 2156 * plug-ins/gfig/gfig-arc.c 2157 * plug-ins/gfig/gfig-bezier.c 2158 * plug-ins/gfig/gfig-circle.c 2159 * plug-ins/gfig/gfig-dialog.c 2160 * plug-ins/gfig/gfig-dobject.c 2161 * plug-ins/gfig/gfig-ellipse.c 2162 * plug-ins/gfig/gfig-line.c 2163 * plug-ins/gfig/gfig-poly.c 2164 * plug-ins/gfig/gfig-spiral.c 2165 * plug-ins/gfig/gfig-star.c 2166 * plug-ins/gfig/gfig.c 2167 * plug-ins/gimpressionist/orientmap.c 2168 * plug-ins/gimpressionist/placement.c 2169 * plug-ins/gimpressionist/sizemap.c 2170 * plug-ins/imagemap/imap_grid.c 2171 * plug-ins/imagemap/imap_main.c 2172 * plug-ins/imagemap/imap_preferences.c 2173 * plug-ins/imagemap/imap_settings.c 2174 * plug-ins/maze/maze.c 2175 * plug-ins/sel2path/curve.c 2176 * plug-ins/sel2path/fit.c 2177 * plug-ins/sel2path/pxl-outline.c 2178 * plug-ins/sel2path/spline.c 2179 * plug-ins/xjt/xjt.c: Functions with no args should be declared 2180 with (void). 2181 2182 * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet 2183 the compiler. 2184 21852004-11-14 Sven Neumann <sven@gimp.org> 2186 2187 * themes/Default/images/Makefile.am 2188 * themes/Default/images/stock-center-16.png 2189 * themes/Default/images/stock-center-24.png 2190 * themes/Default/images/stock-print-resolution-16.png 2191 * themes/Default/images/stock-print-resolution-24.png: new icons 2192 drawn by Jimmac. 2193 2194 * libgimpwidgets/gimpstock.[ch]: registered the new icons. 2195 2196 * app/actions/image-actions.c 2197 * app/dialogs/print-size-dialog.c 2198 * app/dialogs/resize-dialog.c 2199 * plug-ins/ifscompose/ifscompose.c: use them. 2200 22012004-11-14 Sven Neumann <sven@gimp.org> 2202 2203 * configure.in: bumped version to 2.2-pre2. 2204 22052004-11-13 Manish Singh <yosh@gimp.org> 2206 2207 * tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so 2208 that gimp_image_set_filename() validates that it is called with 2209 a filename in the filesystem encoding which can safely be converted 2210 to UTF-8 and back. Fixes #153751. 2211 2212 * app/pdb/image_cmds.c 2213 * libgimp/gimpimage_pdb.c: Regenerated. 2214 22152004-11-13 Sven Neumann <sven@gimp.org> 2216 2217 * app/dialogs/Makefile.am 2218 * app/dialogs/print-size-dialog.[ch]: new files for the Print Size 2219 dialog that was missing. Still work in progress... 2220 2221 * app/actions/image-actions.c 2222 * app/actions/image-commands.[ch] 2223 * app/widgets/gimphelp-ids.h 2224 * menus/image-menu.xml.in: integrate the new dialog. 2225 22262004-11-13 Sven Neumann <sven@gimp.org> 2227 2228 * tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear() 2229 in favor of gimp_selection_none(). Fixes bug #156765. 2230 2231 * app/pdb/selection_cmds.c 2232 * libgimp/gimpselection_pdb.[ch]: regenerated. 2233 22342004-11-13 Kevin Cozens <kcozens@cvs.gimp.org> 2235 2236 * plug-ins/gfig/gfig.c 2237 * plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to 2238 gimp_selection_none() (bug #156765). 2239 22402004-11-13 Kevin Cozens <kcozens@cvs.gimp.org> 2241 2242 * plug-ins/script-fu/scripts/gimp-headers.scm 2243 * plug-ins/script-fu/scripts/gimp-labels.scm 2244 * plug-ins/script-fu/scripts/news-text.scm 2245 * plug-ins/script-fu/scripts/speed-text.scm: Changed calls to 2246 gimp-selection-clear to use gimp-selection-none in preparation 2247 for the deprecation of -clear. (bug #156765) 2248 22492004-11-13 Sven Neumann <sven@gimp.org> 2250 2251 * tools/pdbgen/pdb/image.pdb: document the fact that 2252 gimp_image_get_filename() returns the filename in the filesystem 2253 encoding. Fixed gimp_image_get_name() to actually return the name 2254 in UTF-8 encoding. 2255 2256 * app/pdb/image_cmds.c 2257 * libgimp/gimpimage_pdb.c: Regenerated. 2258 2259 * app/vectors/gimpbezierstroke.h: formatting. 2260 22612004-11-13 Sven Neumann <sven@gimp.org> 2262 2263 * app/core/gimpimagefile.[ch] 2264 * app/file/file-open.c 2265 * app/file/file-save.c: pass the MIME type from the save procedure 2266 to gimp_imagefile_save_thumbnail() so that it can be stored with 2267 the thumbnail. 2268 2269 * tools/pdbgen/pdb/fileops.pdb 2270 * app/pdb/fileops_cmds.c: changed accordingly. 2271 22722004-11-13 Sven Neumann <sven@gimp.org> 2273 2274 * app/plug-in/plug-in-proc-def.[ch] 2275 * app/plug-in/plug-in-rc.c 2276 * app/plug-in/plug-ins.[ch]: allow to associate a procedure for 2277 thumbnail loading with any file load procedure. 2278 2279 * tools/pdbgen/pdb/fileops.pdb: export this functionality to the 2280 PDB as gimp_register_thumbnail_loader(). 2281 2282 * app/pdb/fileops_cmds.c 2283 * app/pdb/internal_procs.c 2284 * libgimp/gimpfileops_pdb.[ch]: regenerated. 2285 2286 * app/core/gimpimagefile.c 2287 * app/file/file-open.[ch]: when creating a thumbnail for an image 2288 file, use a thumbnail load procedure if available. 2289 2290 * plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure 2291 that allows to load a small preview of the SVG image. 2292 22932004-11-13 DindinX <dindinx@gimp.org> 2294 2295 * app/actions/layers-actions.c: added back <control>H as a shortcut 2296 for "Anchor Layer". Spotted by Bruno Ronzani. 2297 22982004-11-13 DindinX <dindinx@gimp.org> 2299 2300 * plug-ins/common/retinex.c: use a GimpAspectPreview instead of a 2301 GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour 2302 of the progress bar. 2303 23042004-11-13 Sven Neumann <sven@gimp.org> 2305 2306 * libgimpbase/gimputils.c (gimp_strip_uline): changed based on a 2307 patch by Joao S. O. Bueno to remove mnemonics as used in languages 2308 like Chinese. Fixes bug #157561. 2309 23102004-11-13 Sven Neumann <sven@gimp.org> 2311 2312 * plug-ins/ifscompose/README.ifscompose: updated link to the 2313 tutorial (pointed out by Alan Horkan) and added another link. 2314 2315 * plug-ins/ifscompose/ifscompose.c: changed plug-in name from 2316 "IfsCompose" to "IFS Fractal". Sorry for the late string changes 2317 but the old name definitely was akward and probably hard to 2318 translate anyway. Fixes bug #157135. 2319 2320 * plug-ins/ifscompose/ifscompose_storage.c: removed trailing 2321 whitespace. 2322 23232004-11-13 Sven Neumann <sven@gimp.org> 2324 2325 * plug-ins/common/retinex.c (retinex_dialog): fixed table size. 2326 23272004-11-13 Simon Budig <simon@gimp.org> 2328 2329 * app/core/gimpimage-merge.c: Return the active layer instead of 2330 the bottom layer when just merging down a floating selection. 2331 Untabbified. 2332 2333 Fixes bug #158130. 2334 23352004-11-12 Sven Neumann <sven@gimp.org> 2336 2337 * app/config/gimpconfig-dump.c: better fix for bug #157971. 2338 2339 * docs/gimprc.5.in: regenerated. 2340 23412004-11-12 DindinX <dindinx@gimp.org> 2342 2343 * plug-ins/gfig/images/stock-show-all.png 2344 * plug-ins/gfig/images/stock-select-object.png: new icons made by 2345 Jimmac. 2346 23472004-11-12 Michael Natterer <mitch@gimp.org> 2348 2349 * app/core/gimpimage-undo-push.c: disallow non-attached items 2350 to be pushed to the undo stack. 2351 23522004-11-12 DindinX <dindinx@gimp.org> 2353 2354 * plug-ins/gfig/images/stock-show-all.png 2355 * plug-ins/gfig/images/stock-select-object.png: added these two stock 2356 icons. Jimmac, these two are screaming to be redone, please. 2357 2358 * plug-ins/gfig/images/Makefile.am: added these icons. 2359 2360 * plug-ins/gfig/gfig-bezier.c 2361 * plug-ins/gfig/gfig-bezier.h 2362 * plug-ins/gfig/gfig-dialog.c 2363 * plug-ins/gfig/gfig-poly.c 2364 * plug-ins/gfig/gfig-poly.h 2365 * plug-ins/gfig/gfig-spiral.c 2366 * plug-ins/gfig/gfig-spiral.h 2367 * plug-ins/gfig/gfig-star.c 2368 * plug-ins/gfig/gfig-star.h 2369 * plug-ins/gfig/gfig-stock.c 2370 * plug-ins/gfig/gfig-stock.h 2371 * plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager 2372 toolbar, which makes the code simpler and easier to read. 2373 23742004-11-12 Sven Neumann <sven@gimp.org> 2375 2376 * app/dialogs/tips-dialog.c: added icons to the Previous/Next 2377 buttons (bug #158004). 2378 23792004-11-11 Sven Neumann <sven@gimp.org> 2380 2381 * app/gui/splash.c: lowered labels a few pixels. 2382 23832004-11-11 Sven Neumann <sven@gimp.org> 2384 2385 * plug-ins/gfig/gfig-dialog.c: minor code cleanup. 2386 23872004-11-11 DindinX <dindinx@gimp.org> 2388 2389 * plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and 2390 automagically have it translated! The button bar will follow the same 2391 path. Remove the now useless "Paint" button. 2392 23932004-11-11 Sven Neumann <sven@gimp.org> 2394 2395 * app/config/gimpconfig-dump.c: groff doesn't like lines to start 2396 with a single quote, we better escape it. Fixes bug #157971. 2397 2398 * docs/gimprc.5.in: regenerated. 2399 24002004-11-11 Michael Natterer <mitch@gimp.org> 2401 2402 * app/core/gimp-edit.c 2403 * app/core/gimpdrawable-blend.c 2404 * app/core/gimpdrawable-bucket-fill.c 2405 * app/core/gimpitem.c (gimp_item_stroke): added precondition 2406 checks for gimp_item_is_attached() and removed checks for 2407 gimp_item_get_image() to actually return an image (because it 2408 always returns an image). 2409 2410 * tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable 2411 is not attached. 2412 2413 * app/pdb/edit_cmds.c: regenerated. 2414 24152004-11-11 Michael Natterer <mitch@gimp.org> 2416 2417 * plug-ins/script-fu/scripts/add-bevel.scm 2418 * plug-ins/script-fu/scripts/addborder.scm 2419 * plug-ins/script-fu/scripts/carve-it.scm 2420 * plug-ins/script-fu/scripts/carved-logo.scm 2421 * plug-ins/script-fu/scripts/chip-away.scm 2422 * plug-ins/script-fu/scripts/clothify.scm 2423 * plug-ins/script-fu/scripts/font-map.scm 2424 * plug-ins/script-fu/scripts/slide.scm 2425 * plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-* 2426 functions on drawables which are not added to an image because 2427 this will be forbidden soon (because it can trash the image's undo 2428 stack). 2429 24302004-11-11 Michael Natterer <mitch@gimp.org> 2431 2432 * plug-ins/script-fu/scripts/lava.scm: replaced 2433 undo-disable/enable by undo-group-start/end. 2434 24352004-11-11 Michael Natterer <mitch@gimp.org> 2436 2437 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_response): 2438 call gimp_image_flush() after committing the image_map so the 2439 menus are up-to-date. Fixes bug #157914. 2440 24412004-11-11 Philip Lafleur <plafleur@cvs.gnome.org> 2442 2443 * app/display/gimpdisplayshell-preview.c: Use the transform 2444 tool coordinates when creating subdivisions, not the 2445 texture coordinates. Fixes breakage with layers that are not 2446 the image size. 2447 24482004-11-11 Jay Cox <jaycox@gimp.org> 2449 2450 * app/base/brush-scale.c: Keep computed brush values from 2451 overflowing with large reduction factors. Fixes bug #76228. 2452 24532004-11-11 Sven Neumann <sven@gimp.org> 2454 2455 * libgimpwidgets/gimpintstore.c 2456 * app/vectors/gimpvectors-import.c: please the overly pedantic 2457 IRIX MIPSpro compiler and don't initialize structs with 2458 non-constant values. 2459 24602004-11-10 Sven Neumann <sven@gimp.org> 2461 2462 * app/file/file-open.c (file_open_layer): add the image to the 2463 list of recently used documents. Fixes bug #157879. 2464 24652004-11-10 DindinX <dindinx@gimp.org> 2466 2467 * plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the 2468 tools and made the dialog a bit smaller. 2469 24702004-11-10 Sven Neumann <sven@gimp.org> 2471 2472 * plug-ins/common/mail.c: added a menu icon (compiled-in). 2473 24742004-11-10 Michael Natterer <mitch@gimp.org> 2475 2476 * app/display/gimpdisplayshell-handlers.c 2477 (gimp_display_shell_resolution_changed_handler): if dot_for_dot is 2478 off, resolution change has the same effect as size change, so call 2479 gimp_display_shell_size_changed_handler(). Fixes display garbage. 2480 24812004-11-10 Michael Natterer <mitch@gimp.org> 2482 2483 * plug-ins/winicon/icodialog.[ch] 2484 * plug-ins/winicon/icoload.[ch] 2485 * plug-ins/winicon/icosave.[ch] 2486 * plug-ins/winicon/main.[ch]: call progress functions 2487 unconditionally; removed global "interactive" variable; use 2488 standard strings for open/save progress messages; gui, indentation 2489 & coding style cleanup; untabified. 2490 24912004-11-10 Michael Schumacher <schumaml@cvs.gnome.org> 2492 2493 * plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann 2494 with some minor modifications. Fixes bug #157612 2495 Removed some unused variables. 2496 24972004-11-10 Michael Natterer <mitch@gimp.org> 2498 2499 * libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2". 2500 25012004-11-10 Sven Neumann <sven@gimp.org> 2502 2503 * app/dialogs/preferences-dialog.c: set the padding-mode to custom 2504 color if a custom color is choosen. Fixes bug #157844. 2505 25062004-11-10 Michael Natterer <mitch@gimp.org> 2507 2508 * plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed 2509 capitalization of notebook tab label. 2510 25112004-11-10 Michael Natterer <mitch@gimp.org> 2512 2513 * libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to 2514 gimp_flags_get_first_value(). Reordered functions so enum and 2515 flags functions are grouped together. Added missing docs. 2516 2517 * libgimpbase/gimpbase.def: changed accordingly. 2518 25192004-11-09 Jay Cox <jaycox@gimp.org> 2520 2521 * plug-ins/common/psd.c: Skip resources with unknown signatures 2522 instead of quiting. Fixes bug #142468, and bug #152728 2523 2524 * app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds, 2525 and gimp_drawable_mask_intersect: reinitialize the return values 2526 after calling gimp_channel_bounds because gimp_channel_bounds 2527 overwrites the values even when it returns false. This fixes the 2528 bug where the gimp crashes when running color tools on layers 2529 smaller than the image, and processes only part of the image when 2530 the layer is larger than the image size. 2531 25322004-11-10 Sven Neumann <sven@gimp.org> 2533 2534 * HACKING: some updates. 2535 25362004-11-10 Michael Natterer <mitch@gimp.org> 2537 2538 * plug-ins/ifscompose/ifscompose.c: use a UI manager created 2539 toolbar instead of two rows of buttons. Added a "dummy-menubar" so 2540 the popup menu shows shortcuts again. Removed "Preview" and "Auto" 2541 buttons since the preview doesn't block the GUI and can always be 2542 updated. 2543 25442004-11-10 Michael Natterer <mitch@gimp.org> 2545 2546 * app/display/gimpstatusbar.[ch]: added new function 2547 gimp_statusbar_push_length(), which works exactly like 2548 push_coords() but takes only one value plus a GimpOrientationType 2549 for specifying the value's axis. 2550 2551 * app/tools/gimptool.[ch]: added the corresponding 2552 gimp_tool_push_status_length(). 2553 2554 * app/tools/gimpmovetool.c: use gimp_tool_push_status_length() 2555 so the guide position is shown in the selected display unit. 2556 Cleaned up the status message code a bit. 2557 25582004-11-10 Sven Neumann <sven@gimp.org> 2559 2560 * plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the 2561 anchor. 2562 25632004-11-09 Manish Singh <yosh@gimp.org> 2564 2565 * plug-ins/common/bmpread.c: if the file has space in the colormap for 2566 more than 256 entries, ignore them instead of failing. Fixes bug 2567 #157775. 2568 25692004-11-09 Manish Singh <yosh@gimp.org> 2570 2571 * plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images 2572 load again. Fixes bug #157764. 2573 25742004-11-09 Michael Natterer <mitch@gimp.org> 2575 2576 * app/display/gimpdisplayshell-callbacks.c 2577 (gimp_display_shell_canvas_tool_events): pass (gint)-truncated 2578 coordinates instead of RINT()-rounded ones to 2579 gimp_display_shell_update_cursor(). Restores correct coordinates 2580 display for zoomed-in display and fixes bug #153534. 2581 2582 * app/tools/gimpmovetool.c: added statusbar messages including the 2583 (rounded) guide coordinate. Keeps bug #141719 closed. 2584 25852004-11-09 Michael Natterer <mitch@gimp.org> 2586 2587 * app/display/gimpdisplayshell.c (gimp_display_shell_new): don't 2588 connect to "event" and don't connect any canvas event to 2589 gimp_display_shell_events(). Connect all tool events separately 2590 (doesn't include "configure-event" and thus fixes bug #141543). 2591 2592 * app/display/gimpdisplayshell-callbacks.c 2593 (gimp_display_shell_canvas_tool_events): call 2594 gimp_display_shell_events() manually before doing tool event 2595 processing. 2596 2597 * app/display/gimpdisplayshell.c 2598 * app/display/gimpdisplayshell-callbacks.[ch]: connect to 2599 "size_allocate" of the canvas, not to "configure_event" 2600 (suggested by Owen in bug #141543). 2601 2602 * app/display/gimpdisplayshell-callbacks.[ch]: removed 2603 gimp_display_shell_popup_menu(). 2604 2605 (gimp_display_shell_origin_button_press): emit "popup-menu" on the 2606 shell manually instead of calling above function. 2607 2608 * app/display/gimpdisplayshell.c: added the whole menu popup code 2609 here. 2610 26112004-11-09 Sven Neumann <sven@gimp.org> 2612 2613 * libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue 2614 a resize. Fixes remaining issues with bug #157495. 2615 26162004-11-09 Sven Neumann <sven@gimp.org> 2617 2618 * plug-ins/common/url.c: removed debug output. 2619 26202004-11-08 Sven Neumann <sven@gimp.org> 2621 2622 * app/dialogs/user-install-dialog.c (user_install_migrate_files): 2623 don't copy menurc, the format changed anyway. 2624 26252004-11-08 Sven Neumann <sven@gimp.org> 2626 2627 * plug-ins/script-fu/script-fu-interface.c (script_fu_ok): 2628 actually retrieve the value from the GtkEntry for SF-VALUE. 2629 26302004-11-08 Michael Natterer <mitch@gimp.org> 2631 2632 * tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert 2633 Jordaens which adds the missing gimp_layer_from_mask() API. 2634 Addresses bug #138662. 2635 2636 * app/pdb/internal_procs.c 2637 * app/pdb/layer_cmds.c 2638 * libgimp/gimplayer_pdb.[ch]. regenerated. 2639 2640 * libgimp/gimp.def: changed accordingly. 2641 26422004-11-08 Michael Natterer <mitch@gimp.org> 2643 2644 * plug-ins/script-fu/scripts/selection-round.scm: removed garbage 2645 from beginning of file. Removed DOS line breaks. 2646 26472004-11-08 Michael Natterer <mitch@gimp.org> 2648 2649 * libgimp/gimppixelfetcher.c: added docs derived from a patch from 2650 Cai Qian (bug #156271). 2651 26522004-11-08 Sven Neumann <sven@gimp.org> 2653 2654 * plug-ins/common/screenshot.c: changed label of default action 2655 button to "Grab". 2656 26572004-11-08 Sven Neumann <sven@gimp.org> 2658 2659 * plug-ins/common/CEL.c 2660 * plug-ins/common/CML_explorer.c 2661 * plug-ins/common/channel_mixer.c 2662 * plug-ins/common/gqbist.c 2663 * plug-ins/common/spheredesigner.c 2664 * plug-ins/flame/flame.c 2665 * plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in 2666 file chooser dialogs. Set the default response for file dialogs. 2667 26682004-11-08 Michael Natterer <mitch@gimp.org> 2669 2670 * app/dialogs/resize-dialog.c (resize_dialog_response) 2671 * app/dialogs/scale-dialog.c (scale_dialog_response): replaced 2672 "case GTK_RESPONSE_CANCEL:" by "default:" so it also catches 2673 hitting the escape key or clicking the WM close button. 2674 26752004-11-08 Øyvind Kolås <pippin@gimp.org> 2676 2677 * plug-ins/common/gqbist.c: fixed typo in construction of file 2678 chooser, use gtk_dialog_run instead of separate callbacks for 2679 the responses of the file chooser dialog. 2680 26812004-11-08 Sven Neumann <sven@gimp.org> 2682 2683 * app/core/gimpdrawable.c (gimp_drawable_mask_bounds) 2684 (gimp_drawable_mask_intersect): initialize the return values before 2685 checking if the drawable is attached. Keeps GIMP from going mad if 2686 this assertion is ever triggered. 2687 26882004-11-07 Sven Neumann <sven@gimp.org> 2689 2690 * plug-ins/helpbrowser/dialog.c: don't connect the help browser to 2691 the help system. 2692 26932004-11-07 Sven Neumann <sven@gimp.org> 2694 2695 * plug-ins/script-fu/scripts/selection-round.scm: register the 2696 compatibility procedure with the correct name. 2697 26982004-11-07 Sven Neumann <sven@gimp.org> 2699 2700 * libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was 2701 taken from label field). 2702 27032004-11-07 Sven Neumann <sven@gimp.org> 2704 2705 * plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager. 2706 27072004-11-07 Sigurd Gartmann <sigurd-translate@brogar.org> 2708 2709 * configure.in: Added support for the new locale nb to ALL_LINGUAS. 2710 27112004-11-07 Sven Neumann <sven@gimp.org> 2712 2713 * plug-ins/common/channel_mixer.c (query): the menu label should 2714 have three dots (bug #157580). 2715 27162004-11-07 DindinX <dindinx@gimp.org> 2717 2718 * plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and 2719 use a GtkListStore instead of the long-time deprecated GtkList. Done 2720 some small cleanups, too. 2721 27222004-11-06 Sven Neumann <sven@gimp.org> 2723 2724 * app/core/gimpbrushgenerated.c: changed minimum brush radius from 2725 1.0 to 0.1. 2726 2727 * app/widgets/gimpbrusheditor.c: allow a smaller brush radius to 2728 be set in the brush editor. Fixes bug #157508. 2729 27302004-11-06 Sven Neumann <sven@gimp.org> 2731 2732 * app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here. 2733 27342004-11-06 Sven Neumann <sven@gimp.org> 2735 2736 * app/dialogs/preferences-dialog.c: fixed typo (bug #157513). 2737 27382004-11-06 Sven Neumann <sven@gimp.org> 2739 2740 * app/dialogs/convert-dialog.c (convert_dialog_new): removed 2741 trailing period from check button label. Fixes bug #157511. 2742 27432004-11-06 Sven Neumann <sven@gimp.org> 2744 2745 * app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of 2746 the Reset functionality (bug #157495). The offset box is still not 2747 working correctly. 2748 2749 * app/widgets/gimpsizebox.c (gimp_size_box_update_resolution): 2750 check for availability of the size entry before accessing it. 2751 27522004-11-06 Sven Neumann <sven@gimp.org> 2753 2754 New Win32 icons contributed by Jernej Simoncic: 2755 2756 * app/Makefile.am 2757 * app/makefile.msc 2758 * app/gimp.rc 2759 * app/fileicon.ico: added new file icon for the Win32 build. 2760 2761 * app/wilber.ico: nicer application icon for the Win32 build. 2762 27632004-11-05 Michael Natterer <mitch@gimp.org> 2764 2765 * plug-ins/maze/maze.c 2766 * plug-ins/maze/maze_face.c: some irrelevant cleanups while doing 2767 code review. 2768 27692004-11-05 Michael Natterer <mitch@gimp.org> 2770 2771 * plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED 2772 because it's no longer needed. Cleaned up #defines and 2773 declarations. Removed tabs and trailing whitespace. 2774 27752004-11-04 Sven Neumann <sven@gimp.org> 2776 2777 * app/widgets/gimpsessioninfo.c: be more tolerant and silently 2778 skip entries that the dialog factory doesn't recognize. 2779 2780 * app/widgets/gimpdialogfactory.c: minor cleanup. 2781 27822004-11-04 Sven Neumann <sven@gimp.org> 2783 2784 * app/dialogs/user-install-dialog.c (user_install_response): don't 2785 save the (empty) gimprc after migrating the user settings. 2786 27872004-11-04 Michael Natterer <mitch@gimp.org> 2788 2789 * plug-ins/common/uniteditor.c: undeprecated by using a 2790 GtkUIManager for creating the toolbar. Some cleanup and code 2791 reordering. 2792 27932004-11-04 Michael Natterer <mitch@gimp.org> 2794 2795 * configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED 2796 only for future versions of GLib, GTK+ and Pango because the 2797 upcoming new stable versions add no new deprecations that are 2798 relevant for the GIMP source. 2799 28002004-11-04 Michael Natterer <mitch@gimp.org> 2801 2802 * plug-ins/ifscompose/ifscompose.c: some undeprecation and 2803 cleanup. Still uses GtkItemFactory. 2804 28052004-11-04 Michael Natterer <mitch@gimp.org> 2806 2807 Don't use deprecated GtkToolbar API in GimpTextEditor: 2808 2809 * app/actions/Makefile.am 2810 * app/actions/actions.c 2811 * app/actions/text-editor-actions.[ch] 2812 * app/actions/text-editor-commands.[ch]: added acions and 2813 callbacks for the new "text-editor" action group. 2814 2815 * app/menus/menus.c: register a "<TextEditor>" UI manager. 2816 2817 * menus/Makefile.am 2818 * menus/text-editor-toolbar.xml: new file for the toolbar. 2819 2820 * app/widgets/gimptexteditor.[ch]: use the toolbar created by the 2821 UI manager instead of constructing it using deprecated API. 2822 2823 * app/tools/gimptextoptions.c: changed accordingly. 2824 2825 * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load() 2826 (used by text-editor-commands.c). 2827 28282004-11-04 Michael Natterer <mitch@gimp.org> 2829 2830 * plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED. 2831 28322004-11-04 Michael Natterer <mitch@gimp.org> 2833 2834 * libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead 2835 of a GtkItemFactory. Added virtual function ::get_action_type() 2836 and create the manager's actions manually using that action type 2837 instead of using gtk_action_group_add_actions(). 2838 2839 * app/widgets/gimpcolorpanel.c: override ::get_action_type() so it 2840 creates GimpActions (which can have a color attached) instead of 2841 GtkActions. Changed the menu item visibility and color preview 2842 code accordingly. 2843 2844 * app/widgets/Makefile.am 2845 * app/widgets/gimpitemfactory.[ch]: finally removed. 2846 2847 * configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again. 2848 28492004-11-04 Michael Natterer <mitch@gimp.org> 2850 2851 * libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED 2852 2853 * libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h> 2854 explicitely and #undef GTK_DISABLE_DEPRECATED only around the 2855 inclusion if it was defined before. 2856 28572004-11-04 Michael Natterer <mitch@gimp.org> 2858 2859 * libgimp/gimpunitcache.h 2860 * libgimpbase/gimpchecks.h 2861 * libgimpbase/gimpdatafiles.h 2862 * libgimpbase/gimplimits.h 2863 * libgimpbase/gimpmemsize.h 2864 * libgimpbase/gimputils.h 2865 * libgimpbase/gimpwin32-io.h 2866 * libgimpthumb/gimpthumb-enums.h 2867 * libgimpthumb/gimpthumb-error.h 2868 * libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS. 2869 28702004-11-04 Michael Natterer <mitch@gimp.org> 2871 2872 * plug-ins/common/ccanalyze.c 2873 * plug-ins/common/uniteditor.c 2874 * plug-ins/gfig/gfig-dialog.c 2875 * plug-ins/gfig/gfig-preview.c 2876 * plug-ins/ifscompose/ifscompose.c 2877 * plug-ins/imagemap/imap_misc.c 2878 * plug-ins/imagemap/imap_selection.c 2879 * plug-ins/imagemap/imap_toolbar.c 2880 * plug-ins/imagemap/imap_tools.c 2881 * plug-ins/print/gimp_color_window.c: stop using deprecated 2882 functions, added some #undef GTK_DISABLE_DEPRECATED where needed. 2883 28842004-11-03 Michael Natterer <mitch@gimp.org> 2885 2886 * app/dialogs/module-dialog.c 2887 * plug-ins/dbbrowser/gimpprocbrowser.c 2888 * plug-ins/dbbrowser/plugin-browser.c: use 2889 gtk_tree_model_get_iter_first() instead of the deprecated 2890 _get_iter_root(). 2891 2892 * app/display/gimpdisplayshell-callbacks.c: don't include 2893 "widgets/gimpitemfactory.h". 2894 28952004-11-03 Øyvind Kolås <pippin@gimp.org> 2896 2897 * app/base/gimphistogram.h: %s/historgam/histogram/ 2898 28992004-11-03 Michael Natterer <mitch@gimp.org> 2900 2901 * app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't 2902 forget to g_free(editor->segments). 2903 29042004-11-03 Michael Natterer <mitch@gimp.org> 2905 2906 * app/display/gimpscalecombobox.c 2907 (gimp_scale_combo_box_mru_remove_last) 2908 * app/widgets/gimpeditor.c (gimp_editor_add_action_button) 2909 * app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks. 2910 29112004-11-03 Sven Neumann <sven@gimp.org> 2912 2913 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): 2914 plugged a mem-leak. 2915 2916 * app/widgets/gimpviewrendererimagefile.c 2917 (gimp_view_renderer_imagefile_render): don't leak the pixbuf here. 2918 2919 * app/widgets/gimpviewrenderer-frame.c: added a comment. 2920 29212004-11-03 Michael Natterer <mitch@gimp.org> 2922 2923 * app/paint-funcs/paint-funcs.c (combine_sub_region): applied 2924 patch from Joao S. O. Bueno which moves assignments into an "else" 2925 branch and thus optimizes the (common) "if" branch. Did some 2926 cosmetic cleanups. 2927 29282004-11-02 Michael Natterer <mitch@gimp.org> 2929 2930 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): 2931 don't silently return when there is already a script running but 2932 show a message instead. Unfortunately introduces two new strings, 2933 but bugs are bugs. Fixes bug #123882. 2934 29352004-11-02 Sven Neumann <sven@gimp.org> 2936 2937 * app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor 2938 cleanup. 2939 2940 * libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do 2941 the right thing. Used to do the wrong thing when called with a 2942 thumbnail size which is not from the GimpThumbSize enum. 2943 29442004-11-02 Sven Neumann <sven@gimp.org> 2945 2946 * app/actions/image-commands.c (image_new_from_image_cmd_callback): 2947 call image_new_dialog_set() unconditionally. Fixes bug #157096. 2948 29492004-11-02 Michael Natterer <mitch@gimp.org> 2950 2951 * tools/pdbgen/pdb/drawable_transform.pdb: factored out the 2952 "invoke" bodies to two utility functions, getting rid of *tons* of 2953 duplicated code. 2954 2955 * app/pdb/drawable_transform_cmds.c: regenerated (only whitespace 2956 and comments changed). 2957 29582004-11-02 Michael Natterer <mitch@gimp.org> 2959 2960 * tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults): 2961 renamed parameter "interpolation" to "interpolate" as suggested by 2962 pippin. 2963 2964 * app/pdb/drawable_transform_cmds.c 2965 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 2966 29672004-11-02 Michael Natterer <mitch@gimp.org> 2968 2969 * app/dialogs/user-install-dialog.c (user_install_migrate_files): 2970 don't copy pluginrc* and themerc*. 2971 29722004-11-02 Michael Natterer <mitch@gimp.org> 2973 2974 * libgimp/gimpimage.h: one more s/cmap/colormap/. 2975 29762004-11-02 Michael Natterer <mitch@gimp.org> 2977 2978 * tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions. 2979 2980 * app/pdb/transform_tools_cmds.c 2981 * libgimp/gimptransformtools_pdb.[ch]: regenerated. 2982 2983 * plug-ins/common/tiff.c 2984 * plug-ins/script-fu/scripts/3dTruchet.scm 2985 * plug-ins/script-fu/scripts/coolmetal-logo.scm 2986 * plug-ins/script-fu/scripts/image-structure.scm 2987 * plug-ins/script-fu/scripts/perspective-shadow.scm 2988 * plug-ins/script-fu/scripts/text-circle.scm 2989 * plug-ins/script-fu/scripts/truchet.scm: use the new transform API. 2990 29912004-11-02 Michael Natterer <mitch@gimp.org> 2992 2993 * tools/pdbgen/pdb/drawable_transform.pdb: added _defaults() 2994 variants (flip_defaults, rotate_defaults, ...) for all transform 2995 functions which finally call gimp_drawable_transform_affine(). 2996 The _defaults() functions don't take the whole interpolation_type, 2997 supersample etc. parameter overkill, but only a "interpolation" 2998 boolean like the old PDB wrappers. 2999 3000 * libgimp/gimp.def: changed accordingly. 3001 3002 * app/pdb/drawable_transform_cmds.c 3003 * app/pdb/internal_procs.c 3004 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3005 30062004-11-02 Michael Natterer <mitch@gimp.org> 3007 3008 * tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and 3009 rotate() to flip_simple() and rotate_simple(). Renamed flip_free() 3010 and rotate_free() to flip() and rotate() (the special cases should 3011 have a special suffix, not the general ones). 3012 3013 * libgimp/gimp.def: changed accordingly. 3014 3015 * app/pdb/drawable_transform_cmds.c 3016 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3017 30182004-11-02 Michael Natterer <mitch@gimp.org> 3019 3020 * plug-ins/common/compressor.c (compressors): added missing bzip2 3021 command lines for Win32. 3022 30232004-11-02 Michael Natterer <mitch@gimp.org> 3024 3025 * plug-ins/bmp/bmpread.c 3026 * plug-ins/bmp/bmpwrite.c 3027 * plug-ins/common/CEL.c 3028 * plug-ins/common/animationplay.c 3029 * plug-ins/common/animoptimize.c 3030 * plug-ins/common/autostretch_hsv.c 3031 * plug-ins/common/c_astretch.c 3032 * plug-ins/common/ccanalyze.c 3033 * plug-ins/common/color_enhance.c 3034 * plug-ins/common/film.c 3035 * plug-ins/common/gee.c 3036 * plug-ins/common/gee_zoom.c 3037 * plug-ins/common/gif.c 3038 * plug-ins/common/gifload.c 3039 * plug-ins/common/grid.c 3040 * plug-ins/common/header.c 3041 * plug-ins/common/mng.c 3042 * plug-ins/common/normalize.c 3043 * plug-ins/common/pcx.c 3044 * plug-ins/common/png.c 3045 * plug-ins/common/pnm.c 3046 * plug-ins/common/postscript.c 3047 * plug-ins/common/psd.c 3048 * plug-ins/common/psd_save.c 3049 * plug-ins/common/raw.c 3050 * plug-ins/common/sunras.c 3051 * plug-ins/common/tga.c 3052 * plug-ins/common/tiff.c 3053 * plug-ins/common/tile.c 3054 * plug-ins/common/vinvert.c 3055 * plug-ins/common/winclipboard.c 3056 * plug-ins/common/winprint.c 3057 * plug-ins/common/xbm.c 3058 * plug-ins/common/xpm.c 3059 * plug-ins/common/xwd.c 3060 * plug-ins/fits/fits.c 3061 * plug-ins/gfli/gfli.c 3062 * plug-ins/imagemap/imap_preview.c 3063 * plug-ins/print/print.c 3064 * plug-ins/pygimp/pygimp-image.c 3065 * plug-ins/winicon/main.c: use the new "colormap" functions 3066 instead of the deprecated "cmap" ones. 3067 30682004-11-02 Michael Natterer <mitch@gimp.org> 3069 3070 More final API cleanup: 3071 3072 * tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap() 3073 and deprecated set,get_cmap(). 3074 3075 * libgimpwidgets/gimppreviewarea.[ch]: renamed 3076 gimp_preview_area_set_cmap() to set_colormap(). 3077 3078 * libgimp/gimp.def 3079 * libgimp/gimpdrawablepreview.c 3080 * libgimp/gimpexport.c 3081 * libgimp/gimpimage.[ch] 3082 * libgimpwidgets/gimpwidgets.def: changed accordingly. 3083 3084 * app/pdb/image_cmds.c 3085 * app/pdb/internal_procs.c 3086 * libgimp/gimpimage_pdb.[ch]: regenerated. 3087 3088 (undeprecation of plug-ins will follow...) 3089 30902004-11-02 Michael Natterer <mitch@gimp.org> 3091 3092 * app/tools/gimpcroptool.c (crop_recalc): added "gboolean 3093 recalc_highlight" and call gimp_display_shell_set_highlight() only 3094 when it's TRUE. Pass TRUE from all places where the crop outline 3095 actually changed. 3096 3097 (gimp_crop_tool_control): added back the call to crop_recalc() for 3098 the RESUME case so the outline gets updated on zoom/scroll, but pass 3099 recalc_highlight = FALSE because it has not changed. 3100 Fixes bug #157001. 3101 31022004-11-02 Michael Natterer <mitch@gimp.org> 3103 3104 * tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed 3105 parameter "center" to "auto_center" and removed 3106 "transform_direction". Renamed rotate() to rotate_free() and 3107 added a "gboolean auto_center" parameter. Added new function 3108 rotate() which takes enum GimpRotationType instead of an 3109 arbiatrary angle so the flip and rotate APIs are symmetric. 3110 3111 * libgimp/gimp.def: added the gimp_drawable_transform_* stuff. 3112 3113 * app/pdb/drawable_transform_cmds.c 3114 * app/pdb/internal_procs.c 3115 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3116 31172004-11-02 Sven Neumann <sven@gimp.org> 3118 3119 * app/dialogs/image-scale-dialog.c (image_scale_callback): actually 3120 use the choosen interpolation type. Fixes bug #157102. 3121 31222004-11-02 DindinX <dindinx@gimp.org> 3123 3124 * plug-ins/gfig/gfig-dobject.c 3125 * plug-ins/gfig/gfig-dobject.h 3126 * plug-ins/gfig/gfig-preview.c 3127 * plug-ins/gfig/gfig-style.h 3128 * plug-ins/gfig/gfig-types.h 3129 * plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is 3130 still there :( 3131 31322004-11-01 Øyvind Kolås <pippin@gimp.org> 3133 3134 * app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity 3135 checking for the xcf loader, colormaps read from non indexed images 3136 are discarded. Does not fix bug #134097, but prevents gimp from 3137 reloading an impossible state. 3138 31392004-11-01 Michael Natterer <mitch@gimp.org> 3140 3141 * app/core/gimpdrawable-transform.[ch] 3142 (gimp_drawable_transform_flip): renamed "center" to "auto_center". 3143 3144 (gimp_drawable_transform_rotate): added missing parameters so it 3145 can be used for a to-be-added PDB wrapper offering a 3146 GimpRotationType based rotate API. 3147 3148 Both functions: always clip when transforming a whole channel, 3149 since they must keep their size. 3150 3151 (gimp_drawable_transform_affine): actually forward the passed 3152 "clip_result" to transform_tiles_affine() instead of always FALSE. 3153 31542004-11-01 Øyvind Kolås <pippin@gimp.org> 3155 3156 * app/pdb/color_cmds.c 3157 * app/pdb/internal_procs.c 3158 * libgimp/gimpcolor_pdb.c 3159 * libgimp/gimpcolor_pdb.h: regenerated 3160 * tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed 3161 metainformation from deprecated levels-auto. 3162 31632004-11-01 Øyvind Kolås <pippin@gimp.org> 3164 3165 * app/actions/drawable-actions.c 3166 * app/actions/drawable-commands.c 3167 * app/actions/drawable-commands.h 3168 * app/base/levels.c 3169 * app/base/levels.h 3170 * app/core/gimpdrawable-levels.c 3171 * app/core/gimpdrawable-levels.h 3172 * app/pdb/color_cmds.c 3173 * app/tools/gimplevelstool.c 3174 * libgimp/gimpcolor_pdb.c 3175 * menus/image-menu.xml 3176 * menus/image-menu.xml.in 3177 * tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto 3178 to [drawable-]levels-stretch, anticipating other ways to automatically 3179 determine levels settings, old PDB command maintained, but marked 3180 as deprecated. 3181 31822004-11-01 Sven Neumann <sven@gimp.org> 3183 3184 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): 3185 don't check for file_proc->menu_paths. Our load and save procedure 3186 don't necessarily register a menu path any longer. 3187 3188 * app/plug-in/plug-ins.c: minor cleanup. 3189 3190 * app/xcf/xcf.c (xcf_init): no need for adding menu paths for the 3191 XCF load and save procedures. 3192 3193 * tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation. 3194 3195 * app/pdb/fileops_cmds.c 3196 * libgimp/gimpfileops_pdb.c: regenerated. 3197 31982004-11-01 Michael Natterer <mitch@gimp.org> 3199 3200 * tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to 3201 the transform_options_args() utility function and changed all 3202 wrappers accordingly. Removed "interpolation", "supersample" and 3203 "recursion_level" args from drawable_transform_flip(). 3204 3205 * app/pdb/drawable_transform_cmds.c 3206 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3207 32082004-11-01 Sven Neumann <sven@gimp.org> 3209 3210 * plug-ins/common/tiff.c (query): fixed typo. 3211 32122004-11-01 Michael Natterer <mitch@gimp.org> 3213 3214 * app/actions/drawable-actions.c: trailing whitespace. 3215 3216 * app/actions/drawable-commands.[ch]: partly revert alphabetical 3217 ordering. Instead, group them as in drawable-actions.c and order 3218 by alphabet inside the groups (different ordering in *-actions.c 3219 and *-commands.c is inconvenient for the usual workflow of editing 3220 both files at the same time). 3221 3222 * app/core/gimpdrawable-levels.h: indentation. 3223 32242004-11-01 Michael Natterer <mitch@gimp.org> 3225 3226 * themes/Small/gtkrc: don't change GtkDialog::button_spacing and 3227 ::action_area_border because it breaks alignment with all other 3228 dialog spacings or borders (which are hardcoded). 3229 32302004-11-01 DindinX <dindinx@gimp.org> 3231 3232 * plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses. 3233 This makes the sources easier to read. 3234 3235 * plug-ins/gfig/Makefile.am: added gfig-types.h 3236 3237 * plug-ins/gfig/gfig.h: removed some types definitions and put them 3238 in gfig-types.h and ... 3239 3240 * plug-ins/gfig/gfig-dobject.h 3241 * plug-ins/gfig/gfig-style.h: ...into these files. 3242 32432004-10-31 Sven Neumann <sven@gimp.org> 3244 3245 * Made 2.2-pre1 release. 3246 32472004-10-31 Simon Budig <simon@gimp.org> 3248 3249 * data/images/gimp-splash.png: new splash based on a great photo 3250 (and pumpkin) by Seth Burgess <sjburges@gimp.org>. 3251 32522004-10-31 Simon Budig <simon@gimp.org> 3253 3254 * plug-ins/common/plasma.c: Fixed handling of 1x1 selection and 3255 selection out of drawable. 3256 32572004-10-31 Sven Neumann <sven@gimp.org> 3258 3259 * plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h. 3260 32612004-10-31 Sven Neumann <sven@gimp.org> 3262 3263 * configure.in: changed gimp_version to 2.2-pre1, to match the 3264 naming scheme of the 2.0 pre-releases. 3265 32662004-10-31 Sven Neumann <sven@gimp.org> 3267 3268 * plug-ins/common/newsprint.c: removed an unused variable. 3269 32702004-10-31 Sven Neumann <sven@gimp.org> 3271 3272 * app/dialogs/user-install-dialog.c: when migrating the user 3273 settings, tolerate errors and create the tmp directory that was 3274 explicitely not copied. 3275 32762004-10-31 Sven Neumann <sven@gimp.org> 3277 3278 * app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the 3279 file permissions also. 3280 3281 * app/dialogs/user-install-dialog.c: added code to migrate user 3282 settings from ~/.gimp-2.0. It copies all files (except GIMP swap 3283 files) and all subdirectories (except tmp) with all files. It 3284 doesn't recurse into subdirectories. 3285 32862004-10-31 Sven Neumann <sven@gimp.org> 3287 3288 * app/config/gimpguiconfig.c: disabled the image area by default 3289 to reduce some clutter. 3290 32912004-10-31 Sven Neumann <sven@gimp.org> 3292 3293 * app/dialogs/user-install-dialog.c: fixed page logic for migration 3294 of user settings. Still missing code to actually copy the files. 3295 32962004-10-31 Sven Neumann <sven@gimp.org> 3297 3298 * libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory 3299 size identifiers. 3300 33012004-10-31 Sven Neumann <sven@gimp.org> 3302 3303 * app/widgets/gimpimageeditor.c (gimp_image_editor_set_context): 3304 set the active image. Fixes bug #156942. 3305 33062004-10-31 Sven Neumann <sven@gimp.org> 3307 3308 * app/dialogs/user-install-dialog.c: started to work on migration of 3309 user settings (bug #156636). Not at all functional yet. 3310 33112004-10-31 Sven Neumann <sven@gimp.org> 3312 3313 * libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio 3314 groups created with gimp_radio_group_new(). 3315 33162004-10-31 DindinX <dindinx@gimp.org> 3317 3318 * plug-ins/gfig/gfig-dialog.c 3319 * plug-ins/gfig/gfig-dobject.c: some more UI improvements. 3320 33212004-10-31 Sven Neumann <sven@gimp.org> 3322 3323 * app/widgets/gimpsizebox.c: added a size entry to edit the 3324 resolution. This should close bug #151022. 3325 33262004-10-31 Sven Neumann <sven@gimp.org> 3327 3328 * app/dialogs/resize-dialog.c: connect the offset controls. 3329 33302004-10-30 DindinX <dindinx@gimp.org> 3331 3332 * plug-ins/gfig/gfig-dobject.c 3333 * plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at 3334 the price of a smallish mem-leak that I will fix later. 3335 33362004-10-30 Sven Neumann <sven@gimp.org> 3337 3338 * app/composite/gimp-composite-generic.c 3339 (gimp_composite_hue_any_any_any_generic): do nothing if the color 3340 has no saturation. Patch by Joao S. Bueno. Fixes bug #123296. 3341 33422004-10-30 Sven Neumann <sven@gimp.org> 3343 3344 * app/actions/image-commands.c (image_scale_cmd_callback): destroy 3345 the scale dialog when the display is disconnected. 3346 3347 * app/dialogs/resize-dialog.c: fixed a couple of bugs related to 3348 the offset area. Still work in progress. 3349 33502004-10-30 DindinX <dindinx@gimp.org> 3351 3352 * plug-ins/common/newsprint.c: Moved the preview to the left, as 3353 suggested by Joao S. O. Bueno. 3354 33552004-10-30 DindinX <dindinx@gimp.org> 3356 3357 * plug-ins/gfig/gfig-dialog.c 3358 * plug-ins/gfig/gfig-line.c 3359 * plug-ins/gfig/gfig-line.h 3360 * plug-ins/gfig/gfig-poly.c 3361 * plug-ins/gfig/gfig-preview.c 3362 * plug-ins/gfig/gfig-star.c 3363 * plug-ins/gfig/gfig-style.c 3364 * plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still 3365 work in progress. 3366 3367 * plug-ins/gfig/pix-data.h: removed this empty, unused file. 3368 33692004-10-30 Sven Neumann <sven@gimp.org> 3370 3371 * app/config/gimpguiconfig.[ch] 3372 * app/config/gimprc-blurbs.h 3373 * app/dialogs/preferences-dialog.c 3374 * app/tools/gimpmoveoptions.[ch] 3375 * app/tools/gimpmovetool.[ch]: reverted changes for bug #156801. 3376 Instead added a gimprc option that allows to get the old behaviour 3377 back. 3378 33792004-10-30 Sven Neumann <sven@gimp.org> 3380 3381 * app/tools/gimpmoveoptions.[ch] 3382 * app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a 3383 patch from Joao S. O. Bueno that adds a tool-option to restore the 3384 old Move tool behaviour. Fixes bug #156801. 3385 33862004-10-30 Sven Neumann <sven@gimp.org> 3387 3388 * plug-ins/common/despeckle.c: applied a patch from Geert Jordaens 3389 that improves the Despeckle algorithm. See bug #72862. 3390 33912004-10-29 Kevin Cozens <kcozens@cvs.gimp.org> 3392 3393 * plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to 3394 use convert_string() to change name of constant to Scheme format. 3395 33962004-10-30 Sven Neumann <sven@gimp.org> 3397 3398 * INSTALL 3399 * NEWS 3400 * README: updated for 2.2 pre-releases. 3401 34022004-10-30 Sven Neumann <sven@gimp.org> 3403 3404 * plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno 3405 that implements the opacity parameters the way it is documented. 3406 Fixes bug #156750. 3407 34082004-10-30 Sven Neumann <sven@gimp.org> 3409 3410 * plug-ins/common/glasstile.c: applied patch from Yeti, updated by 3411 Kevin Cozens and modified by me. Fixes bug #85261. 3412 34132004-10-29 Øyvind Kolås <pippin@gimp.org> 3414 3415 * tools/pdbgen/pdb/color.pdb: moved body of code from here. 3416 3417 * app/core/gimpdrawable-levels.[ch]: to here. 3418 * app/core/Makefile.am: added gimpdrawable-levels.[ch]. 3419 * app/pdb/color_cmds.c: regenerated. 3420 3421 * app/actions/drawable-actions.c 3422 * app/actions/drawable-commands.[ch]: added drawable-layers-auto 3423 action. 3424 3425 * app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE. 3426 * app/menus/image-menu.xml.in: added new auto/White Balance action. 3427 * app/menus/image-menu.xml: regenerated. 3428 34292004-10-29 Sven Neumann <sven@gimp.org> 3430 3431 * app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load) 3432 * app/widgets/gimpclipboard.c (gimp_clipboard_init): only be 3433 verbose on request. 3434 3435 * app/plug-in/plug-in.c (plug_in_close): turned warnings into 3436 messages and respect gimp->be_verbose. 3437 34382004-10-29 Øyvind Kolås <pippin@gimp.org> 3439 3440 * app/actions/drawable-commands.[ch] 3441 * app/actions/drawable-actions.[ch]: alphabetized file pending 3442 addition. 3443 34442004-10-29 Kevin Cozens <kcozens@cvs.gimp.org> 3445 3446 * plug-ins/script-fu/scripts/test-sphere.scm: Added notes about 3447 use of SF-PALETTE. 3448 34492004-10-29 Sven Neumann <sven@gimp.org> 3450 3451 * plug-ins/common/jpeg.c: pass the name in filesystem encoding to 3452 gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in. 3453 34542004-10-29 Sven Neumann <sven@gimp.org> 3455 3456 * app/file/file-utils.c (file_utils_uri_to_utf8_filename): when 3457 the filename cannot be converted to UTF-8, warn and return the URI 3458 instead. This is a workaround for the crash described in bug #153751. 3459 34602004-10-29 Michael Natterer <mitch@gimp.org> 3461 3462 * app/dialogs/dialogs.c (toplevel_entries): added foreign entries 3463 for the keyboard shortcut and the controller action dialogs. 3464 3465 * app/dialogs/preferences-dialog.c 3466 * app/widgets/gimpcontrollereditor.c: register the dialogs with 3467 the "toplevel" dialog factory so they remember their size and 3468 position. 3469 34702004-10-29 Michael Natterer <mitch@gimp.org> 3471 3472 * plug-ins/dbbrowser/gimpprocbrowser.c 3473 * plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or 3474 "1 Plug-In Interfaces" but use the singular form instead. 3475 34762004-10-29 Michael Natterer <mitch@gimp.org> 3477 3478 * plug-ins/common/flarefx.c 3479 * plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR. 3480 3481 * plug-ins/common/iwarp.c 3482 * plug-ins/gflare/gflare.c 3483 * plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview 3484 cursors. Not quite perfect for IfsCompose (actually needs tool- 3485 and constext-sensitive cursors) but definitely better than 3486 before. Fixes bug #90519. 3487 34882004-10-29 Sven Neumann <sven@gimp.org> 3489 3490 * tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the 3491 docs for gimp_edit_fill(). 3492 3493 * app/pdb/edit_cmds.c 3494 * libgimp/gimpedit_pdb.c: regenerated. 3495 34962004-10-28 DindinX <dindinx@gimp.org> 3497 3498 * plug-ins/gfig/gfig-arc.c 3499 * plug-ins/gfig/gfig-bezier.c 3500 * plug-ins/gfig/gfig-bezier.h 3501 * plug-ins/gfig/gfig-dialog.c 3502 * plug-ins/gfig/gfig-dialog.h 3503 * plug-ins/gfig/gfig-dobject.c 3504 * plug-ins/gfig/gfig-dobject.h 3505 * plug-ins/gfig/gfig-ellipse.c 3506 * plug-ins/gfig/gfig-grid.c 3507 * plug-ins/gfig/gfig-grid.h 3508 * plug-ins/gfig/gfig.c: small cleanups 3509 35102004-10-28 Sven Neumann <sven@gimp.org> 3511 3512 * libgimp/gimpdrawablecombobox.c 3513 * libgimp/gimpimagecombobox.c: changed the API docs to suggest to 3514 use gimp_int_combo_box_connect() with these widgets. We don't want 3515 more people to be caught by bug #156659. 3516 35172004-10-28 Sven Neumann <sven@gimp.org> 3518 3519 * plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug 3520 which caused the intersection color to be drawn with the wrong 3521 shade of gray when drawing on a grayscale drawable. 3522 35232004-10-28 Sven Neumann <sven@gimp.org> 3524 3525 * app/dialogs/resize-dialog.c: added the offset area back. Still 3526 work in progress. 3527 35282004-10-28 Sven Neumann <sven@gimp.org> 3529 3530 * plug-ins/helpbrowser/dialog.c: only create a "Document not 3531 found" error page if the requested URL was a page to load, not a 3532 supplementary URL like an image. Fixes bug #138275. 3533 35342004-10-28 Sven Neumann <sven@gimp.org> 3535 3536 * plug-ins/bmp/bmp.c 3537 * plug-ins/common/CEL.c 3538 * plug-ins/common/aa.c 3539 * plug-ins/common/compressor.c 3540 * plug-ins/common/csource.c 3541 * plug-ins/common/dicom.c 3542 * plug-ins/common/gbr.c 3543 * plug-ins/common/gif.c 3544 * plug-ins/common/gifload.c 3545 * plug-ins/common/gih.c 3546 * plug-ins/common/gtm.c 3547 * plug-ins/common/header.c 3548 * plug-ins/common/jpeg.c 3549 * plug-ins/common/mng.c 3550 * plug-ins/common/pat.c 3551 * plug-ins/common/pcx.c 3552 * plug-ins/common/pix.c 3553 * plug-ins/common/png.c 3554 * plug-ins/common/pnm.c 3555 * plug-ins/common/postscript.c 3556 * plug-ins/common/psd.c 3557 * plug-ins/common/psd_save.c 3558 * plug-ins/common/psp.c 3559 * plug-ins/common/sunras.c 3560 * plug-ins/common/svg.c 3561 * plug-ins/common/tga.c 3562 * plug-ins/common/tiff.c 3563 * plug-ins/common/url.c 3564 * plug-ins/common/wmf.c 3565 * plug-ins/common/xbm.c 3566 * plug-ins/common/xpm.c 3567 * plug-ins/common/xwd.c 3568 * plug-ins/faxg3/faxg3.c 3569 * plug-ins/fits/fits.c 3570 * plug-ins/gfli/gfli.c 3571 * plug-ins/sgi/sgi.c 3572 * plug-ins/winicon/main.c 3573 * plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register() 3574 from all plug-ins. File plug-ins don't register into a menu any longer. 3575 35762004-10-28 Sven Neumann <sven@gimp.org> 3577 3578 * plug-ins/common/raw.c (query): do not install an extension for 3579 the raw plug-in to avoid confusion with the dcraw format. 3580 35812004-10-28 Sven Neumann <sven@gimp.org> 3582 3583 * app/actions/layers-actions.c (layers_actions_update): do not set 3584 the "layers-mask-add" action insensitive if there's no alpha channel. 3585 3586 * app/actions/layers-commands.c (layers_add_mask_response): add an 3587 alpha channel if there isn't one already. Fixes bug #156676. 3588 35892004-10-28 Sven Neumann <sven@gimp.org> 3590 3591 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): 3592 use gimp_int_combo_box_connect() so that the initial selection 3593 causes the "changed" callback to be run. Should fix bug #156659. 3594 35952004-10-28 Øyvind Kolås <pippin@gimp.org> 3596 3597 * app/display/gimpdisplayshell-preview.c: Improve preview accuracy of 3598 perspective transform, by subdiving into a 5x5 grid. 3599 3600 Fixes bug #152222. 3601 36022004-10-27 Philip Lafleur <plafleur@cvs.gnome.org> 3603 3604 * app/display/gimpdisplayshell-preview.c: Really fixed all cases 3605 of the perspective tool preview breaking with certain orientations by 3606 using triangles instead of quads. 3607 36082004-10-27 Philip Lafleur <plafleur@cvs.gnome.org> 3609 3610 * app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases 3611 of the perspective tool preview breaking with certain orientations. 3612 36132004-10-27 Manish Singh <yosh@gimp.org> 3614 3615 * tools/pdbgen/enumcode.pl: Don't declare $first twice. 3616 3617 * libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail. 3618 3619 * libgimp/gimpenums.c.tail: Added into CVS. 3620 36212004-10-27 DindinX <dindinx@gimp.org> 3622 3623 * plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the 3624 bezier tool options instead of yet another popup window. 3625 3626 * plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit. 3627 36282004-10-27 Øyvind Kolås <pippin@gimp.org> 3629 3630 * app/core/gimpdrawable-transform.c: made the fixed point used in 3631 supersampling configurable (in source) and changed from 15.16 to 3632 21.10 fixed point. 3633 3634 Fixes bug #128594 for drawables less than 2G wide. 3635 36362004-10-27 Michael Schumacher <schumaml@gmx.de> 3637 3638 * app/widgets/gimpwidgets-utils.c: fixed a typo in 3639 #include "libgimpbase/gimpwin32-io.h" 3640 36412004-10-27 DindinX <dindinx@gimp.org> 3642 3643 * plug-ins/gfig/gfig-dialog.[ch] 3644 * plug-ins/gfig/gfig-poly.[ch] 3645 * plug-ins/gfig/gfig-spiral.[ch] 3646 * plug-ins/gfig/gfig-star.[ch] 3647 * plug-ins/gfig/gfig.h: first step of moving all the hidden popup 3648 dialogs for the tool options in a GtkNotebook showing the options 3649 within one page for each tool. 3650 36512004-10-27 Sven Neumann <sven@gimp.org> 3652 3653 * tools/pdbgen/enumcode.pl: removed trailing commmas from output. 3654 36552004-10-27 Sven Neumann <sven@gimp.org> 3656 3657 * tools/pdbgen/enumcode.pl: fixed loop control in 3658 _gimp_enums_init(). This caused all plug-ins to crash immidiately. 3659 You will need to make sure that libgimp/gimpenums.c.tail is 3660 recreated and appended to libgimp/gimpenums.c 3661 36622004-10-27 Michael Natterer <mitch@gimp.org> 3663 3664 * app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2 3665 bounding boxes to x,y,width,height ones. Added 3666 gimp_transform_matrix_flip_free(). Renamed some parameters to be 3667 consistent with others. Some internal cleanup. 3668 3669 * app/tools/gimpperspectivetool.c 3670 * app/tools/gimpscaletool.c 3671 * app/tools/gimpsheartool.c 3672 * tools/pdbgen/pdb/drawable_transform.pdb 3673 * tools/pdbgen/pdb/transform_tools.pdb: changed accordingly. 3674 3675 * tools/pdbgen/pdb/drawable_transform.pdb 3676 * tools/pdbgen/pdb/transform_tools.pdb: guard all transform 3677 wrappers with if(gimp_drawable_mask_intersect(...)), also the 3678 ones which don't need the returned bounding box. 3679 3680 * tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters 3681 and added gimp_drawable_transform_matrix() which takes the 9 3682 coefficients of a 3x3 matrix for ultimate flexibility ;) 3683 3684 * app/pdb/drawable_transform_cmds.c 3685 * app/pdb/internal_procs.c 3686 * app/pdb/transform_tools_cmds.c 3687 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3688 36892004-10-27 Sven Neumann <sven@gimp.org> 3690 3691 * app/actions/dockable-actions.c (dockable_toggle_actions): changed 3692 menu label from "Show Image Menu" to "Show Image Selection". 3693 3694 * app/widgets/gimpsizebox.c: unmarked a string for translation. 3695 3696 * app/dialogs/scale-dialog.c: added back the message when scaling 3697 an indexed image. 3698 36992004-10-27 DindinX <dindinx@gimp.org> 3700 3701 * libgimp/gimpaspectpreview.c: really use the second parameter of 3702 gimp_aspect_preview_new (), so plug-ins can now really remember the 3703 state of the preview between invocations. 3704 3705 * libgimpwidgets/gimpscrolledpreview.c: fix a little typo 3706 3707 * plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a 3708 boolean value (initial state of the preview) instead of a weird NULL. 3709 37102004-10-27 Michael Natterer <mitch@gimp.org> 3711 3712 * modules/controller_linux_input.c 3713 * modules/controller_midi.c: don't g_free(error) but 3714 g_clear_error(&error) the GError. 3715 37162004-10-27 Sven Neumann <sven@gimp.org> 3717 3718 * app/dialogs/resize-dialog.[ch]: started to redo the Resize 3719 dialog in the style of the new Scale dialog. Only halfway done but 3720 at least the new API is there. 3721 3722 * app/actions/image-commands.c 3723 * app/actions/layers-commands.c: changed accordingly. 3724 3725 * app/dialogs/image-scale-dialog.c: cosmetics. 3726 37272004-10-27 DindinX <dindinx@gimp.org> 3728 3729 * plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing 3730 spaces. 3731 37322004-10-26 Manish Singh <yosh@gimp.org> 3733 3734 * tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init, 3735 called pdb_misc in all procedures. 3736 3737 * app/pdb/drawable_transform_cmds.c 3738 * libgimp/gimpdrawabletransform_pdb.c: regenerated. 3739 37402004-10-27 Sven Neumann <sven@gimp.org> 3741 3742 * libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new 3743 files gimpdrawabletranform_pdb.[ch]. 3744 37452004-10-27 Sven Neumann <sven@gimp.org> 3746 3747 * app/dialogs/Makefile.am 3748 * app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale 3749 dialog that takes care of verifying the user input and optionally 3750 asking for confirmation. Most of this moved out of image-commands.c. 3751 3752 * app/actions/image-commands.c: use the new image scale dialog 3753 even though it doesn't allow to edit the resolution yet. That's a 3754 temporary regression that will get fixed soon. 3755 3756 * app/actions/layers-commands.c: cosmetics. 3757 3758 * app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the 3759 resolution. 3760 3761 * app/widgets/gimpsizebox.c: fixed cut'n'paste error. 3762 37632004-10-27 Sven Neumann <sven@gimp.org> 3764 3765 * app/widgets/gimpsizebox.[ch]: added a resolution label similar 3766 to one in the template editor. Prepared for editable resolution, 3767 work in progress... 3768 3769 * app/dialogs/scale-dialog.[ch]: added resolution and resolution 3770 unit parameters to ScaleDialogCallback. 3771 3772 * app/actions/layers-commands.c: changed accordingly. 3773 37742004-10-26 Sven Neumann <sven@gimp.org> 3775 3776 * app/widgets/gimptemplateeditor.c: commented out the memory size 3777 label. The visual clutter of it's bold appearance was IMO not 3778 appropriate. I think the dialog is better without it. 3779 3780 * app/widgets/gimpsizebox.c: added a pixel size label as in the 3781 Image New dialog. 3782 37832004-10-26 Sven Neumann <sven@gimp.org> 3784 3785 * tools/pdbgen/enumcode.pl: added gtk-doc comment for 3786 gimp_enums_get_type_names(). 3787 37882004-10-26 Sven Neumann <sven@gimp.org> 3789 3790 * plug-ins/common/retinex.c: applied patch by Geert Jordaens that 3791 lets Retinex deal with RGBA drawables. Closes bug #135594 again. 3792 37932004-10-26 Sven Neumann <sven@gimp.org> 3794 3795 Added new drawable transform API to the PDB. Largely based on 3796 patches from Joao S. O. Bueno. Fixes bug #137053. 3797 3798 * app/core/gimpdrawable-transform.[ch]: added missing parameters 3799 to gimp_drawable_transform_flip(). 3800 3801 * tools/pdbgen/pdb/transform_tools.pdb: changed accordinly. 3802 3803 * app/base/base-enums.h 3804 * app/core/core-enums.h: removed pdp-skip for GimpInterpolationType 3805 and GimpTransformDirection enums. 3806 3807 * libgimp/gimpenums.h 3808 * plug-ins/pygimp/gimpenums.py 3809 * tools/pdbgen/enums.pl 3810 * tools/pdbgen/groups.pl: regenerated. 3811 3812 * tools/pdbgen/Makefile.am 3813 * tools/pdbgen/pdb/drawable_transform.pdb: added new file defining 3814 the new PDB calls. 3815 3816 * app/pdb/Makefile.am 3817 * app/pdb/drawable_transform_cmds.c 3818 * app/pdb/internal_procs.c 3819 * app/pdb/transform_tools_cmds.c 3820 * libgimp/gimp_pdb.h 3821 * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. 3822 38232004-10-26 Michael Natterer <mitch@gimp.org> 3824 3825 * modules/controller_linux_input.c 3826 * modules/controller_midi.c: don't enter an infinite blocking loop 3827 when the user selects an input file that can be opened, but not 3828 read (like a directory). 3829 38302004-10-26 Michael Natterer <mitch@gimp.org> 3831 3832 * app/widgets/gimpactionview.[ch] (gimp_action_view_new): added 3833 parameter "const gchar *select_action" and preselect the passed 3834 action if non-NULL. Made the column enum public to users of this 3835 widget can get data from its tree store. 3836 3837 * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog): 3838 pass NULL because we don't want a preselected action here. 3839 3840 * app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete" 3841 buttons to change the event -> action mapping. Implement a action 3842 chooser dialog using GimpActionView. Fixes bug #106920. 3843 38442004-10-26 Sven Neumann <sven@gimp.org> 3845 3846 * app/actions/channels-commands.c 3847 * app/core/gimpchannel-select.c 3848 * app/core/gimpimagefile.c 3849 * app/core/gimpundo.c 3850 * app/widgets/gimpcomponenteditor.c: use the new enum utility 3851 functions from libgimpbase instead of accessing enum_value->value_name. 3852 38532004-10-26 Michael Natterer <mitch@gimp.org> 3854 3855 * app/dialogs/quit-dialog.c (quit_dialog_container_changed): when 3856 changing the button's label to "Quit", also make it the default 3857 action. 3858 38592004-10-26 Michael Natterer <mitch@gimp.org> 3860 3861 * app/widgets/Makefile.am 3862 * app/widgets/widgets-types.h 3863 * app/widgets/gimpcontrollereditor.[ch]: new widget built from 3864 preliminary code from the prefs dialog. Prerequisite for finally 3865 fixing bug #106920. 3866 3867 * app/dialogs/preferences-dialog.c: use the new widget. 3868 38692004-10-26 Michael Natterer <mitch@gimp.org> 3870 3871 * plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific 3872 code a bit. Use gimp_drawable_mask_intersect(). 3873 38742004-10-25 Manish Singh <yosh@gimp.org> 3875 3876 * tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for 3877 regexp group. 3878 38792004-10-26 Michael Natterer <mitch@gimp.org> 3880 3881 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): 3882 my last change removed the sanity check for array_length >= 0. 3883 Put it back. 3884 38852004-10-26 Michael Natterer <mitch@gimp.org> 3886 3887 * libgimpbase/gimpbase.def: updated. 3888 38892004-10-25 DindinX <dindinx@gimp.org> 3890 3891 * plug-ins/common/retinex.c: added this new plug-in. 3892 Addresses bug #135594 3893 3894 * plug-ins/common/plugin-defs.pl: modified accordingly. 3895 3896 * plug-ins/common/.cvsignore 3897 * plug-ins/common/Makefile.am: regenerated. 3898 3899 * plug-ins/gfig/gfig-arc.c 3900 * plug-ins/gfig/gfig-arc.h 3901 * plug-ins/gfig/gfig-circle.c 3902 * plug-ins/gfig/gfig-circle.h 3903 * plug-ins/gfig/gfig-dialog.c: smallish style cleanups 3904 39052004-10-25 Michael Natterer <mitch@gimp.org> 3906 3907 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): 3908 silently accept arrays which are longer than specified. Nothing 3909 bad can happen and it's common practice to resize arrays in fixed 3910 size chunks so avoid frequent resizing. Fixes bug #155359. 3911 39122004-10-25 Michael Natterer <mitch@gimp.org> 3913 3914 * plug-ins/script-fu/siod-wrapper.c (init_constants): removed 3915 debugging output i forgot. 3916 39172004-10-25 Sven Neumann <sven@gimp.org> 3918 3919 * app/dialogs/quit-dialog.c: change the action button's label to 3920 "Quit" if there are no images with unsaved changes. 3921 39222004-10-25 Michael Natterer <mitch@gimp.org> 3923 3924 * libgimpbase/gimpbaseenums.[ch]: register some missing enums. 3925 3926 * tools/pdbgen/enumcode.pl: removed code to generate 3927 plug-ins/script-fu/script-fu-constants.c, generate code to 3928 explicitely initialize and query all of libgimp*'s enums 3929 and write it to libgimp/gimpenums.c.tail 3930 3931 * libgimp/gimpenums.h: regenerated. 3932 3933 * libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c 3934 3935 * libgimp/gimp.c (gimp_main): call g_type_init() and 3936 _gimp_enums_init(). 3937 3938 * libgimp/gimp.def: added gimp_enums_get_type_names(). 3939 3940 * plug-ins/script-fu/Makefile.am 3941 * plug-ins/script-fu/script-fu-constants.[ch]: removed these files. 3942 3943 * plug-ins/script-fu/siod-wrapper.c: dynamically register all 3944 constants using gimp_enums_get_type_names() and introspection. 3945 Also register the built-in unit types. 3946 3947 * plug-ins/script-fu/script-fu.c: changed accordingly. 3948 39492004-10-25 Michael Natterer <mitch@gimp.org> 3950 3951 Don't store human readable and translatable enum/flag strings in 3952 GEnumValue's and GTypeValue's fields but attach them to their 3953 GType using separate structs and utility functions: 3954 3955 * tools/gimp-mkenums: added params and perl voodoo to support 3956 generating a second array of values, which is used by the 3957 Makefiles below to create and register arrays of value 3958 descriptions. 3959 3960 * libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive 3961 arrays of translatable strings to/from enum and flags types. Added 3962 structs GimpEnumDesc and GimpFlagsDesc for that purpose. 3963 3964 * libgimpbase/gimputils.[ch]: changed existing enum utility 3965 functions, added new ones and added a symmetric API for flags. 3966 3967 * app/base/Makefile.am 3968 * app/core/Makefile.am 3969 * app/display/Makefile.am 3970 * app/paint/Makefile.am 3971 * app/text/Makefile.am 3972 * app/tools/Makefile.am 3973 * app/widgets/Makefile.am 3974 * libgimp/Makefile.am 3975 * libgimpbase/Makefile.am: changed *-enums.c generation rules 3976 accordingly. 3977 3978 * app/base/base-enums.c 3979 * app/core/core-enums.c 3980 * app/display/display-enums.c 3981 * app/paint/paint-enums.c 3982 * app/text/text-enums.c 3983 * app/tools/tools-enums.c 3984 * app/widgets/widgets-enums.c 3985 * libgimpbase/gimpbaseenums.c: regenerated. 3986 3987 * app/widgets/gimpenumstore.c 3988 * app/widgets/gimpenumwidgets.c 3989 * app/widgets/gimptemplateeditor.c 3990 * libgimpwidgets/gimppreviewarea.c: follow the enum utility 3991 function API changes. 3992 39932004-10-25 Sven Neumann <sven@gimp.org> 3994 3995 * plug-ins/imagemap/imap_cmd_gimp_guides.c 3996 * plug-ins/imagemap/imap_edit_area_info.c 3997 * plug-ins/imagemap/imap_main.c 3998 * plug-ins/imagemap/imap_menu.[ch] 3999 * plug-ins/imagemap/imap_menu_funcs.[ch] 4000 * plug-ins/imagemap/imap_misc.c 4001 * plug-ins/imagemap/imap_settings.c 4002 * plug-ins/imagemap/imap_source.c: added a menu entry for Help. 4003 Did more minor layout adjustments for HIG compliance. 4004 40052004-10-25 Michael Natterer <mitch@gimp.org> 4006 4007 * app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not 4008 just gimputils.h 4009 40102004-10-25 Michael Natterer <mitch@gimp.org> 4011 4012 * menus/toolbox-menu.xml.in: commented out the "Debug" submenu. 4013 Should do this via an xsltproc --param actually... 4014 40152004-10-25 DindinX <dindinx@gimp.org> 4016 4017 * plug-ins/common/newsprint.c: removed debugging g_print and 4018 remove my memory fix, since it was buggy and shouldn't be done. 4019 My fix just broke this plug-in (reported by Joao S. O. Bueno 4020 Calligaris) 4021 40222004-10-25 Simon Budig <simon@gimp.org> 4023 4024 * app/tools/gimpvectortool.c: Switch to design mode when 4025 Escape gets pressed. Untabbified. 4026 40272004-10-25 Michael Natterer <mitch@gimp.org> 4028 4029 * app/actions/gradient-editor-commands.c 4030 * app/display/gimpdisplayshell-preview.c: irrelevant coding style 4031 and spacing cleanups. 4032 4033 * app/widgets/gimpimageeditor.c: removed utility function 4034 gimp_image_editor_context_changed() and connect 4035 gimp_image_editor_set_image() directly using 4036 g_signal_connect_swapped(). 4037 40382004-10-25 Sven Neumann <sven@gimp.org> 4039 4040 * plug-ins/imagemap/imap_circle.c 4041 * plug-ins/imagemap/imap_cmd_gimp_guides.c 4042 * plug-ins/imagemap/imap_cmd_guides.c 4043 * plug-ins/imagemap/imap_default_dialog.[ch] 4044 * plug-ins/imagemap/imap_edit_area_info.c 4045 * plug-ins/imagemap/imap_grid.c 4046 * plug-ins/imagemap/imap_main.c 4047 * plug-ins/imagemap/imap_misc.c 4048 * plug-ins/imagemap/imap_polygon.c 4049 * plug-ins/imagemap/imap_preferences.c 4050 * plug-ins/imagemap/imap_rectangle.c 4051 * plug-ins/imagemap/imap_selection.c 4052 * plug-ins/imagemap/imap_source.c 4053 * plug-ins/imagemap/imap_toolbar.c 4054 * plug-ins/imagemap/imap_tools.c: reviewed for HIG 4055 compliance. Various other minor fixes. Closes bug #150004. 4056 40572004-10-25 Kevin Cozens <kcozens@cvs.gimp.org> 4058 4059 * plug-ins/script-fu/scripts/test-sphere.scm: Added parameter 4060 missing from argument list. 4061 40622004-10-25 Michael Natterer <mitch@gimp.org> 4063 4064 * tools/pdbgen/enumcode.pl 4065 * libgimp/Makefile.am: register all enums in libgimp/gimpenums.h 4066 with the type system. 4067 4068 * libgimp/gimpenums.h: regenerated. 4069 4070 * libgimp/gimp.def: updated. 4071 40722004-10-25 Sven Neumann <sven@gimp.org> 4073 4074 * configure.in: gimp_user_version should be 2.2. 4075 4076 * libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup. 4077 40782004-10-25 Sven Neumann <sven@gimp.org> 4079 4080 * configure.in: 4081 * app/Makefile.am 4082 * tools/Makefile.am: bumped version to 2.2.0-pre1, set app version 4083 to 2.2, reset other versions to 2.0. Changed library versioning so 4084 we install with the same soname as gimp-2.0 again. 4085 40862004-10-25 Sven Neumann <sven@gimp.org> 4087 4088 * app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say 4089 "Click to create preview" if no preview is available. 4090 40912004-10-25 Michael Natterer <mitch@gimp.org> 4092 4093 * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save() 4094 which saves a GtkTextBuffer's contents to a file. 4095 4096 * app/widgets/gimperrorconsole.c: use 4097 gimp_editor_add_action_button() and removed all "clicked" 4098 callbacks, including all file saving code. 4099 4100 * app/actions/error-console-actions.c 4101 * app/actions/error-console-commands.[ch]: added the code removed 4102 above to the action callbacks. Use gimp_text_buffer_save(). 4103 41042004-10-24 Michael Natterer <mitch@gimp.org> 4105 4106 * app/widgets/gimpgradienteditor.[ch] 4107 * app/widgets/gimppaletteeditor.[ch]: added public APIs for 4108 zooming the editors. Use gimp_editor_add_action_button() to create 4109 all buttons. Removed all button callbacks and all duplicated 4110 button sensitivity logic. 4111 4112 * app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update 4113 the editor's UI manager if it exists. 4114 4115 * app/actions/gradient-editor-actions.c 4116 * app/actions/gradient-editor-commands.[ch]: added zoom actions 4117 and callback and call gimp_gradient_editor_zoom(). Fixed 4118 gradient_editor_actions_update() to actually set all items' 4119 sensitivity (it was possible to modify read-only gradients and 4120 even to crash GIMP). 4121 4122 * app/actions/palette-editor-actions.c 4123 * app/actions/palette-editor-commands.[ch]: changed "new" and 4124 "zoom" actions to actually do their job instead of calling 4125 gtk_button_clicked(editor->foo_button). 4126 41272004-10-24 Michael Natterer <mitch@gimp.org> 4128 4129 * app/widgets/gimpcolormapeditor.c: removed the "Edit Color" 4130 dialog callbacks and use gimp_editor_add_action_button() for 4131 the edit button. Removed button sensitivity logic. Hide the 4132 color dialog when the image's mode changes. 4133 4134 * app/actions/colormap-editor-actions.c: added missing tooltip 4135 for the edit action. 4136 4137 * app/actions/colormap-editor-commands.c: implement the dialog 4138 here. 4139 41402004-10-24 DindinX <dindinx@gimp.org> 4141 4142 * app/core/gimpdrawable-desaturate.c: only return early if there's 4143 nothing to desaturate. 4144 41452004-10-24 Michael Natterer <mitch@gimp.org> 4146 4147 * app/actions/vectors-commands.c: don't leak the filenames of the 4148 import and export dialogs. 4149 41502004-10-24 Michael Natterer <mitch@gimp.org> 4151 4152 * app/dialogs/Makefile.am 4153 * app/dialogs/vectors-export-dialog.[ch] 4154 * app/dialogs/vectors-import-dialog.[ch]: new files. 4155 4156 * app/actions/vectors-commands.c: use the new dialogs and remember 4157 their last values. 4158 41592004-10-23 Sven Neumann <sven@gimp.org> 4160 4161 * app/actions/vectors-commands.c: added missing controls to the 4162 path import and export dialogs. 4163 41642004-10-23 DindinX <dindinx@gimp.org> 4165 4166 * plug-ins/common/newsprint.c: cleaned it up, fixed a (documented) 4167 memory leak and the weird behaviour of the resolution scales. 4168 41692004-10-23 DindinX <dindinx@gimp.org> 4170 4171 * plug-ins/common/newsprint.c: added a preview. 4172 41732004-10-23 Michael Natterer <mitch@gimp.org> 4174 4175 * libgimp/gimpaspectpreview.h 4176 * libgimp/gimpdrawablepreview.h 4177 * libgimp/gimpprogressbar.h 4178 * libgimpwidgets/gimpcellrenderercolor.h 4179 * libgimpwidgets/gimpcellrenderertoggle.h 4180 * libgimpwidgets/gimpframe.h 4181 * libgimpwidgets/gimpintcombobox.h 4182 * libgimpwidgets/gimpintstore.h 4183 * libgimpwidgets/gimppreview.h 4184 * libgimpwidgets/gimppreviewarea.h 4185 * libgimpwidgets/gimpscrolledpreview.h: added padding to all class 4186 structs which have been added since 2.0. 4187 41882004-10-23 Michael Natterer <mitch@gimp.org> 4189 4190 * app/actions/file-commands.c (file_save_cmd_callback): don't 4191 g_return_if_fail() if there is no active drawable, just silently 4192 return. 4193 4194 * app/actions/image-commands.c: remember the last merge_type of 4195 the "Merge Visible Layers" dialog. 4196 4197 * app/actions/layers-commands.c: remeber the last values of the 4198 "Add Layer Mask" dialog. 4199 4200 * app/actions/select-commands.c: renamed a bunch of static 4201 variables to be consistent with other variables used to remember 4202 dialog values. 4203 4204 * app/actions/view-commands.c (view_fullscreen_cmd_callback): it's 4205 useless to update the "view-fullscreen" actions here because the 4206 "fullscreen" state of the shell changes asynchronously 4207 42082004-10-23 Michael Natterer <mitch@gimp.org> 4209 4210 * app/dialogs/image-merge-layers-dialog.c 4211 * app/dialogs/layer-add-mask-dialog.c: made them not resizable. 4212 4213 * app/dialogs/convert-dialog.c 4214 * app/dialogs/offset-dialog.c: renamed ugly variables. 4215 4216 * app/dialogs/image-new-dialog.c 4217 * app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering. 4218 42192004-10-23 Michael Natterer <mitch@gimp.org> 4220 4221 * app/dialogs/Makefile.am 4222 * app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split 4223 out of actions/. 4224 4225 * app/actions/image-commands.c: removed it here. Some cleanup. 4226 42272004-10-23 Sven Neumann <sven@gimp.org> 4228 4229 * libgimpthumb/gimpthumb-utils.[ch] 4230 * libgimpthumb/gimpthumbnail.[ch] 4231 * libgimpthumb/gimpthumb.def: added missing API, mainly for deleting 4232 thumbnails. 4233 4234 * app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a 4235 failure thumbnail if one exists. Unless the thumbnail was created 4236 explicitely, remove all other thumbnails for this image. 4237 4238 * app/actions/documents-commands.c: changed accordingly. 4239 4240 * app/file/file-open.c: only save a thumbnail if there isn't a 4241 valid thumbnail already. 4242 4243 * app/widgets/gimpthumbbox.c: before attempting to create a new 4244 thumbnail, check if there's an uptodate failure thumbnail. 4245 42462004-10-23 Michael Natterer <mitch@gimp.org> 4247 4248 * app/dialogs/Makefile.am 4249 * app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split 4250 out of actions/. 4251 4252 * app/actions/layers-commands.c: removed it here. Some cleanup. 4253 42542004-10-23 Michael Natterer <mitch@gimp.org> 4255 4256 * autogen.sh: don't tell nonsense by printing "I am going to run 4257 ./configure with no arguments", because we always pass at least 4258 --enable-maintainer-mode. Instead, simply always print all 4259 arguments. Also removed --copy from the calls to glib-gettextize 4260 and intltoolize. 4261 42622004-10-23 Michael Natterer <mitch@gimp.org> 4263 4264 * libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the 4265 SLEECTION_STROKE and PATH_STROKE stock items so they can be used 4266 in action areas. 4267 4268 * app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash 4269 with "_Stroke" and reordered some code. 4270 4271 * app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead 4272 of GTK_STOCK_OK. Added parameters to specify the dialog's title 4273 so it doesn't say "Stroke Options". 4274 4275 * app/actions/select-commands.c 4276 * app/actions/vectors-commands.c 4277 * app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke 4278 Path" as dialog titles. 4279 42802004-10-23 Michael Natterer <mitch@gimp.org> 4281 4282 When there are variants of actions with and without dialog, let 4283 the dialog-less actions try to use the values from the last dialog 4284 invocation: 4285 4286 * app/actions/channels-actions.c 4287 * app/actions/channels-commands.[ch] 4288 * app/actions/layers-actions.c 4289 * app/actions/layers-commands.[ch] 4290 * app/actions/vectors-actions.c 4291 * app/actions/vectors-commands.[ch]: renamed the foo-new-defaults 4292 actions to foo-new-last-values and use the last values entered in 4293 the dialogs. 4294 4295 * app/widgets/gimpchanneltreeview.c 4296 * app/widgets/gimpitemtreeview.c 4297 * app/widgets/gimplayertreeview.c 4298 * app/widgets/gimpvectorstreeview.c: changed accordingly. Show 4299 the dialog on clicking "New" and call the last-values action on 4300 <shift>+click. 4301 4302 * app/actions/select-actions.c 4303 * app/actions/vectors-commands.c: renamed the foo-stroke-last-vals 4304 to -last-values. 4305 4306 * app/widgets/gimpselectioneditor.c 4307 * app/widgets/gimpvectorstreeview.c: stroke with last values on 4308 <shift> clicking the stroke buttons. 4309 43102004-10-23 Sven Neumann <sven@gimp.org> 4311 4312 * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a 4313 temporary file to avoid problems with concurrent thumbnail 4314 creation. 4315 43162004-10-23 Michael Natterer <mitch@gimp.org> 4317 4318 * app/dialogs/Makefile.am 4319 * app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog. 4320 4321 * app/actions/layers-commands.c: use it here. 4322 43232004-10-22 Sven Neumann <sven@gimp.org> 4324 4325 * app/tools/gimpimagemaptool.[ch] 4326 * app/tools/gimpcurvestool.c 4327 * app/tools/gimplevelstool.c: allow to Shift-click the Load and 4328 Save buttons to skip the file chooser dialog and reuse the last 4329 used filename. Fixes bug #75558. 4330 43312004-10-22 Michael Natterer <mitch@gimp.org> 4332 4333 * app/dialogs/Makefile.am 4334 * app/dialogs/template-options-dialog.[ch]: the new/edit template 4335 dialog. 4336 4337 * app/actions/templates-commands.c: removed the code here and use 4338 template_options_dialog_new(). Removed utility functions. Some 4339 cleanup. 4340 43412004-10-22 Michael Natterer <mitch@gimp.org> 4342 4343 * app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make 4344 sure the button_box is always interted at the very bottom of the 4345 editor. 4346 4347 * app/widgets/gimpviewabledialog.c: changed the "description" 4348 property from CONSTRUCT_ONLY to CONSTRUCT. 4349 4350 * app/widgets/gimpcolormapeditor.c: show the index of the edited 4351 color in the color dialog and use the correct icon. Replaced label 4352 "Hex triplet" by "HTML notation" to be consistent with the color 4353 dialog. Removed wrong 2 pixel border around the table below the 4354 preview. 4355 43562004-10-22 Sven Neumann <sven@gimp.org> 4357 4358 * plug-ins/common/wmf.c: fixed non-interactive call with default 4359 values. 4360 43612004-10-22 Sven Neumann <sven@gimp.org> 4362 4363 * app/actions/colormap-editor-actions.c 4364 * app/actions/dialogs-actions.c 4365 * app/core/gimpimage-colormap.c 4366 * app/dialogs/convert-dialog.c 4367 * app/dialogs/dialogs.c 4368 * app/widgets/gimpcolormapeditor.c: use the term "Colormap" 4369 instead of "Indexed Palette". Fixes bug #155829. 4370 43712004-10-22 Sven Neumann <sven@gimp.org> 4372 4373 * plug-ins/common/wmf.c: applied a patch by Karine Proot that adds 4374 a preview to the load dialog and a similar UI as the SVG loader. 4375 Fixes bug #133519 and bug #133521. 4376 43772004-10-22 Michael Natterer <mitch@gimp.org> 4378 4379 * app/core/core-enums.[ch]: added new enum GimpStrokeMethod which 4380 can be one of { LIBART, PAINT_CORE }. 4381 4382 * app/core/Makefile.am 4383 * app/core/core-types.h 4384 * app/core/gimpstrokedesc.[ch]: new object which encapsulates 4385 the params and setup logic for the different stroke methods. 4386 4387 * app/core/gimpitem.[ch]: use it in GimpItem::stroke() and 4388 in the gimp_item_stroke() wrapper. 4389 4390 * app/core/gimpchannel.c (gimp_channel_stroke) 4391 * app/core/gimpselection.c (gimp_selection_stroke) 4392 * app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly. 4393 4394 * app/actions/select-commands.c 4395 * app/actions/vectors-commands.c 4396 * app/dialogs/stroke-dialog.c 4397 * tools/pdbgen/pdb/edit.pdb 4398 * tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the 4399 code quite a bit. 4400 4401 * app/pdb/edit_cmds.c 4402 * app/pdb/paths_cmds.c: regenerated. 4403 44042004-10-22 Michael Natterer <mitch@gimp.org> 4405 4406 * app/widgets/gimppropwidgets.c: remember the param_spec with each 4407 radio button instead of with the box/frame around them. 4408 44092004-10-21 Kevin Cozens <kcozens@cvs.gimp.org> 4410 4411 * plug-ins/script-fu/script-fu.c: Removed _() tag from two strings 4412 that should not have been marked for translation. 4413 44142004-10-21 Kevin Cozens <kcozens@cvs.gimp.org> 4415 4416 * plug-ins/script-fu/scripts-fu.c: Fixed spelling error. 4417 44182004-10-21 Michael Natterer <mitch@gimp.org> 4419 4420 * app/actions/select-actions.c 4421 * app/actions/select-commands.[ch] 4422 * app/actions/vectors-actions.c 4423 * app/actions/vectors-commands.[ch]: added actions and callbacks 4424 to stroke with the last values used without showing the stroke 4425 dialog. The actions have no menu entries but can be called via 4426 shortcuts. Fixes bug #135746. 4427 4428 (Disclaimer: the uglyness of the callbacks shows the need for a 4429 stroke API overhaul). 4430 44312004-10-20 Michael Natterer <mitch@gimp.org> 4432 4433 * app/core/gimpdrawable-stroke.c 4434 (gimp_drawable_stroke_scan_convert): Replacing the call to 4435 gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect() 4436 was wrong because gimp_channel_is_empty() makes sure that the 4437 selection doesn't mask itself while being stroked. 4438 44392004-10-20 Michael Natterer <mitch@gimp.org> 4440 4441 * plug-ins/common/raw.c: ported to GimpPreviewArea. 4442 44432004-10-20 Michael Natterer <mitch@gimp.org> 4444 4445 * plug-ins/common/raw.c: new plug-in from Tim Copperfield, made 4446 work with the GIMP 2.1 API by Philipp Gühring, then heavily 4447 cleaned up and undeprecated by myself. Fixes bug #144943. 4448 4449 (still uses GtkPreview, but i wanted a sane state in cvs to diff 4450 against before replacing it) 4451 4452 * plug-ins/common/plugin-defs.pl: changed accordingly. 4453 4454 * plug-ins/common/Makefile.am: regenerated. 4455 44562004-10-20 Michael Natterer <mitch@gimp.org> 4457 4458 Fixed bug #155733 for libgimp: 4459 4460 * tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect() 4461 to the PDB and improved documentation for drawable_mask_bounds(). 4462 4463 * app/pdb/drawable_cmds.c 4464 * app/pdb/internal_procs.c 4465 * libgimp/gimpdrawable_pdb.[ch]: regenerated. 4466 4467 * libgimp/gimp.def: changed accordingly. 4468 44692004-10-20 Michael Natterer <mitch@gimp.org> 4470 4471 * app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect() 4472 which returns the same bounding box as gimp_drawable_mask_bounds(), 4473 but returns TRUE only if there is a non-empty intersection between 4474 the drawable and the selection, or no selection at all. It also 4475 returns the intersection as x,y,width,height instead of the 4476 eeky x1,y1,x2,y2. 4477 4478 * app/core/gimp-edit.c 4479 * app/core/gimpdrawable-blend.c 4480 * app/core/gimpdrawable-bucket-fill.c 4481 * app/core/gimpdrawable-desaturate.c 4482 * app/core/gimpdrawable-equalize.c 4483 * app/core/gimpdrawable-histogram.c 4484 * app/core/gimpdrawable-invert.c 4485 * app/core/gimpdrawable-stroke.c 4486 * app/core/gimpimagemap.c 4487 * app/core/gimpselection.c 4488 * tools/pdbgen/pdb/color.pdb 4489 * tools/pdbgen/pdb/transform_tools.pdb: either switch from 4490 gimp_drawable_mask_bounds() to _intersect() or check the return 4491 values of _mask_bounds() manually to avoid operations on empty 4492 areas. Return successfully because it's a nop, not a failure. 4493 Fixes bug #155733 for the core. 4494 4495 * app/pdb/color_cmds.c 4496 * app/pdb/transform_tools_cmds.c: regenerated. 4497 44982004-10-19 Michael Natterer <mitch@gimp.org> 4499 4500 * app/tools/gimptextoptions.c (gimp_text_options_gui): removed 4501 3 mnemonics. No other tool options label has a mnemonic. 4502 Addresses bug #155861. 4503 45042004-10-19 Michael Natterer <mitch@gimp.org> 4505 4506 * app/dialogs/Makefile.am 4507 * app/dialogs/vectors-options-dialog.[ch]: one more dialog split 4508 out of actions/. 4509 4510 * app/actions/vectors-commands.c: removed it here. Merged more 4511 utility functions into their only callers. 4512 4513 * app/actions/dockable-commands.c 4514 * app/actions/edit-commands.c 4515 * app/actions/file-commands.c 4516 * app/actions/palettes-commands.c 4517 * app/actions/tool-options-commands.c 4518 * app/actions/view-commands.c: renamed "qbox" and "query_box" 4519 variables to "dialog". 4520 45212004-10-19 Michael Natterer <mitch@gimp.org> 4522 4523 * plug-ins/common/screenshot.c (shoot_dialog): don't forget to set 4524 the mnemonic widgets for the labels. Fixes bug #155811. 4525 45262004-10-19 Michael Natterer <mitch@gimp.org> 4527 4528 * app/dialogs/Makefile.am 4529 * app/dialogs/channel-options-dialog.[ch]: new files implementing 4530 the channel options dialog with a horrid number of 13 construction 4531 parameters. Still better than having the same code twice, only 4532 differing in strings used... 4533 4534 * app/actions/channels-commands.c 4535 * app/actions/qmask-commands.c: removed the dialog code here and 4536 use channel_options_dialog_new(). 4537 45382004-10-19 Jay Cox <jaycox@gimp.org> 4539 4540 * plug-ins/common/psd_save.c: don't try to save psd files that are 4541 larger than 30000 pixels in either direction. Fixed the rle code 4542 to compress more compactly. Fixed a memmory leak in 4543 save_channel_data. 4544 45452004-10-18 Michael Natterer <mitch@gimp.org> 4546 4547 Action code review and pre-release consistency cleanup: 4548 4549 * app/actions/*-actions.c: added some missing and resolved 4550 conflicting mnemonics, added missing help IDs. Cleaned up the 4551 *_actions_update() functions. 4552 4553 * app/actions/channels-actions.c 4554 * app/actions/layers-actions.c 4555 * app/actions/vectors-actions.c (*_actions_update): simplified 4556 the code that figures the prev and next channel,layer,vectors. 4557 4558 * app/actions/qmask-actions.c: use the same accelerator for 4559 "qmask-active" and "qmask-toggle". Fixed action sensitivity. 4560 4561 * app/actions/channels-commands.c 4562 * app/actions/dockable-commands.c 4563 * app/actions/documents-commands.c 4564 * app/actions/gradients-commands.c 4565 * app/actions/layers-commands.c 4566 * app/actions/palettes-commands.c 4567 * app/actions/image-commands.c 4568 * app/actions/select-commands.c 4569 * app/actions/vectors-commands.c: folded tons of private utility 4570 functions into their only callers (they used to be public and 4571 called from outside before the switch to action based menus). 4572 Renamed functions and variables saying "query" or "qbox" to 4573 "dialog". Moved static functions to the end of the files. Misc 4574 minor cleanups. 4575 4576 * app/actions/drawable-actions.c 4577 * app/actions/drawable-commands.c: made the "drawable-visible" and 4578 "drawable-linked" actions affect the layer if the active drawable 4579 is a layer mask. 4580 4581 * app/actions/select-commands.c: added action to stroke with the 4582 last values used in an attempt to address bug #135746 but #if 0'ed 4583 it because the approach is too ugly. 4584 4585 * app/tools/gimpiscissorstool.c: changed mnemonic from I to S. 4586 4587 * menus/image-menu-xml.in: added more stuff to the (commented out) 4588 "context" menu. 4589 45902004-10-17 DindinX <dindinx@gimp.org> 4591 4592 * libgimp/gimppixelrgn.c: some more clues in the documentation 4593 (suggested by nomis) 4594 45952004-10-17 DindinX <dindinx@gimp.org> 4596 4597 * libgimp/gimppixelrgn.c: clarify some usecases for 4598 gimp_pixel_rgn_init(). 4599 46002004-10-17 DindinX <dindinx@gimp.org> 4601 4602 * plug-ins/common/colortoalpha.c: Added a preview. 4603 46042004-10-17 DindinX <dindinx@gimp.org> 4605 4606 * plug-ins/common/glasstile.c: use a GimpDrawablePreview. 4607 46082004-10-17 DindinX <dindinx@gimp.org> 4609 4610 * plug-ins/common/borderaverage.c: smallish cleanups. 4611 46122004-10-17 DindinX <dindinx@gimp.org> 4613 4614 * plug-ins/common/displace.c: Added a preview and minor cleanups. 4615 Can someone provide useful testcases for this plug-in? 4616 46172004-10-16 Michael Natterer <mitch@gimp.org> 4618 4619 * app/widgets/gimpitemtreeview.[ch]: moved "item_type" and 4620 "signal_name" from GimpItemTreeView to GimpItemTreeViewClass. 4621 Removed them from gimp_item_tree_view_new(). Require the view_type 4622 instead of item_type in gimp_item_tree_view_new(). 4623 4624 * app/widgets/gimpitemtreeview.c 4625 * app/widgets/gimpdrawabletreeview.c (get_type): made them 4626 abstract base classes. 4627 4628 * app/widgets/gimpchanneltreeview.c 4629 * app/widgets/gimplayertreeview.c 4630 * app/widgets/gimpvectorstreeview.c (class_init): set the 4631 item_type and signal_name members if GimpItemTreeViewClass. 4632 4633 * app/dialogs/dialogs-constructors.c: changed accordingly. 4634 46352004-10-16 Manish Singh <yosh@gimp.org> 4636 4637 * autogen.sh: Add support for automake 1.9. Also rm autom4te.cache, 4638 since it might interfere with differing autoconf versions. 4639 46402004-10-16 Michael Natterer <mitch@gimp.org> 4641 4642 * app/widgets/gimpuimanager.[ch]: added utility function 4643 gimp_ui_manager_get_action() which takes "group_name" and 4644 "action_name". 4645 4646 * app/display/gimpdisplayshell-close.c 4647 * app/widgets/gimpitemtreeview.c 4648 * app/widgets/gimptoolbox.c 4649 * app/widgets/gimptooloptionseditor.c: use it. 4650 46512004-10-16 Michael Natterer <mitch@gimp.org> 4652 4653 * app/actions/channels-actions.c 4654 * app/actions/colormap-editor-actions.c 4655 * app/actions/documents-actions.c 4656 * app/actions/tool-options-actions.c 4657 * app/actions/vectors-actions.c: added more tooltips for actions 4658 which are used as extended dialog button callbacks. 4659 4660 * app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep 4661 the list of extended actions in reverse order. 4662 4663 * app/widgets/gimpchanneltreeview.c 4664 * app/widgets/gimpcolormapeditor.c 4665 * app/widgets/gimpdocumentview.c 4666 * app/widgets/gimpitemtreeview.c 4667 * app/widgets/gimplayertreeview.c 4668 * app/widgets/gimpselectioneditor.c 4669 * app/widgets/gimptooloptionseditor.c 4670 * app/widgets/gimpvectorstreeview.c: don't set the tooltips 4671 manually. Removes another bunch of insane translatable multiline 4672 format strings. Pass the extended actions in the right order 4673 to gimp_editor_add_action_button(). 4674 46752004-10-16 Michael Natterer <mitch@gimp.org> 4676 4677 * app/actions/vectors-commands.c (vectors_linked_cmd_callback): 4678 call gimp_item_set_linked(), not gimp_item_set_visible(). 4679 Fixes bug #155578 4680 46812004-10-16 Michael Natterer <mitch@gimp.org> 4682 4683 Ported the layers, channels and paths dialogs from 4684 gimp_editor_add_button() to gimp_editor_add_action_button(), 4685 removing a massive amount of duplicated code, sensitivity logic 4686 and confusing utility functions. 4687 4688 * app/actions/channels-actions.c 4689 * app/actions/channels-commands.[ch] 4690 * app/actions/layers-actions.c 4691 * app/actions/layers-commands.[ch] 4692 * app/actions/vectors-actions.c 4693 * app/actions/vectors-commands.[ch]: added "foo-new-default" 4694 actions and callbacks which create items without a dialog, 4695 optionally using default values from a passed template. Removed 4696 all public utility function that were passed as function pointers 4697 to widget construtors. Added tooltips to all actions which are now 4698 used for dialog buttons. 4699 4700 * app/widgets/gimpeditor.c (gimp_editor_add_action_button): 4701 automatically create multi-line tooltips showing the modifiers for 4702 extended action buttons. Removes the need for lots of insane 4703 format strings that need to be translated correctly. 4704 4705 * app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass): 4706 replaced tooltip and help_id strings by action names. 4707 4708 (struct GimpItemTreeView) 4709 (gimp_item_tree_view_new): removed "edit", "new" and "activate" 4710 function pointers. 4711 4712 (gimp_item_tree_view_constructor): create all buttons 4713 with gimp_editor_add_action_button(), using the action names 4714 from GimpItemTreeViewClass. 4715 4716 Removed tons of "clicked" callbacks and all code which sets the 4717 buttons' sensitivity. They are not needed any longer. 4718 4719 Require all subclasses to implement GimpItemTreeView::new_item(), 4720 a new virtual function which creates a plain new item without 4721 showing a dialog. 4722 4723 * app/widgets/gimpdrawabletreeview.c 4724 * app/widgets/gimpchanneltreeview.c 4725 * app/widgets/gimplayertreeview.c 4726 * app/widgets/gimpvectorstreeview.c: fill in the action names and 4727 implement GimpItemTreeView::new_item(). Removed all button 4728 sensitivity logic. 4729 4730 * app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't 4731 include anything from actions/ any more. 4732 47332004-10-15 Michael Natterer <mitch@gimp.org> 4734 4735 * tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for 4736 layer_add_mask() and layer_remove_mask(). 4737 4738 * app/pdb/layer_cmds.c 4739 * libgimp/gimplayer_pdb.c: regenerated. 4740 47412004-10-15 Michael Natterer <mitch@gimp.org> 4742 4743 * app/actions/images-commands.[ch] 4744 * app/actions/templates-commands.[ch]: made some public functions 4745 private or removed them entirely by folding their code into their 4746 callers. They used to be passed as function pointers to widgets in 4747 the pre action-based dialog buttons era. 4748 47492004-10-15 Michael Natterer <mitch@gimp.org> 4750 4751 * app/dialogs/quit-dialog.c: raise the image's displays on 4752 double-click in the dirty image list. 4753 47542004-10-15 Michael Natterer <mitch@gimp.org> 4755 4756 Fixed bug #155328: 4757 4758 * app/actions/vectors-actions.c (vectors_actions_update): don't 4759 set the "selection to path" actions sensitive if there is no 4760 image. 4761 4762 * app/widgets/gimpitemtreeview.c: update the UI manager after 4763 setting the view's image. Connect to GimpImage::flush() and 4764 update the UI manager in the callback, too. 4765 47662004-10-15 Michael Natterer <mitch@gimp.org> 4767 4768 * app/actions/view-actions.c (view_zoom_actions): removed 4769 duplicate "view-zoom-in" action (cut'n'paste error) and fixed the 4770 swapped "zoom in/out a lot" actions. Fixes bug #155446. 4771 47722004-10-15 Sven Neumann <sven@gimp.org> 4773 4774 * Made 2.1.7 release. 4775 47762004-10-15 Sven Neumann <sven@gimp.org> 4777 4778 * app/tools/gimptransformoptions.c: removed the "Density" label. 4779 It wasn't helpful and caused the transform options to be wider than 4780 necessary. 4781 4782 * app/tools/gimpblendoptions.c 4783 * app/tools/gimppaintoptions-gui.c 4784 * app/tools/gimptransformoptions.c: let combo boxes expand 4785 horizontally like we do in other (all?) dialogs. 4786 4787 * app/widgets/gimptemplateeditor.c 4788 (gimp_template_editor_aspect_callback): update the pixel size label. 4789 47902004-10-15 Sven Neumann <sven@gimp.org> 4791 4792 * data/images/gimp-splash.png: new splash by Jimmac. 4793 47942004-10-15 DindinX <dindinx@gimp.org> 4795 4796 * plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and 4797 removed many lines of codes. 4798 47992004-10-14 Kevin Cozens <kcozens@cvs.gimp.org> 4800 4801 * plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script. 4802 (Related to bug #153900 and compatability with Tiny-Fu) 4803 48042004-10-14 DindinX <dindinx@gimp.org> 4805 4806 * plug-ins/common/neon.c: fixed the handling of drawable with alpha. 4807 48082004-10-14 DindinX <dindinx@gimp.org> 4809 4810 * plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the 4811 previous preview was absolutely useless. Done some cleanups, too. 4812 4813 * plug-ins/common/spread.c: remember the preview state between 4814 invocations. 4815 48162004-10-14 DindinX <dindinx@gimp.org> 4817 4818 * plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a 4819 GimpAspectPreview, since this plug-in is somewhat edge-oriented and 4820 this makes the code simpler ;) 4821 48222004-10-14 Michael Natterer <mitch@gimp.org> 4823 4824 * themes/Default/images/stock-gradient-bilinear-16.png 4825 * themes/Default/images/stock-gradient-linear-16.png: rotate them 4826 by 90 degrees. All our gradient previews and icons go left->right, 4827 not top->bottom. 4828 48292004-10-14 Manish Singh <yosh@gimp.org> 4830 4831 * plug-ins/common/bmpread.c: Make sure we have a bpp value we can 4832 handle, and fail gracefully if not. Fixes bug #155401. 4833 48342004-10-14 Michael Natterer <mitch@gimp.org> 4835 4836 * libgimpwidgets/gimpwidgets.c 4837 * app/widgets/gimpenumwidgets.[ch] 4838 * app/widgets/gimppropwidgets.c 4839 * app/actions/layers-commands.c 4840 * app/dialogs/convert-dialog.c 4841 * app/tools/gimpblendoptions.c 4842 * app/tools/gimpbucketfilloptions.c 4843 * app/tools/gimpcolorbalancetool.c 4844 * app/tools/gimpcolorizetool.c 4845 * app/tools/gimpcoloroptions.c 4846 * app/tools/gimpcurvestool.c 4847 * app/tools/gimphuesaturationtool.c 4848 * app/tools/gimpinkoptions-gui.c 4849 * app/tools/gimplevelstool.c 4850 * app/tools/gimppaintoptions-gui.c 4851 * app/tools/gimpselectionoptions.c 4852 * app/tools/gimptransformoptions.c: the child of a GimpFrame must 4853 not have any border width. Fixes many subtle misalignments. 4854 48552004-10-14 Sven Neumann <sven@gimp.org> 4856 4857 * app/core/gimpprogress.[ch]: added "message" function to the 4858 GimpProgress interface. Call gimp_message() if it is unimplemented. 4859 4860 * app/plug-in/plug-in-progress.[ch]: added new function 4861 plug_in_progress_message() that passes the message to the current 4862 proc_frame's progress. 4863 4864 * app/widgets/gimpthumbbox.c: implement GimpProgress::message. 4865 Just do nothing in the implementation. We don't want to see 4866 messages from file plug-ins that we use to create the thumbnails. 4867 4868 * tools/pdbgen/pdb/message.pdb 4869 * app/pdb/message_cmds.c: if there's a current plug-in, dispatch 4870 the message by calling plug_in_progress_message(). 4871 4872 * app/display/gimpdisplayshell-close.c: fixed wrong types in 4873 function calls. 4874 48752004-10-14 Michael Natterer <mitch@gimp.org> 4876 4877 * app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use 4878 GIMP_HELP_COLOR_DIALOG as help_id. 4879 48802004-10-14 Michael Natterer <mitch@gimp.org> 4881 4882 * app/actions/dialogs-commands.c: purely cosmetic. 4883 48842004-10-14 Michael Natterer <mitch@gimp.org> 4885 4886 * app/core/core-enums.[ch]: register GimpConvertPaletteType with 4887 the type system. 4888 4889 * tools/pdbgen/enums.pl: regenerated. 4890 4891 * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add): 4892 fixed to insert the widget at the right place in the radio box. 4893 4894 * app/dialogs/convert-dialog.c: use enum widgets and 4895 gimp_enum_radio_frame_add(), resulting in a much better looking 4896 dialog with much less lines of code. 4897 48982004-10-14 Sven Neumann <sven@gimp.org> 4899 4900 * plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index". 4901 "Home" is misleading and leads to problems in some locales (see 4902 bug #148120). 4903 49042004-10-14 Michael Natterer <mitch@gimp.org> 4905 4906 * tools/authorsgen/contributors: correct UTF-8 spelling of 4907 João S. O. Bueno Calligaris. 4908 4909 * AUTHORS 4910 * app/dialogs/authors.h: regenerated. 4911 49122004-10-14 Kevin Cozens <kcozens@cvs.gimp.org> 4913 4914 * plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of 4915 script on original layer. (bug #155358) Fixed spelling error. 4916 49172004-10-13 Manish Singh <yosh@gimp.org> 4918 4919 * tools/pdbgen/Makefile.am: Remove stamp files during 4920 maintainer-clean. Addresses bug #155357. Also flesh out the 4921 dependencies some so rebuilds get triggered when all their 4922 dependent files change. 4923 49242004-10-14 Sven Neumann <sven@gimp.org> 4925 4926 * app/actions/file-commands.c (file_revert_cmd_callback): creata 4927 an UTF-8 filename from the image URI and display that instead of 4928 the URI. 4929 4930 * app/dialogs/convert-dialog.c (convert_dialog_new): removed the 4931 palette size warning for transparent images. The number of colors 4932 is already adjusted to 255. This text was IMO more frightening 4933 than helpful. 4934 49352004-10-13 Kevin Cozens <kcozens@cvs.gimp.org> 4936 4937 * plug-ins/script-fu/scripts/add-bevel.scm: two variables were 4938 not defined before first use (bug #153900). 4939 49402004-10-13 Kevin Cozens <kcozens@cvs.gimp.org> 4941 4942 * app/widgets/gimpactionview.c: Fixed a spelling error. 4943 49442004-10-13 DindinX <dindinx@gimp.org> 4945 4946 * plug-ins/common/colorify.c: Added a preview. 4947 49482004-10-13 Sven Neumann <sven@gimp.org> 4949 4950 * libgimpwidgets/gimppreview.c: removed trailing whitespace. 4951 4952 * libgimpwidgets/gimpwidgets.def: added 4953 gimp_preview_set_default_cursor. 4954 49552004-10-13 Sven Neumann <sven@gimp.org> 4956 4957 * app/widgets/gimpmessagedialog.c: improved handling of parent 4958 widget; probably just being paranoid here. 4959 4960 * app/actions/image-commands.c 4961 * app/dialogs/image-new-dialog.c: ported memory size confirmation 4962 dialogs to GimpMessageDialog. 4963 49642004-10-13 DindinX <dindinx@gimp.org> 4965 4966 * libgimpwidgets/gimppreview.[ch]: added a new function to set the 4967 default cursor on preview: gimp_preview_set_default_cursor(). 4968 4969 * libgimpwidgets/gimpscrolledpreview.c: changed accordlingly. 4970 4971 * plug-ins/common/flarefx.c: 4972 * plug-ins/common/nova.c: use this function. 4973 4974 This addresses bug #90519. 4975 49762004-10-13 DindinX <dindinx@gimp.org> 4977 4978 * plug-ins/common/cubism.c: Added a preview and done some cleanups. 4979 49802004-10-13 Sven Neumann <sven@gimp.org> 4981 4982 * app/actions/plug-in-commands.c 4983 * app/actions/templates-commands.c 4984 * app/actions/tool-options-commands.c: ported more boolean queries 4985 to GimpMessageDialog. 4986 49872004-10-13 Sven Neumann <sven@gimp.org> 4988 4989 * app/widgets/gimpmessagedialog.c: handle parent widget not being 4990 a GtkWindow by calling gtk_widget_get_toplevel(). 4991 4992 * app/actions/data-commands.c 4993 * app/actions/edit-commands.c 4994 * app/actions/file-commands.c: ported more boolean queries to 4995 GimpMessageDialog. 4996 49972004-10-13 Sven Neumann <sven@gimp.org> 4998 4999 * app/widgets/Makefile.am 5000 * app/widgets/widgets-types.h 5001 * app/widgets/gimpmessagedialog.[ch]: added a simple message 5002 dialog to avoid code duplication. 5003 5004 * app/widgets/gimpmessagebox.c: set the border width to 12 pixels. 5005 5006 * app/dialogs/file-save-dialog.c 5007 * app/dialogs/quit-dialog.c 5008 * app/display/gimpdisplayshell-close.c 5009 * app/widgets/gimperrordialog.c 5010 * app/widgets/gimphelp.c 5011 * app/widgets/gimpactionview.c: use the new GimpMessageDialog. 5012 50132004-10-13 Michael Natterer <mitch@gimp.org> 5014 5015 * app/actions/image-actions.c 5016 * menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides". 5017 5018 * plug-ins/script-fu/scripts/Makefile.am 5019 * plug-ins/script-fu/scripts/guides-from-selection.scm 5020 * plug-ins/script-fu/scripts/guides-new-percent.scm 5021 * plug-ins/script-fu/scripts/guides-new.scm 5022 * plug-ins/script-fu/scripts/guides-remove-all.scm: added new 5023 scripts from Alan Horkan. Fixes bug #119667. 5024 50252004-10-13 Michael Natterer <mitch@gimp.org> 5026 5027 * plug-ins/common/flarefx.c: cleaned up and simplified the 5028 FlareCenter code even more. 5029 5030 * plug-ins/common/nova.c: did the same changes for the NovaCenter 5031 stuff. 5032 5033 Also added code which sets an appropriate cursor on "realize" to 5034 fix bug #90519, but GimpPreview currently prevents this from 5035 working correctly... 5036 50372004-10-13 Sven Neumann <sven@gimp.org> 5038 5039 * app/widgets/widgets-enums.[ch]: changed the description for 5040 GIMP_HELP_BROWSER_GIMP. 5041 5042 * app/dialogs/file-save-dialog.c: 5043 * app/widgets/gimphelp.c: use a GimpDialog embedding a 5044 GimpMessageBox instead of gimp_query_boolean_box which looks 5045 somewhat old fashioned. 5046 50472004-10-13 Sven Neumann <sven@gimp.org> 5048 5049 * app/widgets/gimphelp.c: improved error messages on missing help 5050 browser plug-in. 5051 5052 * libgimpthumb/gimpthumb-utils.c 5053 * libgimpthumb/gimpthumbnail.c: improved documentation. 5054 50552004-10-13 Sven Neumann <sven@gimp.org> 5056 5057 * app/display/gimpdisplayshell-close.c 5058 (gimp_display_shell_close_dialog): changed button label. 5059 50602004-10-12 Kevin Cozens <kcozens@cvs.gimp.org> 5061 5062 * plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of 5063 script used in second register line. 5064 50652004-10-13 Sven Neumann <sven@gimp.org> 5066 5067 * app/display/gimpdisplayshell-close.c: changed rounding. 5068 50692004-10-13 Michael Natterer <mitch@gimp.org> 5070 5071 * app/dialogs/image-new-dialog.c (image_new_response): don't 5072 forget to reset the template combo on RESPONSE_RESET. 5073 50742004-10-13 Michael Natterer <mitch@gimp.org> 5075 5076 * app/display/gimpdisplay-foreach.c: keep the container of dirty 5077 images up to date. 5078 5079 * app/dialogs/quit-dialog.c: fixed model/view behavior here, too. 5080 5081 (both are still far from perfect) 5082 50832004-10-13 Sven Neumann <sven@gimp.org> 5084 5085 * app/display/gimpdisplayshell-close.c 5086 (gimp_display_shell_close_dialog): keep the time uptodate. 5087 50882004-10-13 Sven Neumann <sven@gimp.org> 5089 5090 * app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref 5091 the imagefile while creating the thumbnail. 5092 5093 * app/core/gimpimagefile.[ch] 5094 * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved 5095 the tricky part about thumbnail creation into the new function 5096 gimp_imagefile_create_thumbnail_weak(). 5097 50982004-10-13 Michael Natterer <mitch@gimp.org> 5099 5100 * plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from 5101 gimp_plugin_menu_register(). 5102 51032004-10-13 Michael Natterer <mitch@gimp.org> 5104 5105 * app/dialogs/preferences-dialog.c (prefs_dialog_new): added 5106 missing and resolved conflicting mnemonics. 5107 51082004-10-12 Sven Neumann <sven@gimp.org> 5109 5110 * plug-ins/script-fu/scripts/selection-round.scm: moved out of the 5111 "Modify" placeholder. Using placeholders from Script-Fu breaks 5112 i18n. We will need to change menu registration for scripts but 5113 this will have to wait.. 5114 51152004-10-12 Michael Natterer <mitch@gimp.org> 5116 5117 * plug-ins/*/*.c: all plug-ins except script-fu: removed the 5118 translation marks from the menu paths passed to 5119 gimp_plugin_menu_register(). All default menu branches used by 5120 included plug-ins are created and translated by the core now. 5121 51222004-10-12 Sven Neumann <sven@gimp.org> 5123 5124 * app/core/gimpimage.[ch]: renamed struct member "unit" to 5125 "resolution_unit". 5126 5127 * app/actions/image-commands.c 5128 * app/core/gimp-edit.c 5129 * app/core/gimpimage-duplicate.c 5130 * app/core/gimpimage-undo-push.c 5131 * app/dialogs/info-window.c 5132 * app/vectors/gimpvectors-export.c 5133 * app/widgets/gimptoolbox-dnd.c: 5134 * app/xcf/xcf-load.c 5135 * app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit() 5136 where appropriate. 5137 5138 * app/core/gimptemplate.c (gimp_template_set_from_image): fixed 5139 unit handling. Don't touch the template unit, it is used as the 5140 initial display unit. This will need further changes... 5141 51422004-10-12 Michael Natterer <mitch@gimp.org> 5143 5144 * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add): 5145 need to pack the widget expanding. Fixes pattern container 5146 entries. 5147 51482004-10-12 Sven Neumann <sven@gimp.org> 5149 5150 * app/dialogs/info-window.[ch]: fixed unit handling. Right-align 5151 the labels displaying the cursor position. Renamed the "Extended" 5152 tab to "Cursor". Renamed the API accordingly. 5153 5154 * app/display/gimpdisplayshell-cursor.c: changed accordingly. 5155 51562004-10-12 Michael Natterer <mitch@gimp.org> 5157 5158 * app/actions/drawable-commands.c (drawable_rotate_cmd_callback): 5159 if the drawable is a channel, pass clip_result as FALSE. Need to 5160 do this here for rotating only because it can't be decided 5161 generically in GimpChannel. Fixes crash when rotating channels 5162 or layer masks. 5163 5164 Use the undo_desc from GimpItemClass instead of passing "Flip 5165 Layer" and "Rotate Layer". 5166 51672004-10-12 Sven Neumann <sven@gimp.org> 5168 5169 * app/file/file-open.c: minor cleanup. 5170 5171 * app/file/file-save.c (file_save_as): no need to fiddle with the 5172 image name, the URI is taken from the imagefile anyway. 5173 51742004-10-12 Sven Neumann <sven@gimp.org> 5175 5176 * app/actions/layers-actions.c (layers_actions_update): set 5177 "layers-crop" insensitive if the selection is empty. 5178 5179 * plug-ins/script-fu/scripts/alien-glow-button.scm 5180 * plug-ins/script-fu/scripts/alien-glow-logo.scm 5181 * plug-ins/script-fu/scripts/basic2-logo.scm 5182 * plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans 5183 Bold" instead of "Futura_Poster". The underscore in the font name 5184 used to confuse intltool (bug #137029) and the freefont package 5185 isn't that widely used any longer anyway. 5186 51872004-10-12 Sven Neumann <sven@gimp.org> 5188 5189 * app/widgets/Makefile.am 5190 * app/widgets/widgets-types.h 5191 * app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox. 5192 5193 * app/widgets/gimppropwidgets.c: the order of setting the X and Y 5194 properties does matter. 5195 5196 * app/dialogs/Makefile.am 5197 * app/dialogs/scale-dialog.[ch]: added first version of a new 5198 Scale dialog in an attempt to address bug #151022. 5199 5200 * app/actions/layers-commands.c: use the new scale dialog. 5201 52022004-10-12 Sven Neumann <sven@gimp.org> 5203 5204 * app/widgets/gimptemplateeditor.c: added mnemonics for the size 5205 entries. 5206 52072004-10-12 Michael Natterer <mitch@gimp.org> 5208 5209 * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned): 5210 instead of simply using the passed widget as mnemonic_widget for 5211 the GtkLabel, call the new utility function find_mnemonic_widget() 5212 which recursively searches the passed widget until it finds one 5213 that actually can be mnemonic-activated. Fixes lots of mnemonics 5214 where the attached widget is e.g. a GtkEventBox or GtkComboBox. 5215 52162004-10-12 Michael Natterer <mitch@gimp.org> 5217 5218 * app/tools/gimptooloptions-gui.[ch]: removed the recently added 5219 utility functions again. 5220 5221 * app/widgets/Makefile.am 5222 * app/widgets/gimpviewablebox.[ch] 5223 * app/widgets/gimpwidgets-utils.[ch]: and added cleaned up 5224 versions here. 5225 5226 * app/tools/gimpbucketfilloptions.c 5227 * app/tools/gimpclonetool.c 5228 * app/tools/gimppaintoptions-gui.c 5229 * app/tools/gimptextoptions.c: changed accordingly. 5230 5231 * app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead 5232 of reinventing the wheel. 5233 52342004-10-12 Sven Neumann <sven@gimp.org> 5235 5236 * app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger 5237 icon size for GimpImagefile views. 5238 5239 * themes/Default/images/stock-frame-64.png: removed the 1 pixel 5240 wide empty border around the frame. 5241 5242 * app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values. 5243 52442004-10-12 Sven Neumann <sven@gimp.org> 5245 5246 * Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the 5247 configure options that are needed to run 'make dist'. 5248 52492004-10-12 Sven Neumann <sven@gimp.org> 5250 5251 * app/widgets/gimptemplateeditor.c: tweaked table spacings to get 5252 the Height label aligned with the entry again. 5253 52542004-10-12 Sven Neumann <sven@gimp.org> 5255 5256 * app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set 5257 the "skip_taskbar_hint" and "skip_pager_hint" properties on the 5258 progress window. 5259 52602004-10-11 Manish Singh <yosh@gimp.org> 5261 5262 * plug-ins/fp/fp.c: Moved from here... 5263 5264 * plug-ins/common/fp.c: ... to here. 5265 5266 * plug-ins/common/plugin-defs.pl: changed accordingly. 5267 5268 * plug-ins/common/.cvsignore 5269 * plug-ins/common/Makefile.am: regenerated. 5270 5271 * configure.in 5272 * plug-ins/Makefile.am 5273 * plug-ins/fp: Removed directory. 5274 52752004-10-11 DindinX <dindinx@gimp.org> 5276 5277 * plug-ins/common/jigsaw.c: ported to GimpAspectPreview. 5278 52792004-10-11 Michael Natterer <mitch@gimp.org> 5280 5281 * plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying 5282 the flare center. Fixed flare center dragging. Lots of cleanup. 5283 52842004-10-11 Michael Natterer <mitch@gimp.org> 5285 5286 * app/dialogs/dialogs-types.h: removed ColorDialog typedef. 5287 52882004-10-11 Michael Natterer <mitch@gimp.org> 5289 5290 * app/tools/gimptooloptions-gui.[ch]: added utility functions 5291 which create a GimpViewableButton+GimpContainerEntry combo for 5292 brushes, patterns, gradients and fonts and a very ugly utility 5293 function which packs one of these combos into a GtkFrame returned 5294 by gimp_prop_enum_radio_frame_new(). This stuff does not really 5295 belong here but is too ugly to be moved to a more general place. 5296 5297 * app/tools/gimpbucketfilloptions.c 5298 * app/tools/gimppaintoptions-gui.c 5299 * app/tools/gimptextoptions.c: use the new utility functions. Moved 5300 the pattern previews into the radio frame where using the pattern 5301 is selected. Make them insensitive if using the pattern is not 5302 selected. 5303 53042004-10-11 Sven Neumann <sven@gimp.org> 5305 5306 * app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs. 5307 5308 * app/dialogs/preferences-dialog.c: group the thumbnail related 5309 controls together. Could probably still be improved... 5310 53112004-10-11 Sven Neumann <sven@gimp.org> 5312 5313 * app/actions/documents-commands.c 5314 (documents_recreate_preview_cmd_callback): when recreating the 5315 thumbnail, delete old thumbnails and create it in the configured 5316 thumbnail size instead of the container view preview size. 5317 5318 * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb): 5319 reset the image info when the thumbnail state changes. 5320 53212004-10-11 Sven Neumann <sven@gimp.org> 5322 5323 * app/widgets/gimpfiledialog.c: construct a case-insensitive glob 5324 pattern to use when filtering for file extensions. 5325 53262004-10-11 Michael Natterer <mitch@gimp.org> 5327 5328 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails): 5329 user-visible counting starts at 1, not 0. 5330 53312004-10-11 Michael Natterer <mitch@gimp.org> 5332 5333 * tools/authorsgen/contributors: added missing contributors. 5334 Thanks to Kevin Cozens for going through ChangeLog and making a list. 5335 5336 * AUTHORS 5337 * app/dialogs/authors.h: regenerated. 5338 53392004-10-11 Sven Neumann <sven@gimp.org> 5340 5341 * libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug 5342 output again. 5343 53442004-10-11 Sven Neumann <sven@gimp.org> 5345 5346 * app/batch.c: clarified. 5347 53482004-10-08 Kevin Cozens <kcozens@cvs.gimp.org> 5349 5350 * configure.in: removed duplicate GETTEXT_PACKAGE line. 5351 53522004-10-11 Sven Neumann <sven@gimp.org> 5353 5354 * libgimpthumb/gimpthumb-utils.[ch] 5355 * libgimpthumb/gimpthumb.def: added an API to delete thumbnails. 5356 5357 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail): 5358 when recreating a thumbnail on user request, delete all existing 5359 thumbnails for it. 5360 5361 * plug-ins/common/AlienMap2.c: removed unused variable. 5362 53632004-10-10 Sven Neumann <sven@gimp.org> 5364 5365 * libgimpthumb/gimpthumb-utils.[ch] 5366 * libgimpthumb/gimpthumb.def 5367 * libgimpthumb/gimpthumbnail.c: added support for local thumbnails 5368 as introduced by version 0.7 of the thumbnail spec. Untested, but 5369 at least the API is there. 5370 53712004-10-10 DindinX <dindinx@gimp.org> 5372 5373 * plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some 5374 minor cleanups. 5375 53762004-10-10 DindinX <dindinx@gimp.org> 5377 5378 * plug-ins/common/vpropagate.c: added a preview. 5379 53802004-10-10 DindinX <dindinx@gimp.org> 5381 5382 * plug-ins/common/flarefx.c 5383 * plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview. 5384 53852004-10-10 Sven Neumann <sven@gimp.org> 5386 5387 * app/widgets/gimpcontainerview.c (gimp_container_view_lookup): 5388 handle NULL as viewable parameter as a workaround for bug #149906. 5389 5390 * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made 5391 the code more robust. 5392 5393 * app/xcf/xcf-private.h 5394 * app/xcf/xcf.c: added a const qualifier. 5395 53962004-10-09 DindinX <dindinx@gimp.org> 5397 5398 * app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard. 5399 54002004-10-09 Sven Neumann <sven@gimp.org> 5401 5402 * AUTHORS 5403 * app/dialogs/authors.h: regenerated. Someone should look into 5404 updating the list of contributors for the 2.2 release ... 5405 54062004-10-08 Kevin Cozens <kcozens@cvs.gimp.org> 5407 5408 * tools/authorsgen/contributors: Added my name to the 5409 list of contributors. 5410 54112004-10-08 Sven Neumann <sven@gimp.org> 5412 5413 * app/widgets/gimpthumbbox.c: tweaked the text shown while 5414 updating the preview so that the dialog doesn't need to resize. 5415 54162004-10-08 Sven Neumann <sven@gimp.org> 5417 5418 * app/config/gimpcoreconfig.[ch] 5419 * app/config/gimprc-blurbs.h: added new gimprc option 5420 "thumbnail-filesize-limit" that allows to control the maximum 5421 filesize for automatic thumbnail creation. 5422 5423 * app/dialogs/preferences-dialog.c: added a GUI for it, needs 5424 review. 5425 5426 * app/core/gimpimagefile.[ch]: minor cleanups. Moved call to 5427 gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to 5428 gimp_imagefile_save_thumbnail() to avoid it being called twice. 5429 5430 * app/file/file-utils.[ch]: export utility function 5431 file_utils_find_proc_by_extension() that allows to check for a 5432 file plug-in by looking at the filename extension only. 5433 5434 * app/widgets/gimpthumbbox.[ch]: automatically create or update 5435 thumbnails for image files with a known extension that are smaller 5436 than "thumbnail-filesize-limit". Fixes bug #137176. 5437 54382004-10-08 Sven Neumann <sven@gimp.org> 5439 5440 * plug-ins/common/ripple.c: handle the tile parameter identically 5441 for preview and final result. Set Edges options insensitive when 5442 "Retain tileability" is checked. Reported by Olivier. 5443 54442004-10-08 Sven Neumann <sven@gimp.org> 5445 5446 * plug-ins/common/apply_lens.c (lens_dialog): invalidate the 5447 preview when the toggle buttons are used. Reported by Olivier. 5448 5449 * app/widgets/gimpview.c: minor cleanup. 5450 54512004-10-08 Michael Natterer <mitch@gimp.org> 5452 5453 * app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and 5454 cancel the tool on GDK_Escape. Come cleanup. 5455 54562004-10-08 Michael Natterer <mitch@gimp.org> 5457 5458 Made the text options about two toolbox grid columns smaller. 5459 Addresses bug #122862. 5460 5461 * app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use 5462 the number of digits of the property's max_val plus two as number 5463 of chars for the sizeentry'y spinbutton (instead of always 10 as 5464 before). 5465 5466 * app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry 5467 has a minimal width of 150 pixels (eek). Set a silly small minimal 5468 width instead (the entry expands to the available width anyway). 5469 54702004-10-08 Sven Neumann <sven@gimp.org> 5471 5472 * app/file/file-utils.c: added lots of const qualifiers. 5473 54742004-10-08 Michael Natterer <mitch@gimp.org> 5475 5476 * app/tools/gimppaintoptions-gui.c: the gradient button in blend 5477 options got lost, added it back. Also moved creation of the brush, 5478 pattern and gradient buttons to utility functions and cleaned up 5479 the whole file a bit. 5480 54812004-10-08 Michael Natterer <mitch@gimp.org> 5482 5483 * app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled) 5484 (gimp_display_shell_flush) 5485 * app/gui/gui-vtable.c (gui_display_create): always pass a 5486 GimpDisplay, not a GimpDisplayShell as "data" to 5487 gimp_ui_manager_update(). 5488 5489 * app/actions/actions.c (action_data_get_*): removed checks if the 5490 passed data is a GimpDisplayShell and temporarily added g_assert() 5491 to be sure. The assertions will be removed before 2.2. 5492 54932004-10-07 Sven Neumann <sven@gimp.org> 5494 5495 * libgimpthumb/gimpthumbnail.c: added some (disabled) debug output. 5496 5497 * app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve 5498 the size of the frame borders. 5499 5500 * app/widgets/gimpthumbbox.c: don't set an arbitrary padding but 5501 exactly the size of the frame borders. Otherwise we get large 5502 thumbnails (scaled down) if we request normal sized ones. 5503 55042004-10-07 Kevin Cozens <kcozens@cvs.gimp.org> 5505 5506 * plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated 5507 constant ADD to CHANNEL-OP-ADD. 5508 55092004-10-07 Michael Natterer <mitch@gimp.org> 5510 5511 Merged the gz and bz2 plug-ins into one generic compression 5512 handler that can be extended by adding entries to a table of 5513 compressor definitions: 5514 5515 * configure.in: removed bz2 special casing for win32. 5516 5517 * plug-ins/common/bz2.c 5518 * plug-ins/common/gz.c: removed. 5519 5520 * plug-ins/common/compressor.c: new plug-in. 5521 5522 * plug-ins/common/plugin-defs.pl: changed accordingly. 5523 5524 * plug-ins/common/.cvsignore 5525 * plug-ins/common/Makefile.am: regenerated. 5526 55272004-10-07 Simon Budig <simon@gimp.org> 5528 5529 * app/actions/view-commands.c: fill in the formula... :-) 5530 untabbified. 5531 5532 * app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified. 5533 55342004-10-07 Michael Natterer <mitch@gimp.org> 5535 5536 * app/actions/view-actions.c: changed zoom actions to be 5537 GimpEnumActions using the GimpActionSelectType enum. Enables 5538 keyboard shortcuts for useless stuff like "zoom out a lot", and 5539 makes them better accessible for external controllers. 5540 5541 * app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback() 5542 to view_zoom_explicit_cmd_callback(), removed the zoom_in and 5543 zoom_out callbacks and added a new view_zoom_cmd_callback() for 5544 the new GimpActionSelectType-based actions. The implementation of 5545 the new zoom types is questionable but now there is a place where 5546 nomis can fill in nice formulas... 5547 55482004-10-06 Michael Natterer <mitch@gimp.org> 5549 5550 * app/tools/gimpeditselectiontool.[ch]: added new parameter 5551 "gboolean propagate_release" to gimp_edit_slection_tool_start() 5552 and remember it in the GimpEditSelectionTool struct. If requested, 5553 propagate GimpTool::button_release() to the tool below in the tool 5554 stack. 5555 5556 * app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit): 5557 pass FALSE so we don't get the button_release(). 5558 5559 * app/tools/gimpmovetool.[ch]: pass TRUE so we get 5560 button_release(). If moving a layer or path in "pick active" mode, 5561 remember the old active layer/path and switch back to it in 5562 button_release(). Fixes bug #97734. 5563 5564 Unrelated: 5565 5566 * app/tools/gimpeditselectiontool.c 5567 (gimp_edit_selection_tool_motion): set "first_move" to FALSE only 5568 if a move actually happened. Fixes un-undoable moves at high zoom 5569 factors. 5570 55712004-10-06 Michael Natterer <mitch@gimp.org> 5572 5573 * app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for 5574 which GdkDragContext the icon_widget was made. 5575 5576 (gimp_dnd_data_drag_end): destroy the icon_widget only if it was 5577 created for this GdkDragContext. Fixes broken DND icon_widgets 5578 when dragging the same source again while the old icon_widget is 5579 still floating back from an unsuccessful drop. Fixes bug #139337. 5580 55812004-10-05 Manish Singh <yosh@gimp.org> 5582 5583 * tools/pdbgen/lib.pl: Slight cleanup of doc generating code. 5584 55852004-10-06 Michael Natterer <mitch@gimp.org> 5586 5587 * tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc 5588 comment that contains a link to the replacement procedure and 5589 doesn't contain redundant information. 5590 5591 * tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement 5592 procedures. 5593 5594 * libgimp/gimpbrushes.c 5595 * libgimp/gimpgradients.c 5596 * libgimp/gimppalettes.c 5597 * libgimp/gimppatterns.c: made the handwritten gtk-doc comments of 5598 deprecated procedures look like the generated ones. 5599 5600 * app/pdb/text_tool_cmds.c 5601 * libgimp/gimpbrushes_pdb.c 5602 * libgimp/gimpgradients_pdb.c 5603 * libgimp/gimppalettes_pdb.c 5604 * libgimp/gimppatterns_pdb.c 5605 * libgimp/gimptexttool_pdb.c: regenerated. 5606 56072004-10-06 Michael Natterer <mitch@gimp.org> 5608 5609 * app/tools/gimp-tools.c (gimp_tools_restore): reset the tool 5610 options before deserializing so they have the correct default 5611 values. Fixes bug #120832. 5612 5613 * app/tools/gimpbucketfilloptions.c 5614 * app/tools/gimpmagnifyoptions.c 5615 * app/tools/gimpselectionoptions.c 5616 * app/tools/gimptransformoptions.c: removed all set_defaults() 5617 utility functions and moved their code to reset(). The change 5618 above calls them automatically so there is no need to call them 5619 from the GUI constructors any more. 5620 56212004-10-06 Michael Natterer <mitch@gimp.org> 5622 5623 * plug-ins/script-fu/scripts/selection-round.scm: use a 5624 scale_entry instead of a spinbutton, changed mnemonic from "R" to 5625 "E", indentation. 5626 5627 * plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/ 5628 in a comment. 5629 56302004-10-06 Sven Neumann <sven@gimp.org> 5631 5632 * plug-ins/script-fu/scripts/selection-round.scm: applied patch by 5633 Alan Horkan that improves usability and usefulness of this script. 5634 Did some code cleanup and added the old procedure for backward 5635 compatibility. Fixes bug #145147. 5636 5637 * menus/image-menu.xml.in: renamed placeholder in Image->Select 5638 from "Outline" to "Modify". 5639 56402004-10-06 Sven Neumann <sven@gimp.org> 5641 5642 * plug-ins/common/postscript.c (ps_open): tweaked error message. 5643 56442004-10-06 Michael Natterer <mitch@gimp.org> 5645 5646 * app/pdb/procedural_db.h (struct ProcRecord): changed new member 5647 "deprecated" from "gboolean" to a "gchar*" which holds the name of 5648 the replacement procedure. 5649 5650 * tools/pdbgen/app.pl: changed accordingly. 5651 5652 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show 5653 the name of the replacement procedure in the warning message. 5654 5655 * tools/pdbgen/stddefs.pdb: added utility function 5656 std_pdb_deprecated() which takes the name of the replacement 5657 procedure and fills the blurb, help, author, copyright, date and 5658 deprecated fields of the procedure definition. 5659 5660 * tools/pdbgen/pdb/brushes.pdb 5661 * tools/pdbgen/pdb/gradients.pdb 5662 * tools/pdbgen/pdb/image.pdb 5663 * tools/pdbgen/pdb/palettes.pdb 5664 * tools/pdbgen/pdb/patterns.pdb 5665 * tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating 5666 the same code and strings for all deprecated procedures. 5667 5668 * app/pdb/*_cmds.c 5669 * libgimp/gimppatterns_pdb.c 5670 * libgimp/gimptexttool_pdb.c: regenerated. 5671 56722004-10-06 Michael Natterer <mitch@gimp.org> 5673 5674 Fixed the scale constraints radio buttons: 5675 5676 * app/tools/gimptransformoptions.c (gimp_transform_options_gui): 5677 initialize the radio group with the correct value instead of 5678 resetting the model before creating the group. 5679 5680 (gimp_scale_options_constrain_callback): change the model 5681 only if the radio button became active. 5682 5683 (gimp_scale_options_constrain_notify): new callback which makes 5684 the radio buttons a real view on the model again (fixes GUI 5685 updates on modifier press/release). 5686 56872004-10-06 Sven Neumann <sven@gimp.org> 5688 5689 * app/actions/plug-in-actions.c (plug_in_actions_update): an image 5690 doesn't necessarily have a drawable. Handle the case when it doesn't. 5691 56922004-10-06 Sven Neumann <sven@gimp.org> 5693 5694 * app/app_procs.[ch] 5695 * app/batch.[ch] 5696 * app/main.c: added new command-line option "--batch-interpreter" 5697 that allows to specify the procedure to use to process batch 5698 commands. Removed the perl-server hack but kept Script-Fu as the 5699 default for backward compatibility. 5700 5701 * docs/gimp.1.in: documented the new option. 5702 57032004-10-06 Michael Natterer <mitch@gimp.org> 5704 5705 * app/actions/file-commands.c (file_revert_confirm_callback): 5706 removed the code which sets the new image on all contexts where 5707 the old image was set... 5708 5709 * app/display/gimpdisplay-foreach.c (gimp_displays_reconnect): 5710 ...and added it here so it happens for all calls of this function, 5711 also from the PDB. Fixes bug #154638. 5712 57132004-10-06 Sven Neumann <sven@gimp.org> 5714 5715 * libgimp/gimp.def: updated. 5716 57172004-10-06 Michael Natterer <mitch@gimp.org> 5718 5719 * tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the 5720 brush's pixmap data if it has one. 5721 5722 * tools/pdbgen/pdb/pattern.pdb: cleaned up. 5723 5724 * tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated 5725 functions even if they are not exported to libgimp any more. 5726 5727 * app/pdb/procedural_db.h (struct ProcRecord): added member 5728 "gboolean deprecated". 5729 5730 * tools/pdbgen/app.pl 5731 * app/xcf/xcf.c: fill it accordingly. 5732 5733 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn 5734 not only for deprecated procedured which are in the compat hach 5735 table, but also for procedures with deprecated flag set to TRUE. 5736 5737 * app/pdb/*_cmds.c 5738 * libgimp/gimpbrush_pdb.[ch] 5739 * libgimp/gimppattern_pdb.[ch]: regenerated. 5740 5741 * libgimp/gimpbrushmenu.c 5742 * plug-ins/gfig/gfig-style.c: changed accordingly. 5743 57442004-10-05 Manish Singh <yosh@gimp.org> 5745 5746 * tools/pdbgen/lib.pl: Fix array return value generation when there 5747 are more args after it. 5748 57492004-10-06 Sven Neumann <sven@gimp.org> 5750 5751 * configure.in: bumped version number to 2.1.7. 5752 57532004-10-06 Sven Neumann <sven@gimp.org> 5754 5755 * tools/pdbgen/lib.pl: put subsequent deprecated prototypes into 5756 a single #ifndef ... #endif pair. 5757 5758 * libgimp/gimpbrushes_pdb.h 5759 * libgimp/gimpgradients_pdb.h 5760 * libgimp/gimppalettes_pdb.h 5761 * libgimp/gimppatterns_pdb.h 5762 * libgimp/gimptexttool_pdb.h: regenerated. 5763 57642004-10-06 Sven Neumann <sven@gimp.org> 5765 5766 * app/core/gimpimage.[ch]: store the time when the image is first 5767 dirtied. 5768 5769 * app/display/gimpdisplayshell-close.c: tell the user what time 5770 period of changes will be lost when the image is not saved. 5771 57722004-10-06 Michael Natterer <mitch@gimp.org> 5773 5774 * tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data) 5775 * tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform) 5776 (gradients_sample_custom) (gradients_get_gradient_data) 5777 * tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data): 5778 deprecated. 5779 5780 * tools/pdbgen/pdb/brush.pdb 5781 * tools/pdbgen/pdb/gradient.pdb 5782 * tools/pdbgen/pdb/palette.pdb 5783 * tools/pdbgen/pdb/pattern.pdb: added replacements for the 5784 deprecated functions. Removed the silly feature that passing NULL 5785 as name operates on the current brush, pattern etc. 5786 5787 * app/pdb/brush_cmds.c 5788 * app/pdb/brushes_cmds.c 5789 * app/pdb/gradient_cmds.c 5790 * app/pdb/gradients_cmds.c 5791 * app/pdb/internal_procs.c 5792 * app/pdb/palette_cmds.c 5793 * app/pdb/pattern_cmds.c 5794 * app/pdb/patterns_cmds.c 5795 * libgimp/gimpbrush_pdb.[ch] 5796 * libgimp/gimpbrushes_pdb.[ch] 5797 * libgimp/gimpgradient_pdb.[ch] 5798 * libgimp/gimpgradients_pdb.[ch] 5799 * libgimp/gimppalette_pdb.c 5800 * libgimp/gimppattern_pdb.[ch] 5801 * libgimp/gimppatterns_pdb.[ch]: regenerated. 5802 5803 * libgimp/gimpbrushmenu.c 5804 * libgimp/gimpgradientmenu.c 5805 * libgimp/gimppatternmenu.c 5806 * plug-ins/FractalExplorer/Dialogs.c 5807 * plug-ins/common/gradmap.c 5808 * plug-ins/common/sample_colorize.c 5809 * plug-ins/flame/flame.c 5810 * plug-ins/gfig/gfig-style.c 5811 * plug-ins/gflare/gflare.c 5812 * plug-ins/pagecurl/pagecurl.c 5813 * plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly. 5814 58152004-10-06 Sven Neumann <sven@gimp.org> 5816 5817 * plug-ins/common/spheredesigner.c: improved the dialog a bit, 5818 needs more work. 5819 58202004-10-05 Sven Neumann <sven@gimp.org> 5821 5822 * plug-ins/script-fu/scripts/addborder.scm: simple change to make 5823 the script work on all image types, not only RGB. 5824 58252004-10-05 Sven Neumann <sven@gimp.org> 5826 5827 * Made 2.1.6 release. 5828 58292004-10-05 Sven Neumann <sven@gimp.org> 5830 5831 * plug-ins/helpbrowser/dialog.c: added a close button. Launch the 5832 browser with the HTML focused. 5833 58342004-10-05 Sven Neumann <sven@gimp.org> 5835 5836 * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned): 5837 left-justify the label. 5838 5839 * libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP 5840 is being added, hide the automatically added help button. 5841 5842 * plug-ins/script-fu/script-fu-interface.c: five buttons are too 5843 much for the action area. Renamed the About button to Help and 5844 resurrected the help button in the about dialog as a way to get to 5845 the actual help pages (pressing F1 will get you there as well). 5846 58472004-10-05 Sven Neumann <sven@gimp.org> 5848 5849 * app/widgets/gimpfiledialog.c: added a help button. 5850 58512004-10-05 Michael Natterer <mitch@gimp.org> 5852 5853 * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): 5854 - check the number of elements of array parameters against 5855 the actually passed array and spit a proper error message 5856 instead of trashing the wire. Fixes bug #154266. 5857 - g_strdup()/g_free() the proc_name so it doesn't get mungled 5858 by convert_string(). 5859 - added missing implementation of INT16ARRAY return values. 5860 - cleaned up STRINGARRAY value implementations to work like 5861 all other array values. 5862 58632004-10-04 Sven Neumann <sven@gimp.org> 5864 5865 * plug-ins/script-fu/script-fu-interface.c (script_fu_reset): 5866 fixed reset for SF_TEXT values. 5867 58682004-10-04 Sven Neumann <sven@gimp.org> 5869 5870 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): 5871 oops, didn't meant to remove that line. 5872 58732004-10-04 Sven Neumann <sven@gimp.org> 5874 5875 * plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h. 5876 58772004-10-04 Sven Neumann <sven@gimp.org> 5878 5879 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area): 5880 take drawable offsets into account when masking the preview with 5881 the selection mask. 5882 58832004-10-04 Michael Natterer <mitch@gimp.org> 5884 5885 * tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow 5886 the empty string as token. Spotted by Kevin Cozens. 5887 5888 * app/pdb/gimprc_cmds.c: regenerated. 5889 58902004-10-04 Sven Neumann <sven@gimp.org> 5891 5892 * libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer): 5893 no need to set bpp before calling gimp_drawable_get_thumbnail_data(). 5894 58952004-10-04 DindinX <dindinx@gimp.org> 5896 5897 * libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer): 5898 only apply the effect inside the current selection. This, together 5899 with my previous commit fixes bug #132194. 5900 59012004-10-04 DindinX <dindinx@gimp.org> 5902 5903 * plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This 5904 addresses but not totally fixes bug #132194. 5905 59062004-10-04 Sven Neumann <sven@gimp.org> 5907 5908 * app/config/gimpguiconfig.[ch] 5909 * app/config/gimprc-blurbs.h: added gimprc option "show-help-button". 5910 5911 * app/dialogs/preferences-dialog.c: added a GUI for it. 5912 5913 * app/dialogs/file-save-dialog.c 5914 * app/dialogs/image-new-dialog.c 5915 * app/dialogs/quit-dialog.c 5916 * app/display/gimpdisplayshell-close.c 5917 * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation 5918 dialogs. 5919 5920 * libgimpbase/gimpprotocol.[ch] 5921 * libgimp/gimp.[ch]: added boolean "show_help_button" to the 5922 config message. 5923 5924 * app/plug-in/plug-in-run.c: pass the new preference to the plug-in. 5925 5926 * libgimpwidgets/gimpdialog.[ch]: added new function that allows to 5927 set whether new dialogs should get a help button added. 5928 5929 * app/gui/gui.c 5930 * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according 5931 to the gimprc settings. 5932 59332004-10-04 Sven Neumann <sven@gimp.org> 5934 5935 * plug-ins/script-fu/script-fu-interface.c (script_fu_about): set 5936 the help_func again (but not the help_id). 5937 59382004-10-04 Sven Neumann <sven@gimp.org> 5939 5940 * plug-ins/script-fu/script-fu-interface.c (script_fu_about): 5941 enabled line wrapping on labels. 5942 (script_fu_interface): substitute underscores by hyphens to 5943 generate the help-id from the procedure name. 5944 59452004-10-04 Michael Natterer <mitch@gimp.org> 5946 5947 * libgimpbase/gimpwire.c: added assertions to make sure "count" is 5948 always >= 0. Turns the crash described in bug #154266 into a 5949 warning plus corrupted wire state :) Real fix (in script-fu) will 5950 follow. Untabified. 5951 59522004-10-04 Michael Natterer <mitch@gimp.org> 5953 5954 * libgimpwidgets/gimphelpui.c: untabified. 5955 5956 (gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id". 5957 59582004-10-04 Sven Neumann <sven@gimp.org> 5959 5960 * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): 5961 set a minimum width for the color button again. 5962 (script_fu_about): don't set help_func and help_id on the about 5963 dialog. 5964 59652004-10-04 Michael Natterer <mitch@gimp.org> 5966 5967 * tools/pdbgen/pdb/brush.pdb 5968 * tools/pdbgen/pdb/gradient.pdb 5969 * tools/pdbgen/pdb/palette.pdb: disallow the empty string for 5970 new brushes, gradients and palettes and check the return value 5971 of gimp_data_factory_data_new(). Cleanup. 5972 5973 * app/core/gimpbrushgenerated.c (gimp_brush_generated_new) 5974 * app/core/gimpgradient.c (gimp_gradient_new) 5975 * app/core/gimpdatafactory.c (gimp_data_factory_data_new): same 5976 here. Fixes bug #154264. 5977 5978 * app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean 5979 "deletable" parameter because it's not derivable from "writable". 5980 5981 * app/core/gimpdatafactory.c (gimp_data_factory_load_data): need 5982 to figure "deletable" separately from "writable" to be able to 5983 delete unsavable stuff in the user-writable data directories. 5984 Fixes bug #154410. 5985 5986 (gimp_data_factory_data_save_single): cleaned up. 5987 5988 * app/pdb/brush_cmds.c 5989 * app/pdb/gradient_cmds.c 5990 * app/pdb/palette_cmds.c 5991 * libgimp/gimpbrush_pdb.c 5992 * libgimp/gimpgradient_pdb.c 5993 * libgimp/gimppalette_pdb.c: regenerated. 5994 59952004-10-04 Sven Neumann <sven@gimp.org> 5996 5997 * plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of 5998 the script contributed by Kevin Cozens (see bug #153900). 5999 6000 * plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin 6001 Cozens that fixes use of the script on original layer (bug #152678). 6002 60032004-10-04 Sven Neumann <sven@gimp.org> 6004 6005 * plug-ins/script-fu/scripts/3d-outline.scm 6006 * plug-ins/script-fu/scripts/blended-logo.scm 6007 * plug-ins/script-fu/scripts/camo.scm 6008 * plug-ins/script-fu/scripts/clothify.scm 6009 * plug-ins/script-fu/scripts/flatland.scm 6010 * plug-ins/script-fu/scripts/glossy.scm 6011 * plug-ins/script-fu/scripts/land.scm 6012 * plug-ins/script-fu/scripts/predator.scm 6013 * plug-ins/script-fu/scripts/rendermap.scm 6014 * plug-ins/script-fu/scripts/ripply-anim.scm 6015 * plug-ins/script-fu/scripts/speed-text.scm 6016 * plug-ins/script-fu/scripts/spinning-globe.scm: applied patches 6017 from Kevin Cozens that define variables before first use (bug 6018 #153900). 6019 60202004-10-04 Sven Neumann <sven@gimp.org> 6021 6022 * libgimp/gimpgradientmenu.c: handle allocation > requisition for 6023 the gradient preview. 6024 6025 * plug-ins/script-fu/script-fu-interface.c: added a horizontal 6026 size group for the left-aligned controls. 6027 60282004-10-03 DindinX <dindinx@gimp.org> 6029 6030 * plug-ins/common/destripe.c: ported to GimpDrawablePreview. 6031 60322004-10-03 DindinX <dindinx@gimp.org> 6033 6034 * plug-ins/common/nova.c: ported to GimpAspectPreview. 6035 60362004-10-03 DindinX <dindinx@gimp.org> 6037 6038 * plug-ins/common/max_rgb.c: ported to GimpAspectPreview. 6039 60402004-10-03 Michael Schumacher <schumaml@gmx.de> 6041 6042 * plug-ins/dbbrowser/Makefile.am 6043 * plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to 6044 the beginning of LDADD 6045 60462004-10-03 DindinX <dindinx@gimp.org> 6047 6048 * libgimp/gimpaspectpreview.c: limit the size of the preview to 512 6049 pixels. This prevents plug-ins using gimp_drawable_get_thumbnail_data 6050 to crash. 6051 60522004-10-03 DindinX <dindinx@gimp.org> 6053 6054 * plug-ins/common/emboss.c: ported to GimpAspectPreview and made some 6055 cleanups so this plug-in now use the same naming scheme as other 6056 plug-ins do. 6057 60582004-10-03 DindinX <dindinx@gimp.org> 6059 6060 * plug-ins/common/whirlpinch.c: ported to GimpAspectPreview. 6061 60622004-10-03 Sven Neumann <sven@gimp.org> 6063 6064 * tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB. 6065 Fixes bug #154368. 6066 6067 * app/pdb/color_cmds.c 6068 * app/pdb/internal_procs.c 6069 * libgimp/gimpcolor_pdb.[ch]: regenerated. 6070 60712004-10-03 DindinX <dindinx@gimp.org> 6072 6073 * plug-ins/common/blinds.c: use a GimpAspectPreview to make the 6074 preview resizable. 6075 60762004-10-03 DindinX <dindinx@gimp.org> 6077 6078 * plug-ins/common/ripple.c: Added a preview. 6079 60802004-10-02 DindinX <dindinx@gimp.org> 6081 6082 * plug-ins/common/polar.c: use a GimpAspectPreview. 6083 60842004-10-02 DindinX <dindinx@gimp.org> 6085 6086 * plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the 6087 code much simpler. 6088 60892004-10-02 DindinX <dindinx@gimp.org> 6090 6091 * plug-ins/common/illusion.c: use a GimpAspectPreview so the preview 6092 is now resizable. 6093 60942004-10-02 DindinX <dindinx@gimp.org> 6095 6096 * plug-ins/common/apply_lens.c: added a preview. This plug-in still 6097 need some work. 6098 60992004-10-01 Michael Natterer <mitch@gimp.org> 6100 6101 * app/display/gimpdisplayshell-callbacks.c 6102 (gimp_display_shell_tool_events): dispatch GDK_Escape to 6103 GimpTool::key_press(). 6104 6105 * app/tools/gimpcroptool.c (gimp_crop_tool_key_press) 6106 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press): 6107 * app/tools/gimptransformtool.c (gimp_transform_tool_key_press): 6108 cancel the tool on <Escape>. 6109 61102004-10-01 Sven Neumann <sven@gimp.org> 6111 6112 * plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin. 6113 61142004-10-01 Sven Neumann <sven@gimp.org> 6115 6116 * app/tools/gimpcroptool.c (crop_response): destroy the info 6117 dialog instead of hiding it. Fixes session management. 6118 61192004-10-01 Sven Neumann <sven@gimp.org> 6120 6121 * app/tools/gimpcroptool.c: unset the highlight from 6122 crop_response() so it gets called when cropping is cancelled. 6123 6124 * app/dialogs/info-dialog.c (info_dialog_show): do what the 6125 function name says, show the window, but don't present it. 6126 Fixes bugs #128833 and #138816. 6127 61282004-10-01 Sven Neumann <sven@gimp.org> 6129 6130 * themes/Default/images/stock-frame-64.png: replaced the obtrusive 6131 drop-shadow by a thin white frame with a subtle shadow. Taken from 6132 a mockup done by Jimmac. 6133 6134 * app/widgets/gimpviewrenderer-frame.c: changed the hardcoded 6135 offsets for the new frame image :( 6136 61372004-10-01 Sven Neumann <sven@gimp.org> 6138 6139 * app/display/gimpdisplayshell-callbacks.c: no need to include 6140 gimpdisplayshell-render.h here. 6141 6142 * app/display/gimpdisplayshell-draw.c 6143 * app/display/gimpdisplayshell-render.[ch] 6144 6145 * app/display/gimpdisplayshell.[ch]: added an API to highlight a 6146 rectangle (specified in image coordinates). Actually it doesn't 6147 highlight but dims the area outside the rectangle. 6148 6149 * app/tools/gimpcroptool.c: use the new functionality to show the 6150 area to be cropped. Fixes bug #93360. 6151 61522004-09-30 Michael Natterer <mitch@gimp.org> 6153 6154 * plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed 6155 member "decription" to "menu_path". 6156 6157 * plug-ins/script-fu/script-fu-interface.c: changed accordingly. 6158 6159 * plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the 6160 menu_path as "blurb" to gimp_install_temp_proc(). Instead, 6161 pass "help" as "blurb" and nothing as "help". 6162 6163 * plug-ins/script-fu/scripts/test-sphere.scm: shortened overly 6164 long and useless help text. 6165 61662004-09-30 Michael Natterer <mitch@gimp.org> 6167 6168 * plug-ins/dbbrowser/gimpprocbox.c: don't include 6169 "libgimp/stdplugins-intl.h". 6170 6171 * plug-ins/dbbrowser/gimpprocbrowser.c 6172 * plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs() 6173 so we don't leak all param names and descriptions. 6174 6175 * plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or 6176 redundant information (help == blurb for deprecated procedures). 6177 61782004-09-30 Michael Natterer <mitch@gimp.org> 6179 6180 * plug-ins/dbbrowser/Makefile.am 6181 * plug-ins/dbbrowser/gimpprocbox.c: new files holding more common 6182 code from the two browsers. 6183 6184 * plug-ins/dbbrowser/gimpprocbrowser.c: use it. 6185 6186 * plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting 6187 by all columns in both views. More cleanup. 6188 61892004-09-30 Sven Neumann <sven@gimp.org> 6190 6191 * README: added missing linebreak. 6192 6193 * plug-ins/imagemap/imap_about.c (do_about_dialog): should not 6194 mark email address for translation. 6195 61962004-09-30 Daniel Egger <degger@fhm.edu> 6197 6198 * README: Applied proofreading patch from Jonathan Levi 6199 <drjlevi@netonecom.net>. 6200 62012004-09-30 Michael Natterer <mitch@gimp.org> 6202 6203 Cleaned up the DB Browser and Plugin Details code and GUI. It's 6204 not perfect yet but at least they don't look like crap any more. 6205 Fixes bug #131490. 6206 6207 * plug-ins/common/plugin-defs.pl 6208 * plug-ins/common/plugindetails.c: removed this plugin. 6209 6210 * plug-ins/common/.cvsignore 6211 * plug-ins/common/Makefile.am: regenerated. 6212 6213 * plug-ins/dbbrowser/Makefile.am 6214 * plug-ins/dbbrowser/dbbrowser.c 6215 * plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files. 6216 6217 * plug-ins/dbbrowser/gimpprocbrowser.[ch] 6218 * plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files. 6219 6220 * plug-ins/dbbrowser/plugin-browser.c: the former plugindetails. 6221 * plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser. 6222 6223 * plug-ins/script-fu/Makefile.am: link against the new library 6224 libgimpprocbrowser.a 6225 6226 * plug-ins/script-fu/script-fu-console.c: changed #includes 6227 accordingly. Minor cleanup. 6228 6229 * tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path 6230 return value. Was broken since the plug-in menu registering 6231 changes. 6232 6233 * app/pdb/plug_in_cmds.c: regenerated. 6234 62352004-09-30 Sven Neumann <sven@gimp.org> 6236 6237 * app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness 6238 I introduced with my last cleanup. 6239 62402004-09-29 Manish Singh <yosh@gimp.org> 6241 6242 * plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch 6243 from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and 6244 untabbifies things. Closes bug #153921. 6245 6246 * plug-ins/pygimp/plug-ins/gimpplugin.py 6247 * plug-ins/pygimp/plug-ins/gimpshelf.py 6248 * plug-ins/pygimp/plug-ins/gimpui.py: Untabbify. 6249 62502004-09-29 Manish Singh <yosh@gimp.org> 6251 6252 * plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history 6253 behavior. 6254 6255 * plug-ins/pygimp/plug-ins/clothify.py 6256 * plug-ins/pygimp/plug-ins/foggify.py 6257 * plug-ins/pygimp/plug-ins/gimpcons.py 6258 * plug-ins/pygimp/plug-ins/gtkcons.py 6259 * plug-ins/pygimp/plug-ins/pdbbrowse.py 6260 * plug-ins/pygimp/plug-ins/shadow_bevel.py 6261 * plug-ins/pygimp/plug-ins/sphere.py 6262 * plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify. 6263 62642004-09-29 Sven Neumann <sven@gimp.org> 6265 6266 * app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a 6267 tiny memleak spotted by Olivier. 6268 62692004-09-29 Sven Neumann <sven@gimp.org> 6270 6271 * libgimpwidgets/gimppreview.[ch] 6272 * libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer(). 6273 6274 * libgimp/gimpaspectpreview.[ch] 6275 * libgimp/gimpdrawablepreview.[ch] 6276 * libgimp/gimpui.def: removed the public draw_buffer API. 6277 Implement the virtual GimpPreview::draw_buffer method instead. 6278 6279 * plug-ins/common/cartoon.c 6280 * plug-ins/common/deinterlace.c 6281 * plug-ins/common/despeckle.c 6282 * plug-ins/common/dog.c 6283 * plug-ins/common/edge.c 6284 * plug-ins/common/engrave.c 6285 * plug-ins/common/exchange.c 6286 * plug-ins/common/gauss.c 6287 * plug-ins/common/grid.c 6288 * plug-ins/common/neon.c 6289 * plug-ins/common/noisify.c 6290 * plug-ins/common/oilify.c 6291 * plug-ins/common/photocopy.c 6292 * plug-ins/common/plasma.c 6293 * plug-ins/common/sel_gauss.c 6294 * plug-ins/common/sharpen.c 6295 * plug-ins/common/shift.c 6296 * plug-ins/common/snoise.c 6297 * plug-ins/common/sobel.c 6298 * plug-ins/common/spread.c 6299 * plug-ins/common/struc.c: changed accordingly. Don't pass the 6300 preview around as GimpDrawablePreview or GimpAspectPreview. It 6301 should whenever possible be accessed as GimpPreview. 6302 63032004-09-29 Sven Neumann <sven@gimp.org> 6304 6305 * libgimpwidgets/gimppreview.[ch] 6306 * libgimpwidgets/gimpscrolledpreview.[ch] 6307 * libgimpwidgets/gimpwidgets.def: moved the offsets and the 6308 draw_thumb method back to the GimpPreview class. 6309 6310 * libgimp/gimpdrawablepreview.c: changed accordingly. 6311 6312 * plug-ins/common/bumpmap.c 6313 * plug-ins/common/cartoon.c 6314 * plug-ins/common/deinterlace.c 6315 * plug-ins/common/despeckle.c 6316 * plug-ins/common/dog.c 6317 * plug-ins/common/edge.c 6318 * plug-ins/common/engrave.c 6319 * plug-ins/common/exchange.c 6320 * plug-ins/common/gauss.c 6321 * plug-ins/common/grid.c 6322 * plug-ins/common/mblur.c 6323 * plug-ins/common/neon.c 6324 * plug-ins/common/noisify.c 6325 * plug-ins/common/oilify.c 6326 * plug-ins/common/photocopy.c 6327 * plug-ins/common/sel_gauss.c 6328 * plug-ins/common/sharpen.c 6329 * plug-ins/common/shift.c 6330 * plug-ins/common/sobel.c 6331 * plug-ins/common/softglow.c 6332 * plug-ins/common/spread.c 6333 * plug-ins/common/struc.c 6334 * plug-ins/common/unsharp.c 6335 * plug-ins/common/wind.c: back to using gimp_preview_get_position(). 6336 6337 * libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected 6338 gtk-doc comment. 6339 63402004-09-29 DindinX <dindinx@gimp.org> 6341 6342 * plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the 6343 preview is resizable. 6344 63452004-09-29 Sven Neumann <sven@gimp.org> 6346 6347 * libgimp/gimpui.def 6348 * libgimpwidgets/gimpwidgets.def: updated. 6349 63502004-09-29 DindinX <dindinx@gimp.org> 6351 6352 * libgimpwidgets/gimppreview.c 6353 * libgimpwidgets/gimppreview.h: split this widget into itself (more 6354 abstract now) and ... 6355 6356 * libgimpwidgets/gimpscrolledpreview.c 6357 * libgimpwidgets/gimpscrolledpreview.h: this widget which also have 6358 some scrollbars and a nagivation preview. 6359 6360 * libgimpwidgets/Makefile.am 6361 * libgimpwidgets/gimpwidgetstypes.h: changed accordingly. 6362 6363 * libgimp/gimpaspectpreview.c 6364 * libgimp/gimpaspectpreview.h: Added this widget, derived from 6365 GimpPreview, which has always the same ratio has the given drawable. 6366 This widget has almost the same api as GimpDrawablePreview, and is 6367 useful for plug-ins that show the whole (scaled) drawable in their 6368 preview. 6369 6370 * libgimp/gimpdrawablepreview.c 6371 * libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived 6372 from GimpScrolledPreview. 6373 6374 * libgimp/Makefile.am 6375 * libgimp/gimpui.h 6376 * libgimp/gimpuitypes.h: changed accordingly. 6377 6378 * plug-ins/common/plasma.c: use a GimpAspectPreview. 6379 6380 * plug-ins/common/bumpmap.c 6381 * plug-ins/common/cartoon.c 6382 * plug-ins/common/deinterlace.c 6383 * plug-ins/common/despeckle.c 6384 * plug-ins/common/dog.c 6385 * plug-ins/common/edge.c 6386 * plug-ins/common/engrave.c 6387 * plug-ins/common/exchange.c 6388 * plug-ins/common/gauss.c 6389 * plug-ins/common/grid.c 6390 * plug-ins/common/mblur.c 6391 * plug-ins/common/neon.c 6392 * plug-ins/common/noisify.c 6393 * plug-ins/common/oilify.c 6394 * plug-ins/common/photocopy.c 6395 * plug-ins/common/sel_gauss.c 6396 * plug-ins/common/sharpen.c 6397 * plug-ins/common/shift.c 6398 * plug-ins/common/sobel.c 6399 * plug-ins/common/softglow.c 6400 * plug-ins/common/spread.c 6401 * plug-ins/common/struc.c 6402 * plug-ins/common/unsharp.c 6403 * plug-ins/common/wind.c: use gimp_scrolled_preview_get_position 6404 instead of gimp_preview_get_position. 6405 64062004-09-29 Michael Natterer <mitch@gimp.org> 6407 6408 * libgimp/gimpregioniterator.[ch]: renamed the "run_mode" 6409 parameters to "unused" and remode the rum_mode member from the 6410 private GimpRgbIterator struct. 6411 6412 * plug-ins/common/AlienMap2.c 6413 * plug-ins/common/autostretch_hsv.c 6414 * plug-ins/common/c_astretch.c 6415 * plug-ins/common/color_enhance.c 6416 * plug-ins/common/colorify.c 6417 * plug-ins/common/colortoalpha.c 6418 * plug-ins/common/gradmap.c 6419 * plug-ins/common/mapcolor.c 6420 * plug-ins/common/max_rgb.c 6421 * plug-ins/common/noisify.c 6422 * plug-ins/common/normalize.c 6423 * plug-ins/common/sample_colorize.c 6424 * plug-ins/common/scatter_hsv.c 6425 * plug-ins/common/semiflatten.c 6426 * plug-ins/common/threshold_alpha.c 6427 * plug-ins/common/vinvert.c 6428 * plug-ins/fp/fp.c: made "run_mode" a private variable of run() 6429 and pass 0 to gimp_rgn_iterate*(). Minor cleanups. 6430 64312004-09-29 Sven Neumann <sven@gimp.org> 6432 6433 * libgimp/gimp.def 6434 * libgimp/gimpui.def 6435 * libgimpwidgets/gimpwidgets.def: updated. 6436 64372004-09-29 Michael Natterer <mitch@gimp.org> 6438 6439 * tools/pdbgen/Makefile.am 6440 * tools/pdbgen/groups.pl: renamed group "gradient_edit" to 6441 "gradient" and added "brush", "palette" and "pattern" groups. 6442 6443 * tools/pdbgen/pdb/gradient_edit.pdb: removed. 6444 6445 * tools/pdbgen/pdb/brush.pdb 6446 * tools/pdbgen/pdb/gradient.pdb 6447 * tools/pdbgen/pdb/palette.pdb 6448 * tools/pdbgen/pdb/pattern.pdb: new files containing functions 6449 which create, duplicate, rename, delete, query and manipulate 6450 a single brush, pattern etc. 6451 6452 * tools/pdbgen/pdb/brushes.pdb 6453 * tools/pdbgen/pdb/gradients.pdb 6454 * tools/pdbgen/pdb/palettes.pdb 6455 * tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete 6456 now and simply removed the procedures that were added after 2.0. 6457 6458 * app/pdb/gradient_edit_cmds.c 6459 * libgimp/gimpgradientedit_pdb.[ch]: removed. 6460 6461 * app/pdb/brush_cmds.c 6462 * app/pdb/gradient_cmds.c 6463 * app/pdb/palette_cmds.c 6464 * app/pdb/pattern_cmds.c 6465 * libgimp/gimpbrush_pdb.[ch] 6466 * libgimp/gimpgradient_pdb.[ch] 6467 * libgimp/gimppalette_pdb.[ch] 6468 * libgimp/gimppattern_pdb.[ch]: new files. 6469 6470 * app/pdb/brushes_cmds.c 6471 * app/pdb/gradients_cmds.c 6472 * app/pdb/internal_procs.c 6473 * app/pdb/palettes_cmds.c 6474 * app/pdb/patterns_cmds.c 6475 * libgimp/gimp_pdb.h 6476 * libgimp/gimpbrushes_pdb.[ch] 6477 * libgimp/gimpgradients_pdb.[ch] 6478 * libgimp/gimppalettes_pdb.[ch] 6479 * libgimp/gimppatterns_pdb.[ch]: regenerated. 6480 6481 * app/pdb/Makefile.am 6482 * libgimp/Makefile.am 6483 * plug-ins/gfig/gfig-style.c: changed accordingly. 6484 64852004-09-28 Sven Neumann <sven@gimp.org> 6486 6487 * app/file/gimprecentlist.c (gimp_recent_list_write): don't write 6488 empty groups. 6489 6490 * app/file/gimprecentlist.c: disabled the code for the win32 6491 platform. It doesn't make much sense there anyway. If someone 6492 wants to contribute a win32 specific implementation, we'd welcome 6493 that. A Mac OS X implementation would be nice to have as well. 6494 64952004-09-28 Sven Neumann <sven@gimp.org> 6496 6497 * etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce. 6498 64992004-09-28 Maurits Rijk <m.rijk@chello.nl> 6500 6501 * plug-ins/imagemap/imap_circle.c: 6502 * plug-ins/imagemap/imap_cmd_gimp_guides.c 6503 * plug-ins/imagemap/imap_edit_area_info.c 6504 * plug-ins/imagemap/imap_grid.c 6505 * plug-ins/imagemap/imap_polygon.c 6506 * plug-ins/imagemap/imap_rectangle.c 6507 * plug-ins/imagemap/imap_settings.c: first set of changes to make 6508 imagemap fully HIG compliant. More to come. 6509 65102004-09-28 Sven Neumann <sven@gimp.org> 6511 6512 * app/file/gimprecentlist.c: seek to the start of the file before 6513 calling lockf(). 6514 65152004-09-28 Maurits Rijk <m.rijk@chello.nl> 6516 6517 * plug-ins/common/borderaverage.c: added size entry. Fixes #143156 6518 (Use size entry widget in Borderaverage plug-in) 6519 65202004-09-28 Sven Neumann <sven@gimp.org> 6521 6522 * docs/gimp.1.in: updated name of the splash image. 6523 65242004-09-28 Michael Natterer <mitch@gimp.org> 6525 6526 * app/core/gimppalette.c: code review / cleanup. 6527 6528 (gimp_palette_delete_entry): don't add "Black" when the last color 6529 gets removed, a palette can easily live with zero colors. 6530 6531 * app/widgets/gimppaletteeditor.c 6532 (palette_editor_invalidate_preview): also update the entry which 6533 shows the palette_entry's name. 6534 65352004-09-28 Sven Neumann <sven@gimp.org> 6536 6537 * app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle 6538 EINTR while writing. 6539 65402004-09-28 Sven Neumann <sven@gimp.org> 6541 6542 * app/config/gimpxmlparser.[ch]: added new convenience function 6543 gimp_xml_parser_parse_fd(). 6544 6545 * app/file/Makefile.am 6546 * app/file/gimprecentitem.[ch] 6547 * app/file/gimprecentlist.[ch]: added an implementation of the 6548 recent-files spec as found on freedesktop.org. This code is taken 6549 from libegg and has been edited to fit the GIMP needs. 6550 6551 * app/file/file-open.c 6552 * app/file/file-save.c: update the ~/.recently-used file. Fixes 6553 bug #131206. 6554 65552004-09-28 Michael Natterer <mitch@gimp.org> 6556 6557 * app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview): 6558 removed hack which strcmp()s the property name to figure the 6559 preview's border_width and use the container view's 6560 preview_border_width instead. 6561 65622004-09-28 Sven Neumann <sven@gimp.org> 6563 6564 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog): 6565 simplified code and removed a compiler warning. 6566 65672004-09-28 Carol Spears <carol@gimp.org> 6568 6569 * data/images/gimp-splash.png there was a white spot that was making 6570 me crazy. It is gone now. 6571 65722004-09-28 Sven Neumann <sven@gimp.org> 6573 6574 * app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack 6575 to get rid of the border drawn around thumbnails in the "Open Recent" 6576 menu. 6577 65782004-09-28 Sven Neumann <sven@gimp.org> 6579 6580 * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog): 6581 add a shortcut to the filechooser that points to the user's folder. 6582 6583 * app/actions/vectors-commands.c: added a file filter to the SVG 6584 import dialog. 6585 65862004-09-27 Sven Neumann <sven@gimp.org> 6587 6588 * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some 6589 padding for the shadow frame to avoid scaling the thumbnail. 6590 65912004-09-27 Sven Neumann <sven@gimp.org> 6592 6593 * themes/Default/images/Makefile.am 6594 * themes/Default/images/stock-frame-64.png: added a stock icon 6595 that shows a simple drop shadow but could be exchanged for other 6596 image decorations. 6597 6598 * libgimpwidgets/gimpstock.[ch]: register the new icon. 6599 6600 * app/widgets/Makefile.am 6601 * app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some 6602 ugly code to draw a frame around a preview pixbuf. 6603 6604 * app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached 6605 to the GimpViewRenderer class so it can be shared by all renderers. 6606 6607 * app/widgets/gimpviewrendererimagefile.c: use the new functionality 6608 to draw a nice frame around imagefile previews. 6609 6610 * app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border. 6611 66122004-09-27 Michael Natterer <mitch@gimp.org> 6613 6614 * app/actions/data-commands.c: cleanup. 6615 6616 * app/actions/vectors-commands.c 6617 * app/display/gimpdisplayshell.c 6618 * tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes. 6619 6620 * app/text/gimptext-bitmap.c 6621 * app/text/gimptext-parasite.c 6622 * app/text/gimptext-vectors.c 6623 * app/text/gimptext-xlfd.c 6624 * app/text/gimptext.c 6625 * app/text/gimptextlayer-xcf.c: include "text-types.h" instead 6626 of "text/text-types.h". 6627 6628 * app/widgets/gimppatternselect.c: create a GimpPatternFactoryView 6629 instead of GimpDataFactoryView. 6630 6631 * app/pdb/paint_tools_cmds.c: regenerated. 6632 66332004-09-27 Michael Natterer <mitch@gimp.org> 6634 6635 * app/actions/brushes-actions.c 6636 * app/actions/gradients-actions.c 6637 * app/actions/palettes-actions.c 6638 * app/actions/patterns-actions.c: made the "foo-edit" actions 6639 GimpStringActions and pass the identifier of the editor dialog 6640 to the callback. 6641 6642 * app/actions/data-commands.[ch] (data_edit_data_cmd_callback): 6643 show the editor dialog here instead of calling view->edit_func(). 6644 6645 * app/dialogs/dialogs-constructors.[ch]: removed the brush, 6646 gradient and palette edit_funcs. 6647 6648 * app/widgets/widgets-types.h: removed typedef GimpDataEditFunc. 6649 6650 * app/widgets/gimpdatafactoryview.[ch]: removed the edit_func 6651 member and parameters and create the edit button unconditionally. 6652 6653 * app/widgets/gimpbrushfactoryview.[ch] 6654 * app/widgets/gimppatternfactoryview.[ch]: changed accordingly. 6655 6656 * app/widgets/Makefile.am 6657 * app/widgets/gimpdataselect.[ch]: removed this class, it's not 6658 needed any longer. 6659 6660 * app/widgets/gimpbrushselect.[ch] 6661 * app/widgets/gimpgradientselect.[ch] 6662 * app/widgets/gimppaletteselect.[ch] 6663 * app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog 6664 and follow the edit_func removal. 6665 6666 * app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func 6667 stuff. 6668 6669 * app/widgets/gimpcontainereditor.c: minor unrelated cleanup. 6670 66712004-09-27 Michael Natterer <mitch@gimp.org> 6672 6673 * app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors 6674 for consistency and added a (useless) template grid. 6675 6676 * app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries 6677 more readable by using macros to define them. 6678 66792004-09-27 Sven Neumann <sven@gimp.org> 6680 6681 * app/core/gimpimagefile.c: removed conversion to TempBuf. 6682 Instead implement GimpViewable::get_new_pixbuf by compositing the 6683 thumbnail on a checkerboard. 6684 6685 * app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf 6686 struct member to pixbuf. 6687 (gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf() 6688 and render the pixbuf before falling back to the TempBuf preview. 6689 (gimp_view_renderer_render_pixbuf): new function that sets a 6690 pixbuf for the renderer and flushes the render_buffer. 6691 6692 * app/widgets/gimpviewrendererimagefile.c 6693 (gimp_view_renderer_imagefile_render): render the pixbuf. 6694 6695 * app/dialogs/dialogs-constructors.c: create the document history 6696 dockable with a zero borderwidth. 6697 66982004-09-27 Sven Neumann <sven@gimp.org> 6699 6700 * tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use 6701 the GIMP_CHECK_SIZE_SM define, not the enum value 6702 GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!). 6703 6704 * app/pdb/fileops_cmds.c: regenerated. 6705 6706 * app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup. 6707 67082004-09-26 Michael Natterer <mitch@gimp.org> 6709 6710 * app/widgets/gimpdataeditor.[ch]: added "data" property. 6711 6712 * app/widgets/gimpbrusheditor.c 6713 * app/widgets/gimpgradienteditor.c 6714 * app/widgets/gimppaletteeditor.c: pass the current data to 6715 g_object_new() so we never end up with initially empty editors. 6716 67172004-09-26 Michael Natterer <mitch@gimp.org> 6718 6719 * app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY 6720 "data-factory" property. Removed gimp_data_editor_construct(). 6721 6722 * app/widgets/gimpbrusheditor.c 6723 * app/widgets/gimpgradienteditor.c 6724 * app/widgets/gimppaletteeditor.c: pass the construct parameters 6725 to g_object_new(). 6726 67272004-09-26 Sven Neumann <sven@gimp.org> 6728 6729 * app/widgets/gimpcolorframe.c: changed label alignment to be more 6730 HIG conformant and consistent with the rest of the user interface. 6731 67322004-09-26 Michael Natterer <mitch@gimp.org> 6733 6734 * app/widgets/gimpdialogfactory.[ch]: added "name", "blurb", 6735 "stock_id" and "help_id" to struct GimpDialogFactoryEntry and to 6736 gimp_dialog_factory_dialog_register(). Added typedef 6737 GimpDialogConstructor which takes a GimpDialogFactoryEntry in 6738 addition to the parameters GimpDialogNewFunc takes. Added a 6739 constructor function pointer to GimpDialogFactory which defaults 6740 to a function that just returns entry->new_func(). Use that 6741 constructor instead of entry->new_func() for creating 6742 dialogs. Added public API gimp_dialog_factory_set_constructor(). 6743 6744 * app/dialogs/dialogs.c: register name, blurb, stock_id and 6745 help_id for all dockables so all the dialog info lives in one huge 6746 ugly table now. For the global_toolbox_factory and the 6747 global_dock_factory, set a constructor which creates a dockable 6748 around the widget returned by entry->new_func(). 6749 6750 * app/dialogs/dialogs-constructors.[ch]: don't create the dockable 6751 in each dialog constructor. Removes tons of code and reduces most 6752 constructors to a "return gimp_foo_new(...)" one-liner. Got rid of 6753 all static variables, they were from a time when GimpDialogFactory 6754 was unable to manage singletons. 6755 6756 * app/widgets/gimpbrusheditor.[ch] 6757 * app/widgets/gimpgradienteditor.[ch] 6758 * app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not 6759 GimpDataEditor from gimp_foo_editor_new(). 6760 6761 * app/widgets/gimpdataeditor.c: minor cleanups. 6762 67632004-09-26 Michael Natterer <mitch@gimp.org> 6764 6765 * app/widgets/gimpcolordialog.c: moved stuff from new() to init(). 6766 67672004-09-26 Michael Natterer <mitch@gimp.org> 6768 6769 Ported GimpNavigationView to use actions for its buttons: 6770 6771 * app/menus/menus.c (menus_init): register a <GimpNavigationEditor> 6772 UI manager containing the "view" action group. 6773 6774 * app/actions/actions.c (action_data_get_foo): handle "data" being 6775 a GimpNavigationEditor. 6776 6777 * app/actions/view-actions.c (view_actions): added tooltips for 6778 the actions used in the editor. 6779 6780 (view_actions_update): use action_data_get_display() instead of 6781 checking the type of "data" manually. 6782 6783 * app/widgets/gimpeditor.c (gimp_editor_add_action_button): use 6784 a GtkToggleButton instead of GimpButton for GtkToggleActions. 6785 6786 * app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory 6787 parameter to the public constructor and removed all other 6788 parameters. Simplified gimp_navigation_editor_new_private() and 6789 use gimp_editor_add_action_button() instead of just add_button() 6790 for creating the buttons. Made gimp_navigation_view_set_shell() 6791 private. Update the UI manager when the shell zooms or scrolls. 6792 6793 * app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new): 6794 pass the menu_factory to gimp_navigation_editor_new(). 6795 6796 Removed #includes which are not needed any more. 6797 67982004-09-26 DindinX <dindinx@gimp.org> 6799 6800 * plug-ins/common/exchange.c: use the same preview as in all other 6801 plug-ins. 6802 68032004-09-25 Sven Neumann <sven@gimp.org> 6804 6805 * plug-ins/imagemap/imap_stock.c: removed C++ style comment. 6806 68072004-09-25 Maurits Rijk <m.rijk@chello.nl> 6808 6809 * plug-ins/imagemap/imap_stock.[ch] 6810 * plug-ins/imagemap/Makefile.am 6811 * plug-ins/imagemap/*.xpm: get rid of all .xpm images 6812 6813 * configure.in 6814 * plug-ins/imagemap/images/*: and add them as .png here 6815 6816 * plug-ins/imagemap/imap_browse.c: remove unused include. 6817 68182004-09-25 Sven Neumann <sven@gimp.org> 6819 6820 * app/widgets/gimpviewrenderer.h: removed trailing whitespace. 6821 68222004-09-25 Sven Neumann <sven@gimp.org> 6823 6824 * app/display/gimpdisplayshell-close.c: changed mnemonic so that 6825 you can close an image w/o saving it by using Ctrl-W Alt-W. 6826 68272004-09-25 Michael Natterer <mitch@gimp.org> 6828 6829 * app/core/gimpimage-qmask.h: added comment about not changing the 6830 silly "Qmask" string because it is used to identify the Quick Mask 6831 in the XCF. 6832 6833 * app/core/gimpchannel.c: implement GimpViewable::get_description() 6834 and return "Quick Mask" if it's the Quick Mask. 6835 6836 * app/actions/qmask-actions.c 6837 * app/actions/qmask-commands.c 6838 * app/core/core-enums.[ch] 6839 * app/core/gimpimage-qmask.c 6840 * app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/. 6841 68422004-09-25 DindinX <dindinx@gimp.org> 6843 6844 * plug-ins/common/engrave.c: Added a preview and #if'ed out some 6845 unreachable code. 6846 68472004-09-25 Michael Natterer <mitch@gimp.org> 6848 6849 * app/core/gimppickable.[ch]: added new vitrual function 6850 GimpPickableInterface::get_image() 6851 6852 * app/core/gimpdrawable.c 6853 * app/core/gimpimagemap.c 6854 * app/core/gimpprojection.[ch]: implement it. 6855 68562004-09-25 Michael Natterer <mitch@gimp.org> 6857 6858 * app/widgets/gimpcolormapeditor.[ch] 6859 * app/widgets/gimphistogrameditor.[ch] 6860 * app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage" 6861 parameters from public constructors. They are all GimpImageEditor 6862 widgets which get their image via gimp_docked_set_context() and 6863 gimp_image_editor_set_image() later anyway. Fixes uglyness as well 6864 as problems where the editors had an image but no context, causing 6865 strange behavior in their foo_actions_update() functions. 6866 6867 * app/dialogs/dialogs-constructors.c: changed accordingly. Removed 6868 redundant calls to gimp_dockable_set_context() on newly created 6869 dockables because they will get a context when added to their 6870 containers. 6871 68722004-09-25 Michael Natterer <mitch@gimp.org> 6873 6874 * app/widgets/gimpcolormapeditor.c: moved stuff from 6875 gimp_colormap_editor_new() to 6876 gimp_colormap_editor_init(). Untabified. 6877 68782004-09-25 DindinX <dindinx@gimp.org> 6879 6880 * plug-ins/common/dog.c: made the preview behave like in all other 6881 plug-ins by using a GimpDrawablePreview. This allowed to remove a 6882 bunch of complicated code. 6883 68842004-09-25 Sven Neumann <sven@gimp.org> 6885 6886 * app/widgets/gimptemplateeditor.[ch]: added resolution and image 6887 type information which is usually hidden in the Advanced Options. 6888 68892004-09-25 DindinX <dindinx@gimp.org> 6890 6891 * plug-ins/common/oilify.c: Added a preview and made some small 6892 cleanups. 6893 68942004-09-24 Sven Neumann <sven@gimp.org> 6895 6896 * app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to 6897 improve the tooltip for the layer-preview-size gimprc setting. 6898 Addresses bug #153603. 6899 69002004-09-24 Michael Natterer <mitch@gimp.org> 6901 6902 * app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored 6903 common code out of the UNDO amd REDO cases. Use gimp_drawable_update() 6904 instead of gimp_viewable_invalidate_preview() so the projection 6905 gets updated correctly. Fixes bug #149558. 6906 6907 * app/core/gimplayer-floating-sel.c (floating_sel_to_layer): 6908 removed unused variables and their assignments. 6909 69102004-09-24 Sven Neumann <sven@gimp.org> 6911 6912 * app/widgets/gimptemplateeditor.[ch]: added a label that shows 6913 the pixel size (as in the initial mockup done by Jimmac). 6914 69152004-09-24 Michael Natterer <mitch@gimp.org> 6916 6917 * app/tools/gimpimagemaptool.c 6918 (gimp_image_map_tool_settings_dialog): set the folder using 6919 gtk_file_chooser_set_current_folder(), not set_filename(). 6920 69212004-09-24 Sven Neumann <sven@gimp.org> 6922 6923 * app/base/curves.[ch] 6924 * app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it. 6925 6926 * tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the 6927 last control point which got initialized to (255,255) by 6928 curves_init(). Fixes bug #153635. 6929 6930 * app/pdb/color_cmds.c: regenerated. 6931 69322004-09-24 Sven Neumann <sven@gimp.org> 6933 6934 * app/plug-in/plug-in-message.c: removed a linebreak from a 6935 warning message. 6936 69372004-09-24 Michael Natterer <mitch@gimp.org> 6938 6939 * app/paint/gimpairbrushoptions.c 6940 * app/paint/gimpcloneoptions.c 6941 * app/paint/gimpconvolveoptions.c 6942 * app/paint/gimpdodgeburnoptions.c 6943 * app/paint/gimperaseroptions.c 6944 * app/paint/gimpinkoptions.c 6945 * app/paint/gimppaintoptions.c 6946 * app/paint/gimppenciloptions.c 6947 * app/paint/gimpsmudgeoptions.c 6948 * app/tools/gimpblendoptions.c 6949 * app/tools/gimpbucketfilloptions.c 6950 * app/tools/gimpcoloroptions.c 6951 * app/tools/gimpcolorpickeroptions.c 6952 * app/tools/gimpcropoptions.c 6953 * app/tools/gimpflipoptions.c 6954 * app/tools/gimphistogramoptions.c 6955 * app/tools/gimpimagemapoptions.c 6956 * app/tools/gimpmagnifyoptions.c 6957 * app/tools/gimpmeasureoptions.c 6958 * app/tools/gimpmoveoptions.c 6959 * app/tools/gimppaintoptions-gui.c 6960 * app/tools/gimpselectionoptions.c 6961 * app/tools/gimptextoptions.c 6962 * app/tools/gimptransformoptions.c 6963 * app/tools/gimpvectoroptions.c: code cleanup: untabified and 6964 trailing whitespace removal, removed empty instance_init() 6965 funcions, cleaned up variable declarations/initializations. 6966 69672004-09-23 Michael Natterer <mitch@gimp.org> 6968 6969 * app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register) 6970 * app/tools/gimppenciltool.c (gimp_pencil_tool_register): 6971 add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because 6972 these tools use the current gradient. Fixes bug #153584. 6973 69742004-09-23 Michael Natterer <mitch@gimp.org> 6975 6976 * app/dialogs/Makefile.am 6977 * app/dialogs/color-dialog.[ch]: removed... 6978 6979 * app/widgets/Makefile.am 6980 * app/widgets/widgets-types.h 6981 * app/widgets/gimpcolordialog.[ch]: ...and added as widget. 6982 6983 * app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM. 6984 6985 * app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState. 6986 6987 * app/widgets/gimpcolormapeditor.[ch] 6988 * app/widgets/gimpcolorpanel.[ch] 6989 * app/widgets/gimpgradienteditor.[ch] 6990 * app/widgets/gimppaletteeditor.[ch] 6991 * app/widgets/gimptoolbox-color-area.c 6992 * app/actions/gradient-editor-commands.c 6993 * app/actions/view-commands.c: ported to GimpColorDialog. Removes 6994 a whole bunch of ugly widgets/ -> dialogs/ dependencies. 6995 69962004-09-23 Sven Neumann <sven@gimp.org> 6997 6998 * plug-ins/script-fu/script-fu-interface.c: put the text view into 6999 a scrolled window. Removed "changed" callbacks for GtkEntry and 7000 GtkTextView. Instead retrieve the final string when the dialog is 7001 confirmed. 7002 7003 * plug-ins/script-fu/scripts/carved-logo.scm 7004 * plug-ins/script-fu/scripts/chrome-it.scm 7005 * plug-ins/script-fu/scripts/crystal-logo.scm 7006 * plug-ins/script-fu/scripts/sota-chrome-logo.scm: use 7007 gimp-data-directory instead of the deprecated constant 7008 gimp-data-dir. 7009 7010 * plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for 7011 translation that I marked yesterday. Won't work unfortunately. 7012 70132004-09-23 Sven Neumann <sven@gimp.org> 7014 7015 * plug-ins/script-fu/scripts/blended-logo.scm: fixed context 7016 push/pop. 7017 70182004-09-23 Sven Neumann <sven@gimp.org> 7019 7020 * plug-ins/script-fu/script-fu-enums.h 7021 * plug-ins/script-fu/script-fu-interface.c 7022 * plug-ins/script-fu/script-fu-scripts.c 7023 * plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin 7024 Cozens, based on a patch by Dov Grobgeld. Implements multi-line 7025 text input in Script-Fu (bug #124394). 7026 7027 * plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT 7028 parameter. 7029 70302004-09-23 Sven Neumann <sven@gimp.org> 7031 7032 * libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail, 7033 gimp_image_get_thumbnail): use the exported symbols from 7034 libgimp, not the private _gimp_drawable_thumbnail() 7035 and _gimp_image_thumbnail() functions. 7036 7037 * libgimp/gimp.def: added new symbols, removed 7038 _gimp_image_thumbnail and _gimp_drawable_thumbnail. 7039 70402004-09-23 Michael Natterer <mitch@gimp.org> 7041 7042 * tools/pdbgen/pdb/brushes.pdb 7043 * tools/pdbgen/pdb/gradients.pdb 7044 * tools/pdbgen/pdb/palettes.pdb 7045 * tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo() 7046 procedures and marked the foos_get_foo() ones as deprecated. For 7047 brushes, patterns and palettes, added foos_get_foo_info() 7048 procedures which work like foos_get_foo_data() but return just the 7049 properties, not the actual data. Allow NULL or "" to be passed 7050 as name to all functions (use the current brush, pattern etc. 7051 in this case). 7052 7053 * tools/pdbgen/pdb/fonts.pdb: cleanup. 7054 7055 * app/pdb/procedural_db.c: added the removed ones to the compat 7056 hash table. 7057 7058 * libgimp/Makefile.am 7059 * libgimp/gimpbrushes.[ch] 7060 * libgimp/gimpgradients.[ch] 7061 * libgimp/gimppalettes.[ch] 7062 * libgimp/gimppatterns.[ch]: new files with compat functions 7063 wich call the resp. gimp_context_*() functions. 7064 7065 * libgimp/gimp.h: changed accordingly. 7066 7067 * app/pdb/brushes_cmds.c 7068 * app/pdb/gradients_cmds.c 7069 * app/pdb/internal_procs.c 7070 * app/pdb/palettes_cmds.c 7071 * app/pdb/patterns_cmds.c 7072 * libgimp/gimpbrushes_pdb.[ch] 7073 * libgimp/gimpgradients_pdb.[ch] 7074 * libgimp/gimppalettes_pdb.[ch] 7075 * libgimp/gimppatterns_pdb.[ch]: regenerated. 7076 7077 * plug-ins/FractalExplorer/Dialogs.c 7078 * plug-ins/gfig/gfig-dialog.c 7079 * plug-ins/gfig/gfig-style.[ch] 7080 * plug-ins/gflare/gflare.c: changed accordingly. 7081 70822004-09-23 Michael Natterer <mitch@gimp.org> 7083 7084 * plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for 7085 packing preview and controls so the controls are resizable again. 7086 70872004-09-23 Michael Natterer <mitch@gimp.org> 7088 7089 * plug-ins/script-fu/scripts/3d-outline.scm 7090 * plug-ins/script-fu/scripts/beveled-pattern-arrow.scm 7091 * plug-ins/script-fu/scripts/beveled-pattern-bullet.scm 7092 * plug-ins/script-fu/scripts/beveled-pattern-button.scm 7093 * plug-ins/script-fu/scripts/beveled-pattern-heading.scm 7094 * plug-ins/script-fu/scripts/beveled-pattern-hrule.scm 7095 * plug-ins/script-fu/scripts/blended-logo.scm 7096 * plug-ins/script-fu/scripts/carve-it.scm 7097 * plug-ins/script-fu/scripts/carved-logo.scm 7098 * plug-ins/script-fu/scripts/chip-away.scm 7099 * plug-ins/script-fu/scripts/chrome-it.scm 7100 * plug-ins/script-fu/scripts/coffee.scm 7101 * plug-ins/script-fu/scripts/comic-logo.scm 7102 * plug-ins/script-fu/scripts/coolmetal-logo.scm 7103 * plug-ins/script-fu/scripts/crystal-logo.scm 7104 * plug-ins/script-fu/scripts/frosty-logo.scm 7105 * plug-ins/script-fu/scripts/glossy.scm 7106 * plug-ins/script-fu/scripts/hsv-graph.scm 7107 * plug-ins/script-fu/scripts/land.scm 7108 * plug-ins/script-fu/scripts/lava.scm 7109 * plug-ins/script-fu/scripts/mkbrush.scm 7110 * plug-ins/script-fu/scripts/rendermap.scm 7111 * plug-ins/script-fu/scripts/select-to-brush.scm 7112 * plug-ins/script-fu/scripts/select-to-pattern.scm 7113 * plug-ins/script-fu/scripts/sota-chrome-logo.scm 7114 * plug-ins/script-fu/scripts/spyrogimp.scm 7115 * plug-ins/script-fu/scripts/starburst-logo.scm 7116 * plug-ins/script-fu/scripts/starscape-logo.scm 7117 * plug-ins/script-fu/scripts/t-o-p-logo.scm 7118 * plug-ins/script-fu/scripts/test-sphere.scm 7119 * plug-ins/script-fu/scripts/textured-logo.scm: use the new 7120 opacity, paint_mode, brush, pattern, gradient, palette and font 7121 accessors. 7122 71232004-09-23 Sven Neumann <sven@gimp.org> 7124 7125 Converted the last bunch of scripts to the new context API: 7126 7127 * plug-ins/script-fu/scripts/[s-z]*.scm 7128 71292004-09-23 Sven Neumann <sven@gimp.org> 7130 7131 Converted more scripts to the new context API: 7132 7133 * plug-ins/script-fu/scripts/glossy.scm 7134 * plug-ins/script-fu/scripts/hsv-graph.scm 7135 * plug-ins/script-fu/scripts/image-structure.scm 7136 * plug-ins/script-fu/scripts/perspective-shadow.scm 7137 * plug-ins/script-fu/scripts/pupi-button.scm 7138 * plug-ins/script-fu/scripts/rendermap.scm 7139 * plug-ins/script-fu/scripts/ripply-anim.scm 7140 71412004-09-23 Sven Neumann <sven@gimp.org> 7142 7143 * plug-ins/script-fu/scripts/hsv-graph.scm: 7144 7145 * tools/pdbgen/pdb/context.pdb: oops, should probably pop, not 7146 push a context in gimp_context_pop(). 7147 7148 * app/pdb/context_cmds.c: regenerated. 7149 7150 * plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the 7151 brush description, simply use the name choosen by the user. 7152 71532004-09-23 Sven Neumann <sven@gimp.org> 7154 7155 Converted the next bunch of scripts to the new context API: 7156 7157 * plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context. 7158 Removed code that used to restore the context values changed by 7159 the scripts. 7160 71612004-09-23 Michael Natterer <mitch@gimp.org> 7162 7163 * app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv): 7164 removed warning about entering a dead code path. That path is not 7165 dead at all :) 7166 71672004-09-23 Michael Natterer <mitch@gimp.org> 7168 7169 * tools/pdbgen/pdb/context.pdb: added accessors for the context's 7170 brush, pattern, gradient, palette and brush. Deprecation of old 7171 functions will follow. Fixes gimp-context-set-background wrapper. 7172 Cleanup. 7173 7174 * tools/pdbgen/pdb/patterns.pdb 7175 * libgimp/gimpbrushes.h: minor fixes. 7176 7177 * app/pdb/context_cmds.c 7178 * app/pdb/internal_procs.c 7179 * app/pdb/patterns_cmds.c 7180 * libgimp/gimpcontext_pdb.[ch]: regenerated. 7181 71822004-09-23 Sven Neumann <sven@gimp.org> 7183 7184 * plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics. 7185 71862004-09-22 Kevin Turner <acapnotic@twistedmatrix.com> 7187 7188 * plug-ins/pygimp/gimpfu.py (register): clean up errors in 7189 parameter checking. 7190 71912004-09-22 Michael Natterer <mitch@gimp.org> 7192 7193 * tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode 7194 functions... 7195 7196 * tools/pdbgen/pdb/context.pdb: ...and added them here. 7197 7198 * app/pdb/procedural_db.c: added them to the pdb_compat hash table. 7199 7200 * libgimp/Makefile.am 7201 * libgimp/gimpbrushes.[ch]: new files with compat functions 7202 which call the gimp_context_*() functions. 7203 7204 * libgimp/gimp.h: changed accordingly. 7205 7206 * app/pdb/brushes_cmds.c 7207 * app/pdb/context_cmds.c 7208 * app/pdb/internal_procs.c 7209 * libgimp/gimpbrushes_pdb.[ch] 7210 * libgimp/gimpcontext_pdb.[ch]: regenerated. 7211 72122004-09-22 Michael Natterer <mitch@gimp.org> 7213 7214 * tools/pdbgen/Makefile.am 7215 * tools/pdbgen/groups.pl 7216 * tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group... 7217 7218 * tools/pdbgen/pdb/context.pdb: and added its functions to the 7219 "Context" namespace instead. 7220 7221 * app/pdb/Makefile.am 7222 * app/pdb/palette_cmds.c: removed. 7223 7224 * app/pdb/procedural_db.c: added them to the pdb_compat hash table. 7225 7226 * libgimp/Makefile.am 7227 * libgimp/gimppalette_pdb.[ch]: removed. 7228 7229 * libgimp/gimppalette.[ch]: new files holding compat functions 7230 which call gimp_context_*() functions. 7231 7232 * libgimp/gimp.h 7233 * libgimp/gimpui.c: changed accordingly. 7234 7235 * app/pdb/context_cmds.c 7236 * app/pdb/internal_procs.c 7237 * libgimp/gimp_pdb.h 7238 * libgimp/gimpcontext_pdb.[ch]: regenerated. 7239 7240 * plug-ins/MapObject/mapobject_image.c 7241 * plug-ins/MapObject/mapobject_preview.c 7242 * plug-ins/common/apply_lens.c 7243 * plug-ins/common/blinds.c 7244 * plug-ins/common/borderaverage.c 7245 * plug-ins/common/checkerboard.c 7246 * plug-ins/common/colortoalpha.c 7247 * plug-ins/common/cubism.c 7248 * plug-ins/common/exchange.c 7249 * plug-ins/common/film.c 7250 * plug-ins/common/gif.c 7251 * plug-ins/common/grid.c 7252 * plug-ins/common/mapcolor.c 7253 * plug-ins/common/mblur.c 7254 * plug-ins/common/mng.c 7255 * plug-ins/common/mosaic.c 7256 * plug-ins/common/papertile.c 7257 * plug-ins/common/png.c 7258 * plug-ins/common/polar.c 7259 * plug-ins/common/semiflatten.c 7260 * plug-ins/common/sinus.c 7261 * plug-ins/common/sparkle.c 7262 * plug-ins/common/vpropagate.c 7263 * plug-ins/common/warp.c 7264 * plug-ins/common/whirlpinch.c 7265 * plug-ins/gfig/gfig-style.c 7266 * plug-ins/gfli/gfli.c 7267 * plug-ins/ifscompose/ifscompose.c 7268 * plug-ins/maze/handy.c 7269 * plug-ins/pagecurl/pagecurl.c 7270 * plug-ins/pygimp/gimpmodule.c 7271 * plug-ins/script-fu/scripts/*.scm: changed accordingly. 7272 72732004-09-22 Sven Neumann <sven@gimp.org> 7274 7275 * app/actions/view-actions.c (view_zoom_actions): mark menu label 7276 as translatable (bug #153456). 7277 72782004-09-22 Sven Neumann <sven@gimp.org> 7279 7280 * plug-ins/script-fu/siod-wrapper.c 7281 * plug-ins/script-fu/scripts/mkbrush.scm 7282 * plug-ins/script-fu/scripts/select-to-brush.scm 7283 * plug-ins/script-fu/scripts/select-to-pattern.scm: applied a 7284 patch from Kevin Cozens that adds constants for the directory 7285 names exposed by libgimpbase. Fixes bug #153327. 7286 72872004-09-22 Sven Neumann <sven@gimp.org> 7288 7289 Converted the first bunch of Script-Fu to the new context API: 7290 7291 * plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context. 7292 Removed code that used to restore the context values changed by 7293 the scripts. 7294 72952004-09-22 Michael Natterer <mitch@gimp.org> 7296 7297 * app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init): 7298 removed assertion about proc_rec != NULL because that happens 7299 when query()ing and init()int plug-ins. 7300 7301 Replaced "context" by "main_context" plus "context_stack". 7302 7303 * app/plug-in/plug-in-context.c: implement plug_in_context_push() 7304 and plug_in_context_pop(). 7305 7306 * app/plug-in/plug-in-message.c 7307 * app/plug-in/plug-in-progress.c: changed accordingly. 7308 7309 * tools/pdbgen/pdb/context.pdb: use the return values of 7310 plug_in_context_push() and _pop(). 7311 7312 * app/pdb/context_cmds.c: regenerated. 7313 7314 * plug-ins/script-fu/scripts/test-sphere.scm: use 7315 gimp-context-push and gimp-context-pop instead of remembering the 7316 old values for FG, BG etc. 7317 73182004-09-22 Sven Neumann <sven@gimp.org> 7319 7320 * tools/pdbgen/Makefile.am 7321 * tools/pdbgen/pdb/context.pdb: new files that will hold context 7322 related PDB functions. 7323 7324 * tools/pdbgen/groups.pl 7325 * app/pdb/Makefile.am 7326 * app/pdb/context_cmds.c 7327 * app/pdb/internal_procs.c 7328 * app/pdb/progress_cmds.c 7329 * libgimp/gimp_pdb.h 7330 * libgimp/gimpcontext_pdb.[ch]: (re)generated. 7331 7332 * app/plug-in/Makefile.am 7333 * app/plug-in/plug-in-context.[ch]: new files that will hold code 7334 that implements a context stack in the plug-in's proc-frame. 7335 7336 * app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame(). 7337 7338 * app/plug-in/plug-in-message.c 7339 * app/plug-in/plug-in-progress.c: use the new function instead of 7340 duplicating it all over the place. 7341 73422004-09-22 Michael Natterer <mitch@gimp.org> 7343 7344 * app/plug-in/Makefile.am 7345 * app/plug-in/plug-in-proc.[ch]: removed... 7346 * app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name. 7347 7348 * app/plug-in/plug-in-def.[ch] 7349 * app/plug-in/plug-in-message.[ch] 7350 * app/plug-in/plug-in-progress.[ch] 7351 * app/plug-in/plug-in-rc.[ch] 7352 * app/plug-in/plug-in-run.[ch] 7353 * app/plug-in/plug-in.[ch] 7354 * app/plug-in/plug-ins.[ch] 7355 * app/actions/plug-in-actions.c 7356 * app/actions/plug-in-commands.c 7357 * app/file/file-open.[ch] 7358 * app/file/file-save.[ch] 7359 * app/file/file-utils.[ch] 7360 * app/gui/gui-vtable.c 7361 * app/menus/plug-in-menus.c 7362 * app/widgets/gimpfiledialog.c 7363 * app/widgets/gimpfileprocview.c 7364 * app/widgets/gimppluginaction.c 7365 * app/xcf/xcf.c 7366 * tools/pdbgen/pdb/fileops.pdb 7367 * tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some 7368 minor cosmetic cleanups. 7369 7370 * app/pdb/fileops_cmds.c 7371 * app/pdb/plug_in_cmds.c: regenerated. 7372 73732004-09-22 Michael Natterer <mitch@gimp.org> 7374 7375 * app/widgets/gimplayertreeview.c 7376 (gimp_layer_tree_view_floating_selection_changed): removed the 7377 hack that was displaying "Floating Selection" instead of the 7378 floating layer's real name. 7379 7380 * app/core/gimplayer.c: implement GimpViewable::get_description() 7381 instead and special case floating selections with a two-line 7382 text that contains "Floating Selection". 7383 7384 * app/core/gimplayer-floating-sel.c 7385 * app/core/gimpimage-undo-push.c: emit "name_changed" on the layer 7386 when it changes its state from floating to normal or vice versa 7387 so the views can update accordingly. 7388 7389 * app/core/gimpselection.c: s/"Selection"/"Floated Layer"/. 7390 7391 * app/tools/gimpeditselectiontool.c: 7392 s/"Floating Layer"/"Floating Selection"/. 7393 73942004-09-22 Michael Natterer <mitch@gimp.org> 7395 7396 * app/plug-in/Makefile.am 7397 * app/plug-in/plug-in-proc-frame.[ch]: new files containing 7398 utility functions for initializing/freeing PlugInProcFrames. 7399 Added the progress stuff to the proc_frame. 7400 7401 * app/plug-in/plug-in.[ch]: removed the progress stuff from the 7402 PlugIn struct and use the new proc_frame utility functions. 7403 7404 * app/plug-in/plug-in-message.c 7405 * app/plug-in/plug-in-progress.c 7406 * app/plug-in/plug-in-run.c: changed accordingly. 7407 74082004-09-22 Michael Natterer <mitch@gimp.org> 7409 7410 Prepare for enabling private contexts for plug-ins and scripts: 7411 7412 * app/plug-in/plug-in.[ch]: removed the "context" member from 7413 the PlugIn struct and added it to PlugInProcFrame instead. 7414 7415 * app/plug-in/plug-in-message.c 7416 * app/plug-in/plug-in-progress.c 7417 * app/plug-in/plug-in-run.c: changed accordingly. 7418 74192004-09-22 Sven Neumann <sven@gimp.org> 7420 7421 * plug-ins/common/bumpmap.c: moved the preview to the left. 7422 74232004-09-22 Michael Natterer <mitch@gimp.org> 7424 7425 * app/plug-in/plug-in-types.h 7426 * app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which 7427 contains the ProcRecord, the proc's GMainLoop and its return 7428 values. 7429 7430 Use the same struct for the plug-in's main proc and its 7431 temp_procs, so we finally have one set of return values per call 7432 frame, and not just one per plug-in. 7433 7434 Added plug_in_proc_frame_push()/pop() and changed 7435 plug_in_main_loop[_quit]() accordingly. 7436 7437 * app/plug-in/plug-in-message.c 7438 * app/plug-in/plug-in-progress.c 7439 * app/plug-in/plug-in-run.c: changed accordingly. 7440 74412004-09-22 Sven Neumann <sven@gimp.org> 7442 7443 * app/text/gimptextlayout.c (gimp_text_get_pango_context): 7444 workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug 7445 #148997). Based on a patch by Robert Ögren. 7446 74472004-09-22 Sven Neumann <sven@gimp.org> 7448 7449 * app/widgets/gimpviewabledialog.c: removed the prelit event box 7450 from the header frame, use a smaller font for the subtitle, 7451 removed the separator. 7452 7453 * app/dialogs/preferences-dialog.c: removed the prelit event box 7454 from the header frame. Perhaps we should have subtitles here with 7455 a more verbose description of the settings page? 7456 74572004-09-21 Michael Natterer <mitch@gimp.org> 7458 7459 * app/actions/file-actions.c (file_actions): resolved conflicting 7460 mnemonics. 7461 74622004-09-21 Sven Neumann <sven@gimp.org> 7463 7464 * data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png 7465 to gimp-splash.png. 7466 7467 * data/images/gimp-splash.png: new splash, courtesy of Dave Neary. 7468 7469 * app/gui/splash.c: look for gimp-splash.png in the users 7470 directory, then in the systemwide images directory. 7471 74722004-09-21 Sven Neumann <sven@gimp.org> 7473 7474 * plug-ins/script-fu/script-fu-server.c: got rid of two the global 7475 file descriptor sets. Use the client hash-table instead. 7476 74772004-09-21 Sven Neumann <sven@gimp.org> 7478 7479 * plug-ins/script-fu/script-fu-server.c: enabled build of the 7480 Script-Fu server for the Win32 platform using the winsock API. 7481 7482 * plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32. 7483 7484 * plug-ins/script-fu/script-fu-console.c 7485 * plug-ins/script-fu/script-fu.c 7486 * plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code 7487 that isn't needed any longer. 7488 74892004-09-21 Michael Natterer <mitch@gimp.org> 7490 7491 For the sake of completeness, added a GUI for the hidden 7492 "Open as Layer" feature: 7493 7494 * app/actions/file-actions.c 7495 * app/actions/file-commands.[ch]: added "file-open-as-layer" 7496 action and callback. Abuse the "gimage" field of GimpFileDialog to 7497 indicate layer opening (it's otherwise unused for file-open). 7498 7499 * app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL, 7500 open the selected files as layers for that image. 7501 7502 * app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER. 7503 7504 * menus/image-menu.xml.in: added it to the menu. 7505 75062004-09-21 Sven Neumann <sven@gimp.org> 7507 7508 * plug-ins/common/jpeg.c (save_dialog): let the dialog collapse 7509 with the expander by making it not resizable. 7510 75112004-09-21 Sven Neumann <sven@gimp.org> 7512 7513 * app/display/gimpdisplayshell-close.c 7514 (gimp_display_shell_close_dialog): resolved a mnemonics collision. 7515 75162004-09-21 Dave Neary <bolsh@gimp.org> 7517 7518 * plug-ins/common/psd.c: Correctly set overlay, hard light and 7519 soft light modes from .psd files. Fixes bug #153229. 7520 75212004-09-21 Sven Neumann <sven@gimp.org> 7522 7523 * plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as 7524 a workaround for bug #143300. 7525 75262004-09-20 Maurits Rijk <m.rijk@chello.nl> 7527 7528 * plug-ins/imagemap/imap_cmd_guides.c 7529 * plug-ins/imagemap/imap_default_dialog.c 7530 * plug-ins/imagemap/imap_menu.c 7531 * plug-ins/imagemap/imap_preferences.c 7532 * plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't 7533 fully work yet. Bug #136713 now becomes an enhancement request. 7534 75352004-09-20 Sven Neumann <sven@gimp.org> 7536 7537 * plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate 7538 for darkening" by default, some minor cleanups. 7539 75402004-09-20 Michael Natterer <mitch@gimp.org> 7541 7542 * app/dialogs/dialogs-constructors.c: removed useless #includes. 7543 75442004-09-20 Michael Natterer <mitch@gimp.org> 7545 7546 * app/actions/buffers-commands.c 7547 * app/actions/file-commands.c 7548 * app/actions/layers-commands.c 7549 * app/actions/plug-in-actions.c 7550 * app/actions/tools-actions.c: removed useless #includes, cleanup. 7551 75522004-09-20 Michael Natterer <mitch@gimp.org> 7553 7554 * app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory 7555 parameter and removed inclusion on "menus/menus.h". 7556 7557 * app/menus/menus.[ch] (menus_init): added GimpActionFactory 7558 parameter and removed inclusion of "actions/actions.h". 7559 7560 * app/gui/gui.c (gui_restore_callback): pass the factories to the 7561 above functions. 7562 75632004-09-20 Sven Neumann <sven@gimp.org> 7564 7565 * configure.in: bumped version number to 2.1.6. 7566 75672004-09-20 DindinX <dindinx@gimp.org> 7568 7569 * plug-ins/common/deinterlace.c: added a preview. Not sure if it is 7570 really useful... 7571 75722004-09-20 DindinX <dindinx@gimp.org> 7573 7574 * plug-ins/common/shift.c: added a preview. 7575 75762004-09-20 Michael Natterer <mitch@gimp.org> 7577 7578 * libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events): 7579 removed "case GDK_CONFIGURE" because it's not needed and did 7580 "break" instead of "return FALSE", causing random color changes 7581 when resizing and initially showing the widget. 7582 75832004-09-20 Sven Neumann <sven@gimp.org> 7584 7585 * Made 2.1.5 release. 7586 75872004-09-20 Michael Natterer <mitch@gimp.org> 7588 7589 * app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks. 7590 7591 (gimp_2_1_LDADD) 7592 (gimp_console_2_1_LDADD): reordered .a files correctly. The core 7593 seems to be cleaned up enough to have proper dependencies now. 7594 75952004-09-20 Michael Natterer <mitch@gimp.org> 7596 7597 * app/actions/channels-commands.c 7598 * app/actions/vectors-commands.c: removed massive code duplication 7599 by factoring out the code that creates the "New Channel/Path" and 7600 "Edit Channel/Path Attributes" dialogs out to utility functions. 7601 GUI spacing and Code cleanup. 7602 7603 * app/actions/layers-commands.c: minor GUI spacing and code 7604 cleanup. 7605 76062004-09-19 Sven Neumann <sven@gimp.org> 7607 7608 * app/base/tile-manager.c (tile_manager_get_memsize): count valid 7609 tiles, not dirty ones. 7610 76112004-09-19 Sven Neumann <sven@gimp.org> 7612 7613 * plug-ins/common/bumpmap.c: some tweaks to the dialog layout. 7614 76152004-09-19 Michael Natterer <mitch@gimp.org> 7616 7617 * app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a 7618 GtkRadioAction callback but behaved like a GtkToggleAction 7619 callback. Fixes bug #152948. 7620 76212004-09-19 DindinX <dindinx@gimp.org> 7622 7623 * plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a 7624 very complicated homemade preview. Many small changes in the code 7625 too, and some cleanups. I hope I didn't break anything. 7626 76272004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 7628 7629 * app/tools/gimppaintoptions-gui.c: clean up ugliness introduced 7630 by my previous commit -- no functional change. 7631 76322004-09-19 Sven Neumann <sven@gimp.org> 7633 7634 Improved undo memory calculation for paint operations (bug #153035): 7635 7636 * app/base/tile-manager.[ch] (tile_manager_get_memsize): added a 7637 "gboolean sparse" parameter to get more accurate results for 7638 sparse tile-managers. 7639 7640 * app/core/gimpbuffer.c 7641 * app/core/gimpdrawable.c 7642 * app/core/gimpimage-undo-push.c 7643 * app/core/gimpimage.c 7644 * app/core/gimplayer.c 7645 * app/core/gimpprojection.c: changed accordingly. 7646 76472004-09-19 Sven Neumann <sven@gimp.org> 7648 7649 * app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h. 7650 76512004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 7652 7653 * app/tools/gimppaintoptions-gui.c: rearrange tool options as 7654 described in bug #153014. 7655 76562004-09-19 Sven Neumann <sven@gimp.org> 7657 7658 * app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed 7659 handling of too many error messages. 7660 76612004-09-19 Sven Neumann <sven@gimp.org> 7662 7663 Try to make floating selections more obvious: 7664 7665 * app/widgets/gimplayertreeview.c 7666 (gimp_layer_tree_view_floating_selection_changed): always display 7667 "Floating Selection" as the name for a floating selection. 7668 7669 * app/core/gimpselection.c (gimp_selection_float): call the new 7670 layer "Selection" instead of "Floating Selection". This is what 7671 will be displayed if the FS is turned into a layer. 7672 7673 * app/actions/layers-commands.c (layers_edit_layer_query): don't 7674 special case floating selections here. 7675 7676 * app/core/gimplayer-floating-sel.c: cosmetics. 7677 76782004-09-19 Sven Neumann <sven@gimp.org> 7679 7680 * plug-ins/common/postscript.c (ps_open): applied a patch by Peter 7681 Kirchgessner that solves a problem with the recognition of the 7682 bounding box. Fixes bug #152829. 7683 76842004-09-19 Sven Neumann <sven@gimp.org> 7685 7686 * libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc 7687 comment. 7688 76892004-09-18 Simon Budig <simon@gimp.org> 7690 7691 * libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0, 7692 so that the entry accepts hex colors starting with "#" again. 7693 Untabbified. 7694 76952004-09-18 Manish Singh <yosh@gimp.org> 7696 7697 * app/Makefile.am: remove LDFLAGS references to now private 7698 file_open_dialog_show, file_open_location_dialog_show, and 7699 file_save_dialog_show. 7700 77012004-09-18 Sven Neumann <sven@gimp.org> 7702 7703 * app/actions/qmask-commands.c 7704 * libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup. 7705 7706 * app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always 7707 set gimage->qmask_color regardless of the qmask state. 7708 7709 * libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set 7710 the type before setting the color. 7711 77122004-09-17 Michael Natterer <mitch@gimp.org> 7713 7714 * app/widgets/gimpcomponenteditor.c 7715 (gimp_component_editor_renderer_update): use 7716 gimp_component_editor_get_iter() instead of duplicating its code. 7717 77182004-09-17 Simon Budig <simon@gimp.org> 7719 7720 * app/widgets/gimpbrusheditor.[ch]: Added a slider for the 7721 brush spacing to the brush editor. Should make it more obvious 7722 how to change it. 7723 77242004-09-17 Sven Neumann <sven@gimp.org> 7725 7726 * app/core/gimp-edit.c (gimp_edit_paste): based on a patch from 7727 Joao S. O. Bueno: Ensure that the pasted layer is always within 7728 the image, if it fits and aligned at top left if it doesn't. 7729 Fixes bug #142944. 7730 77312004-09-16 Sven Neumann <sven@gimp.org> 7732 7733 * INSTALL: updated. 7734 77352004-09-16 Sven Neumann <sven@gimp.org> 7736 7737 * libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic): 7738 applied a patch by Joao S. O. Bueno that fixes bug #152820. 7739 77402004-09-16 Dave Neary <bolsh@gimp.org> 7741 7742 * plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin 7743 Cozens which reinstates corona. Fixes bug #142282. 7744 77452004-09-16 Michael Natterer <mitch@gimp.org> 7746 7747 * configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4. 7748 7749 * app/gui/gui.c: changed accordingly. 7750 7751 * app/sanity.c: ditto. Added check for GLib and put each check 7752 into its own utility function. Enabled #if 0'ed check for 7753 FreeType >= 6.2.7. 7754 7755 * app/widgets/gimpactiongroup.c 7756 * app/widgets/gimpcursor.c 7757 * app/widgets/gimpselectiondata.c 7758 * app/widgets/gimpuimanager.c 7759 * app/widgets/gimpwidgets-utils.c: removed workarounds for library 7760 versions we refuse to start with. 7761 77622004-09-16 Michael Natterer <mitch@gimp.org> 7763 7764 * app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse 7765 order of DND dests so "text/uri-list" is preferred again after my 7766 DND change of 2004-06-29. Fixes dropping of multiple files. 7767 77682004-09-16 Michael Natterer <mitch@gimp.org> 7769 7770 * app/widgets/gimpcomponenteditor.[ch]: set the viewable 7771 renderer's "renderer" property to NULL when clearing the 7772 view to work around bug #149906. 7773 77742004-09-16 Sven Neumann <sven@gimp.org> 7775 7776 * app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift 7777 with a binary and. Should be unnoticeably faster ;) 7778 77792004-09-16 Michael Natterer <mitch@gimp.org> 7780 7781 * app/pdb/procedural_db.c: removed #if 0'ed code, took assignments 7782 out of if()-conditions, minor cleanup. 7783 77842004-09-16 Simon Budig <simon@gimp.org> 7785 7786 * app/core/gimpscanconvert.c: Implemented an own rendering 7787 callback for libart and use it instead of art_gray_svp_aa(). 7788 This now handles non-antialiased scan conversions itself. It 7789 also basically shows the way to implement a LUT for the 7790 scan conversion. 7791 77922004-09-16 Sven Neumann <sven@gimp.org> 7793 7794 * app/dialogs/quit-dialog.c: removed code that isn't needed any 7795 longer now that the dialog is a singleton. 7796 77972004-09-15 DindinX <david@dindinx.org> 7798 7799 * plug-ins/common/mblur.c: fix the preview for the zoom blur mode. 7800 78012004-09-15 Sven Neumann <sven@gimp.org> 7802 7803 * libgimpwidgets/gimppreviewarea.c 7804 (gimp_preview_area_[draw|blend|mask]): fixed code that handles 7805 drawing outside of the preview area. 7806 7807 * plug-ins/common/unsharp.c (preview_update): draw the preview 7808 directly from the pixel region. 7809 78102004-09-15 Manish Singh <yosh@gimp.org> 7811 7812 * modules/controller_linux_input.c: use guint16 instead of __u16. 7813 Should fix bug #152746. 7814 78152004-09-15 Sven Neumann <sven@gimp.org> 7816 7817 * libgimp/gimpdrawablepreview.[ch] 7818 * libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to 7819 gimp_drawable_preview_draw_buffer() and added a rowstride 7820 parameter. Added new functions gimp_drawable_preview_get_drawable() 7821 and gimp_drawable_preview_draw_region(). 7822 7823 * plug-ins/common/mblur.c: added a preview that uses the 7824 shadow tiles as the preview buffer and draws using the new 7825 gimp_drawable_preview_draw_region() API. 7826 7827 * plug-ins/common/photocopy.c 7828 * plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region(). 7829 7830 * plug-ins/common/cartoon.c 7831 * plug-ins/common/despeckle.c 7832 * plug-ins/common/edge.c 7833 * plug-ins/common/gauss.c 7834 * plug-ins/common/grid.c 7835 * plug-ins/common/neon.c 7836 * plug-ins/common/noisify.c 7837 * plug-ins/common/sel_gauss.c 7838 * plug-ins/common/sharpen.c 7839 * plug-ins/common/sobel.c 7840 * plug-ins/common/spread.c 7841 * plug-ins/common/struc.c 7842 * plug-ins/common/unsharp.c 7843 * plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer(). 7844 78452004-09-15 Michael Natterer <mitch@gimp.org> 7846 7847 * app/widgets/gimphelp-ids.h: added help IDs for the drawable- and 7848 vectors-visible and -liked actions as well as for the layer mask 7849 property action. 7850 7851 * app/actions/drawable-actions.c 7852 * app/actions/vectors-actions.c: use them. 7853 7854 * app/actions/layers-actions.c 7855 * app/actions/layers-commands.[ch]: ditto. Use 7856 GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced 7857 "paint_mode" by "mode" in all action and function/variable names 7858 because this is the layer mode, not a paint mode. 7859 7860 * app/actions/channels-commands.c 7861 * app/actions/layers-commands.c 7862 * app/actions/vectors-commands.c: set the "activates-default" 7863 property on the name entry in all "New Foo" and "Edit Foo 7864 Attributes" dialogs except in the "New Layer" dialog. 7865 Addresses bug #148026. 7866 7867 * menus/image-menu.xml.in: added a (commented out) layer 7868 properties menu containing all the new actions. 7869 78702004-09-15 Michael Natterer <mitch@gimp.org> 7871 7872 * app/actions/layers-actions.c 7873 * app/actions/layers-commands.[ch]: added actions and callbacks 7874 "layers-preserve-transparency" and 7875 "layers-paint-mode-first,last,previous,next". Update the "active" 7876 state of the recently added layer mask property actions in 7877 layers_actions_update(). 7878 7879 * app/actions/drawable-actions.c 7880 * app/actions/drawable-commands.[ch]: added actions and callbacks 7881 for "drawable-visible" and "drawable-linked". Fixes bug #152597. 7882 7883 * app/actions/vectors-actions.c 7884 * app/actions/vectors-commands.[ch]: same here ("vectors-visible" 7885 and "vectors-linked"). 7886 7887 * app/widgets/gimplayertreeview.c 7888 (gimp_layer_tree_view_preserve_button_toggled): flush the image 7889 so the new actions are updated. Compress preserve_trans undos. 7890 7891 * menus/image-menu.xml.in: added the layer mask property actions 7892 to the Layers/Mask submenu. 7893 7894 * menus/layers-menu.xml: reordered the mask property actions 7895 to have the same order as in the image menu. 7896 78972004-09-15 Sven Neumann <sven@gimp.org> 7898 7899 * app/widgets/gimpcontainertreeview.c 7900 (gimp_container_tree_view_menu_position): improved the fix for bug 7901 #152662 and removed trailing whitespace. 7902 79032004-09-15 Nathan Summers <rock@gimp.org> 7904 7905 * app/widgets/gimpcontainertreeview.c 7906 (gimp_container_tree_view_menu_position): clamp the popup menu's Y 7907 position to the visible area of the GtkTreeView. Fixes #152662. 7908 79092004-09-14 Michael Natterer <mitch@gimp.org> 7910 7911 * libgimpwidgets/gimpquerybox.c: set the "activates-default" 7912 property on the entries in all query boxes so hitting "return" 7913 confirms them. Addresses bug #148026. 7914 79152004-09-14 Michael Natterer <mitch@gimp.org> 7916 7917 * app/widgets/gimpbufferview.c: simplified the code which deals 7918 with the global_buffer's preview. The new buffer view renderer 7919 does the aspect ratio magic all by itself now. 7920 7921 * app/actions/image-commands.h: removed trailing whitespace. 7922 79232004-09-14 Michael Natterer <mitch@gimp.org> 7924 7925 * app/widgets/Makefile.am 7926 * app/widgets/widgets-types.h 7927 * app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer 7928 which knows how to preserve a GimpBuffer's aspect ratio if the 7929 view's aspect ratio is different. 7930 7931 * app/widgets/gimpviewrenderer-utils.c 7932 (gimp_view_renderer_type_from_viewable_type): use it for viewables 7933 of type GimpBuffer. Fixes bug #152531 7934 79352004-09-14 Sven Neumann <sven@gimp.org> 7936 7937 * plug-ins/common/flarefx.c 7938 * plug-ins/common/nova.c: embed the preview into a sunken frame 7939 and put it into the upper left corner of the dialog. 7940 79412004-09-14 Sven Neumann <sven@gimp.org> 7942 7943 * app/dialogs/dialogs-constructors.[ch] 7944 * app/dialogs/dialogs.c 7945 * app/gui/gui.c: let the dialog factory handle the quit dialog 7946 as singleton. Fixes bug #151914. 7947 7948 * app/dialogs/quit-dialog.c: added a warning here. We need a 7949 container of dirty images for the above change to work correctly. 7950 79512004-09-13 Sven Neumann <sven@gimp.org> 7952 7953 * plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data" 7954 toggle insensitive when no EXIF data is present (bug #140042). 7955 7956 * app/display/gimpdisplayshell-close.c: as suggested by the HIG, 7957 ask the user to save the image when the last display is being 7958 closed. Addresses some issues raised in bug #106726. 7959 79602004-09-13 Michael Natterer <mitch@gimp.org> 7961 7962 * app/app_procs.c (app_run): install the message handler for the 7963 "Gimp-Dialogs" domain. 7964 79652004-09-13 Michael Natterer <mitch@gimp.org> 7966 7967 * app/actions/file-commands.c: resurrected file_open_dialog_show() 7968 and file_save_dialog_show() as private utility functions to get 7969 rid of code duplication. 7970 79712004-09-13 Michael Natterer <mitch@gimp.org> 7972 7973 Manage the file-save dialog using the dialog factory and stop 7974 making menu items insensitive while it is open. Fixes bug #81407. 7975 7976 * app/dialogs/Makefile.am 7977 * app/dialogs/file-dialog-utils.[ch]: removed these files. 7978 7979 * app/dialogs/file-save-dialog.[ch]: removed functions 7980 file_save_dialog_show() and file_save_a_copy_dialog_show() and 7981 changed internal function file_save_dialog_create() to 7982 file_save_dialog_new(). 7983 7984 * app/dialogs/dialogs.c 7985 * app/dialogs/dialogs-constructors.[ch]: made it completely 7986 managed by the dialog factory. 7987 7988 * app/actions/file-commands.c: create it using the dialog 7989 factory. Attach it to the image so we open only one save 7990 dialog per image. 7991 7992 * app/dialogs/file-open-dialog.c: added precondition checks 7993 to file_open_dialog_new(). 7994 79952004-09-13 Sven Neumann <sven@gimp.org> 7996 7997 * plug-ins/common/jpeg.c: some code cleanup. 7998 79992004-09-13 Michael Natterer <mitch@gimp.org> 8000 8001 * app/dialogs/file-open-dialog.[ch]: removed function 8002 file_open_dialog_show() and changed internal function 8003 file_open_dialog_create() to file_open_dialog_new(). 8004 8005 * app/dialogs/dialogs.c 8006 * app/dialogs/dialogs-constructors.[ch]: made it completely 8007 managed by the dialog factory. 8008 8009 * app/actions/file-commands.c: create it using the dialog factory. 8010 80112004-09-13 Michael Natterer <mitch@gimp.org> 8012 8013 * configure.in 8014 * app/Makefile.am: added new directory app/dialogs and link 8015 libappdialogs.c into the gimp binary. 8016 8017 * app/gui/Makefile.am 8018 * app/gui/gui-types.h 8019 * app/gui/gui-vtable.c 8020 * app/gui/gui.c 8021 8022 * app/gui/about-dialog.[ch] 8023 * app/gui/authors.h 8024 * app/gui/color-notebook.[ch] 8025 * app/gui/convert-dialog.[ch] 8026 * app/gui/dialogs-constructors.[ch] 8027 * app/gui/dialogs.[ch] 8028 * app/gui/file-dialog-utils.[ch] 8029 * app/gui/file-new-dialog.[ch] 8030 * app/gui/file-open-dialog.[ch] 8031 * app/gui/file-open-location-dialog.[ch] 8032 * app/gui/file-save-dialog.[ch] 8033 * app/gui/grid-dialog.[ch] 8034 * app/gui/info-dialog.[ch] 8035 * app/gui/info-window.[ch] 8036 * app/gui/module-browser.[ch] 8037 * app/gui/offset-dialog.[ch] 8038 * app/gui/palette-import-dialog.[ch] 8039 * app/gui/preferences-dialog.[ch] 8040 * app/gui/quit-dialog.[ch] 8041 * app/gui/resize-dialog.[ch] 8042 * app/gui/resolution-calibrate-dialog.[ch] 8043 * app/gui/stroke-dialog.[ch] 8044 * app/gui/tips-dialog.[ch] 8045 * app/gui/tips-parser.[ch] 8046 * app/gui/user-install-dialog.[ch]: removed these files... 8047 8048 * app/dialogs/Makefile.am 8049 * app/dialogs/dialogs-types.h 8050 8051 * app/dialogs/*.[ch]: ...and added them here. Changed some 8052 filenames like module-browser -> module-dialog. 8053 8054 * app/app_procs.c 8055 * app/actions/actions-types.h 8056 * app/actions/actions.c 8057 * app/actions/dialogs-actions.c 8058 * app/actions/dialogs-commands.c 8059 * app/actions/dockable-commands.c 8060 * app/actions/drawable-commands.c 8061 * app/actions/edit-commands.c 8062 * app/actions/file-commands.c 8063 * app/actions/gradient-editor-commands.c 8064 * app/actions/image-commands.c 8065 * app/actions/layers-commands.c 8066 * app/actions/palettes-commands.c 8067 * app/actions/select-commands.c 8068 * app/actions/templates-commands.c 8069 * app/actions/templates-commands.h 8070 * app/actions/vectors-commands.c 8071 * app/actions/view-commands.c 8072 * app/display/gimpdisplayshell-cursor.c 8073 * app/display/gimpdisplayshell-title.c 8074 * app/display/gimpdisplayshell.[ch] 8075 * app/tools/gimpcroptool.c 8076 * app/tools/gimpperspectivetool.c 8077 * app/tools/gimprotatetool.c 8078 * app/tools/gimpscaletool.c 8079 * app/tools/gimpsheartool.c 8080 * app/tools/gimptransformtool.[ch] 8081 * app/tools/gimpvectortool.c 8082 * app/widgets/gimpcolormapeditor.[ch] 8083 * app/widgets/gimpcolorpanel.c 8084 * app/widgets/gimpgradienteditor.[ch] 8085 * app/widgets/gimppaletteeditor.[ch] 8086 * app/widgets/gimptoolbox-color-area.c 8087 * menus/toolbox-menu.xml.in 8088 * tools/authorsgen/authorsgen.pl: changed accordingly. 8089 80902004-09-13 Michael Natterer <mitch@gimp.org> 8091 8092 Restore binary compatibility of the wire protocol that was 8093 broken by the recent GPConfig changes: 8094 8095 * libgimpbase/gimpprotocol.[ch] (struct _GPConfig) 8096 (_gp_config_read) 8097 (_gp_config_write): argh, we can't use the two bytes padding 8098 because that's just a binary compatible struct change, but inserts 8099 two bytes into the byte stream that goes over the wire. Use the 8100 first two bytes of the former "gdouble gamma" instead. 8101 8102 * app/plug-in/plug-in-run.c (plug_in_run) 8103 * libgimp/gimp.c (gimp_config): changed accordingly. 8104 81052004-09-13 Sven Neumann <sven@gimp.org> 8106 8107 * app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and 8108 look at the LANGUAGE environment variable if the locale is not "C". 8109 81102004-09-13 Simon Budig <simon@gimp.org> 8111 8112 * app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me. 8113 /me hides embarrassed in a corner... :) 8114 81152004-09-13 Simon Budig <simon@gimp.org> 8116 8117 * app/tools/gimpcroptool.c: Fix warnings and coding style. 8118 81192004-09-12 Nathan Summers <rock@gimp.org> 8120 8121 * app/tools/gimpcroptool.c: disable crop and resize buttons while the 8122 operation is being processed. Fixes #152372. 8123 81242004-09-12 Sven Neumann <sven@gimp.org> 8125 8126 * plug-ins/common/aa.c (aa_dialog): use a combo box for format 8127 selection. 8128 81292004-09-12 Sven Neumann <sven@gimp.org> 8130 8131 * libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing 8132 whitespace. 8133 81342004-09-12 DindinX <david@dindinx.org> 8135 8136 * libgimp/gimppixelrgn.c: some more fixes by nomis. 8137 81382004-09-12 DindinX <david@dindinx.org> 8139 8140 * libgimp/gimppixelrgn.c: nomis helped me to make some correction to 8141 the documentation. 8142 81432004-09-12 DindinX <david@dindinx.org> 8144 8145 * libgimp/gimppixelrgn.c: more documentation. 8146 81472004-09-11 DindinX <david@dindinx.org> 8148 8149 * plug-ins/common/edge.c: added a default value (TRUE) for the 8150 update_preview toggle. 8151 8152 * plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is 8153 much more useful now. 8154 81552004-09-11 DindinX <david@dindinx.org> 8156 8157 * libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel 8158 region related functions. (work in progress) 8159 81602004-09-11 Simon Budig <simon@gimp.org> 8161 8162 * app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to 8163 gimp_dialog_factories_toggle to make it possible to ensure a visible 8164 toolbox. 8165 8166 * app/actions/dialogs-commands.c: Use the new parameter to ensure 8167 toolbox visibility after the last image window closes. 8168 8169 * app/display/gimpdisplayshell-callbacks.c: Changed accordingly. 8170 8171 Fixes bug #137057 (the discussion is in bug #152285) 8172 81732004-09-11 DindinX <david@dindinx.org> 8174 8175 * plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of 8176 code and much more features! 8177 81782004-09-11 DindinX <david@dindinx.org> 8179 8180 * plug-ins/common/oilify.c: some code cleanup and small optimisations. 8181 81822004-09-10 Sven Neumann <sven@gimp.org> 8183 8184 * plug-ins/common/xpm.c (query): fixed spelling. 8185 81862004-09-10 Bill Skaggs <weskaggs@primate.ucdavis.edu> 8187 8188 * app/widgets/gimperrorconsole.c: fix typo 8189 81902004-09-10 Michael Natterer <mitch@gimp.org> 8191 8192 * libgimpwidgets/gimpcolorselect.c: untabified, removed useless 8193 inclusion of <gdk/gdkkeysyms.h>. 8194 81952004-09-10 Sven Neumann <sven@gimp.org> 8196 8197 * libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea. 8198 Destroy the GdkGC in unrealize() instead of in finalize(). 8199 82002004-09-10 Michael Natterer <mitch@gimp.org> 8201 8202 * app/widgets/gimpcontainertreeview-dnd.c 8203 (gimp_container_tree_view_drop_status): always call 8204 gdk_drag_status() before returning FALSE. 8205 8206 (gimp_container_tree_view_drag_motion): never return FALSE, an 8207 impossible drop location is now reported by calling 8208 gdk_drag_status() above. Always returning TRUE makes sure 8209 gimp_container_tree_view_drag_leave() is called unconditionally 8210 and can remove the scroll_timeout set in drag_motion(). 8211 8212 Fixes bug #152193 and many other obscure DND crashes caused by the 8213 scroll_timeout being invoked after the widget is destroyed. 8214 82152004-09-10 Sven Neumann <sven@gimp.org> 8216 8217 * plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely 8218 based on a patch attached to bug #151912. 8219 82202004-09-10 Sven Neumann <sven@gimp.org> 8221 8222 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb): 8223 also handle GRAY and GRAYA thumbnails. 8224 8225 * tools/pdbgen/pdb/drawable.pdb 8226 * tools/pdbgen/pdb/image.pdb: corrected documentation for 8227 _gimp_drawable_thumbnail() and _gimp_image_thumbnail(). 8228 8229 * app/pdb/drawable_cmds.c 8230 * app/pdb/image_cmds.c 8231 * libgimp/gimpdrawable_pdb.c 8232 * libgimp/gimpimage_pdb.c: regenerated. 8233 82342004-09-10 Sven Neumann <sven@gimp.org> 8235 8236 * libgimpwidgets/gimppreview.c: fixed positioning of the 8237 navigation marker and handling of motion events. 8238 82392004-09-10 Sven Neumann <sven@gimp.org> 8240 8241 * libgimpwidgets/gimppreview.c 8242 * libgimpwidgets/gimppreviewarea.c: documented new functions. 8243 82442004-09-09 Sven Neumann <sven@gimp.org> 8245 8246 * libgimp/gimpdrawablepreview.c 8247 * libgimpwidgets/gimppreview.[ch]: added a navigation popup 8248 similar to the one in the image window. Needs some more work. 8249 82502004-09-09 DindinX <david@dindinx.org> 8251 8252 * libgimpwidgets/gimppreviewarea.c: added a utility function 8253 gimp_preview_area_queue_draw(), which queue the right part of the 8254 preview to be redrawn. And use it in all the drawing functions. This 8255 fix a problem where the preview wasn't updated correctly after a 8256 resize. 8257 82582004-09-09 Michael Natterer <mitch@gimp.org> 8259 8260 * plug-ins/common/cartoon.c 8261 * plug-ins/common/despeckle.c 8262 * plug-ins/common/gauss.c 8263 * plug-ins/common/grid.c 8264 * plug-ins/common/neon.c 8265 * plug-ins/common/noisify.c 8266 * plug-ins/common/photocopy.c 8267 * plug-ins/common/sel_gauss.c 8268 * plug-ins/common/sharpen.c 8269 * plug-ins/common/sobel.c 8270 * plug-ins/common/softglow.c 8271 * plug-ins/common/spread.c 8272 * plug-ins/common/struc.c 8273 * plug-ins/common/unsharp.c: pack all drawable previews expanding. 8274 Also did some general cleanups like consistently naming the dialog 8275 variable "dialog" and the main vbox "main_vbox". 8276 82772004-09-09 Sven Neumann <sven@gimp.org> 8278 8279 * libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL 8280 layouts. 8281 82822004-09-09 Sven Neumann <sven@gimp.org> 8283 8284 * libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size 8285 and center the preview area if its allocation extends the maximum. 8286 8287 * libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the 8288 toggle button out of the table and put the table into an aspect 8289 frame. Added an API to set the preview boundaries. Set the maximum 8290 size of the GimpPreviewArea from that function. 8291 8292 * libgimpwidgets/gimpwidgets.def: added new entries. 8293 8294 * libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds(). 8295 8296 * plug-ins/common/gauss.c: pack the preview widget so that it 8297 resizes with the dialog. 8298 82992004-09-09 DindinX <david@dindinx.org> 8300 8301 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend) 8302 (gimp_preview_area_mask): optimized the case where both buffers have 8303 the same alpha for a given pixel. 8304 83052004-09-09 Michael Natterer <mitch@gimp.org> 8306 8307 * app/widgets/gimpviewrendererbrush.c 8308 * app/widgets/gimpviewrendererdrawable.c 8309 * app/widgets/gimpviewrenderergradient.c 8310 * app/widgets/gimpviewrendererimage.c 8311 * app/widgets/gimpviewrendererimagefile.c 8312 * app/widgets/gimpviewrendererlayer.c 8313 * app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup. 8314 83152004-09-09 Michael Natterer <mitch@gimp.org> 8316 8317 * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use 8318 g_type_name(dialog_type) instead of just "pdb dialog" as name for 8319 the dialog's private context. 8320 83212004-09-09 Michael Natterer <mitch@gimp.org> 8322 8323 * app/gui/convert-dialog.[ch] (convert_dialog_new): changed 8324 GimpDisplay* parameter to GimpProgress* because that's what it's 8325 used for. 8326 8327 * app/actions/image-commands.c (image_convert_cmd_callback): 8328 changed accordingly. 8329 8330 * app/gui/convert-dialog.c: massively cleaned up internals. Use a 8331 GimpViewableButton + GimpContainerEntry combo as in text options 8332 for selecting the custom palette. Use a filtered container which 8333 contains only palettes with a maximum of 256 colors. 8334 Fixes bug #136574 8335 83362004-09-09 Michael Natterer <mitch@gimp.org> 8337 8338 * app/gui/file-open-location-dialog.[ch]: changed 8339 file_open_location_dialog_show() to 8340 file_open_location_dialog_new() and return the dialog. 8341 8342 * app/gui/dialogs.c 8343 * app/gui/dialogs-constructors.[ch]: added a constructor for it 8344 and let the dialog factory manage it entirely. 8345 8346 * app/actions/file-commands.c 8347 (file_open_location_dialog_cmd_callback): use the dialog factory 8348 to create it. 8349 83502004-09-09 Michael Natterer <mitch@gimp.org> 8351 8352 * app/widgets/gimpdialogfactory.c 8353 (gimp_dialog_factory_dialog_new_internal): renamed parameter 8354 "gboolean raise_if_found" to "return_existing" and added 8355 additional parameter "gboolean present". 8356 8357 (gimp_dialog_factory_dialog_new) 8358 (gimp_dialog_factory_dialog_raise) 8359 (gimp_dialog_factory_dockable_new): pass both parameters (passing 8360 "present" as "raise_if_found" was not quite correct). 8361 83622004-09-08 DindinX <david@dindinx.org> 8363 8364 * libgimpwidgets/gimppreviewarea.c: fixed a stupid typo. 8365 83662004-09-08 Sven Neumann <sven@gimp.org> 8367 8368 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill): 8369 optimized solid color fills. 8370 83712004-09-08 Sven Neumann <sven@gimp.org> 8372 8373 * libgimpwidgets/gimppreviewarea.c: factored out common code. 8374 Reduced indentation level by closing a switch earlier. 8375 83762004-09-08 DindinX <david@dindinx.org> 8377 8378 * libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend) 8379 use gimp_preview_area_draw when the opacity is 0 or 255, instead of 8380 duplicating code. 8381 83822004-09-07 Sven Neumann <sven@gimp.org> 8383 8384 * libgimpwidgets/gimpwidgets.def: added new entries. 8385 8386 * libgimpwidgets/test-preview-area.c: fit output into 80 columns. 8387 8388 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some 8389 code cleanup. 8390 83912004-09-07 DindinX <david@dindinx.org> 8392 8393 * libgimpwidgets/test-preview-area.c: added some tests for 8394 gimp_preview_area_blend() and gimp_preview_area_mask(). 8395 83962004-09-07 DindinX <david@dindinx.org> 8397 8398 * libgimpwidgets/gimppreviewarea.c 8399 * libgimpwidgets/gimppreviewarea.h: added two functions: 8400 gimp_preview_area_blend() to draw the blending of two buffers with 8401 an opacity parameter, and gimp_preview_area_mask() to draw the 8402 blending of two buffers, with a mask buffer. The code still needs some 8403 polish, though. 8404 8405 * libgimp/gimpdrawablepreview.c 8406 * libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in 8407 gimp_drawable_preview_draw(), so the previews are now much more 8408 accurate (respecting the selection, if any). 8409 8410 Also made the buf parameter of gimp_drawable_preview_draw() a pointer 8411 to constants. 8412 84132004-09-07 Michael Natterer <mitch@gimp.org> 8414 8415 * app/display/gimpdisplayshell-draw.c 8416 (gimp_display_shell_draw_grid): #define the constant crosshair 8417 size for the INTERSECTION grid style instead of using an eeky 8418 "const gint". 8419 84202004-09-07 Michael Natterer <mitch@gimp.org> 8421 8422 * app/gui/dialogs.c (toplevel_entries): added a foreign entry 8423 "gimp-file-open-loaction-dialog". 8424 8425 * app/gui/file-open-location-dialog.c: register the dialog 8426 with the toplevel dialog factory so it remembers its position. 8427 84282004-09-07 Michael Natterer <mitch@gimp.org> 8429 8430 * app/actions/context-actions.c 8431 * app/actions/context-commands.[ch]: applied a heavily modified 8432 patch from David Gowers which adds actions to modify the context's 8433 paint_mode. Fixes bug #151471. 8434 8435 * menus/image-menu.xml.in: added them to the (commentd out) 8436 "Context" submenu. 8437 84382004-09-07 Michael Natterer <mitch@gimp.org> 8439 8440 * plug-ins/common/edge.c: indentation and whitespace cleanup. 8441 8442 * plug-ins/common/struc.c: minor coding style issues. 8443 84442004-09-07 Michael Natterer <mitch@gimp.org> 8445 8446 * plug-ins/common/xwd.c (query): applied patch from Alan Horkan 8447 which improves the blurb and help texts. Fixes bug #151912. 8448 8449 Unrelated: did coding style / indentation cleanup in the whole file. 8450 84512004-09-07 Michael Natterer <mitch@gimp.org> 8452 8453 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): 8454 simplified the code that selects an image file by its URI. 8455 84562004-09-07 Simon Budig <simon@gimp.org> 8457 8458 * app/widgets/gimpviewrendererbrush.c: Added an indicator for 8459 generated brushes. Pretty straightforward, suggestions for 8460 improvements are welcome. 8461 84622004-09-06 DindinX <david@dindinx.org> 8463 8464 * plug-ins/common/struc.c: added a preview. 8465 84662004-09-06 Simon Budig <simon@gimp.org> 8467 8468 * app/tools/gimpcroptool.c: reordered info_dialog_hide() and 8469 crop_tool_crop_image(), which avoids the repeated popping up 8470 of the info dialog and avoids a crash. 8471 8472 Fixes bug #151712 8473 84742004-09-05 DindinX <david@dindinx.org> 8475 8476 * plug-ins/common/cartoon.c: use gimp_preview_invalidate() where 8477 appropriate. 8478 8479 * plug-ins/common/photocopy.c: Added a preview. 8480 84812004-09-05 Sven Neumann <sven@gimp.org> 8482 8483 * configure.in: bumped version number to 2.1.5. 8484 8485 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select 8486 the image file, not only the folder it lives in. Fixes bug #151638. 8487 84882004-09-05 DindinX <david@dindinx.org> 8489 8490 * plug-ins/common/cartoon.c: Added a preview. 8491 84922004-09-05 Simon Budig <simon@gimp.org> 8493 8494 * plug-ins/common/autocrop.c: fix handling of layers with an 8495 offset. Resize the image before cropping when the covered area 8496 of a layer is partially outside the image area. Make math more 8497 comprehensible. 8498 84992004-09-05 Sven Neumann <sven@gimp.org> 8500 8501 * plug-ins/common/convmatrix.c 8502 * plug-ins/common/smooth_palette.c 8503 * plug-ins/flame/flame.c: renamed functions from doit() to 8504 something less silly. 8505 85062004-09-05 Sven Neumann <sven@gimp.org> 8507 8508 * Made 2.1.4 release. 8509 85102004-09-05 Simon Budig <simon@gimp.org> 8511 8512 * tools/pdbgen/pdb/image.pdb: improved documentation for 8513 gimp_image_resize_to_layers 8514 8515 * libgimp/gimp.def: added gimp_image_resize_to_layers 8516 8517 * app/pdb/image_cmds.c 8518 * libgimp/gimpimage_pdb.c: regenerated 8519 85202004-09-05 Simon Budig <simon@gimp.org> 8521 8522 * app/core/gimpimage-resize.[ch]: Implement function to resize 8523 the image to contain all layers completely. Untabified. 8524 8525 * app/actions/image-actions.c 8526 * app/actions/image-commands.[ch] 8527 * app/widgets/gimphelp-ids.h 8528 * menus/image-menu.xml.in: Make it available in the GUI. 8529 8530 * tools/pdbgen/pdb/image.pdb: Make it available in the PDB. 8531 8532 * app/pdb/image_cmds.c 8533 * app/pdb/internal_procs.c 8534 * libgimp/gimpimage_pdb.[ch]: regenerated. 8535 85362004-09-04 DindinX <david@dindinx.org> 8537 8538 * plug-ins/common/noisify.c: ported to GimpDrawablePreview. 8539 85402004-09-04 Michael Schumacher <schumaml@cvs.gnome.org> 8541 8542 * libgimp/gimp.def 8543 * libgimpbase/gimpbase.def 8544 * libgimpwidgets/gimpwidgets.def: added the check(erboard) related 8545 entries 8546 85472004-09-04 Sven Neumann <sven@gimp.org> 8548 8549 * libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to 8550 gimp_preview_area_menu_popup(). 8551 8552 * libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu(). 8553 85542004-09-04 DindinX <david@dindinx.org> 8555 8556 * libgimpwidgets/gimppreview.c: Changed the way we attach the preview 8557 area frame to the table so very small drawables don't cause a 8558 malicious bug. 8559 85602004-09-04 DindinX <david@dindinx.org> 8561 8562 * plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview. 8563 85642004-09-04 DindinX <david@dindinx.org> 8565 8566 * plug-ins/common/sharpen.c: ported to GimpDrawablePreview. 8567 85682004-09-03 Sven Neumann <sven@gimp.org> 8569 8570 * libgimpwidgets/gimppreviewarea.[ch]: added 8571 gimp_preview_area_menu_popup(). Not completely finished yet... 8572 8573 * libgimpwidgets/gimppreview.c: use the new function. 8574 85752004-09-03 Sven Neumann <sven@gimp.org> 8576 8577 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable): 8578 take care of setting the colormap for indexed drawables. 8579 8580 * libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with 8581 the first mouse button only. We will need the other buttons. 8582 85832004-09-03 Sven Neumann <sven@gimp.org> 8584 8585 * plug-ins/common/grid.c: ported to GimpDrawablePreview. 8586 85872004-09-03 Sven Neumann <sven@gimp.org> 8588 8589 * plug-ins/common/plasma.c (plasma_dialog): left-align the preview. 8590 8591 * plug-ins/common/grid.c (dialog): pack the preview as in other 8592 plug-in dialogs and embed it into a GtkFrame. 8593 85942004-09-03 Michael Natterer <mitch@gimp.org> 8595 8596 * app/widgets/gimpdevicestatus.c: removed "Configure input 8597 devices" button. Fixes bug #150177. 8598 85992004-09-03 Simon Budig <simon@gimp.org> 8600 8601 * app/gui/info-window.c: Applied modified patch by Kevin Cozens 8602 that implements a "Comments" tab in the image info dialog. 8603 8604 Fixes bug #151719. 8605 86062004-09-03 Sven Neumann <sven@gimp.org> 8607 8608 * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light 8609 and gray checks to get a checkerboard that matches the image window. 8610 86112004-09-03 Michael Natterer <mitch@gimp.org> 8612 8613 * libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the 8614 never used "gdouble gamma" with 8 reserved gint8 and stuffed two 8615 gint8 behind "gint8 show_tool_tips" where they fit in in a binary 8616 compatible way due to 32bit aligning of the following "gint32 8617 min_colors". Use the latter ones for "check_size" and 8618 "check_type". 8619 8620 * libgimpbase/gimpprotocol.c (_gp_config_read,write): changed 8621 accordingly to pass the new stuff over the wire. 8622 8623 * app/plug-in/plug-in-run.c: ditto. Pass the transpareny values 8624 from GimpDisplayConfig to plug-ins. 8625 8626 * libgimp/gimp.[ch] (gimp_config): remember the new config values. 8627 (gimp_check_size,type): new functions returning the new config values. 8628 8629 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init): 8630 use the new values to configure preview->area accordingly. 8631 86322004-09-03 Sven Neumann <sven@gimp.org> 8633 8634 * libgimpbase/gimpchecks.h 8635 * libgimpbase/gimplimits.h: moved check size and check color 8636 defines. It makes a lot more sense to keep them in gimpchecks.h. 8637 8638 * libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented. 8639 8640 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): 8641 added a sanity check so we don't crash if the drawable pointer 8642 should ever be NULL here. 8643 86442004-09-02 Helvetix Victorinox <helvetix@gimp.org> 8645 8646 * app/composite/gimp-composite-*test.c: a regression test now 8647 iterates over 8388625 pixels per pass. 8648 8649 * app/composite/gimp-composite-mmx.c 8650 * app/composite/gimp-composite-sse.c 8651 * app/composite/gimp-composite-sse2.c: 8652 Ensured that a clobbered condition code register is reflected in 8653 the clobbered register list for each asm() statement. 8654 This should FIX bug #147013. 8655 86562004-09-03 Sven Neumann <sven@gimp.org> 8657 8658 * libgimpbase/Makefile.am 8659 * libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades(). 8660 8661 * app/base/temp-buf.c 8662 * app/display/gimpdisplayshell-render.c 8663 * libgimpwidgets/gimppreviewarea.c: use the new function instead 8664 of replicating these numbers in three different places. 8665 86662004-09-03 DindinX <david@dindinx.org> 8667 8668 * plug-ins/gimpressionist/*.c: made the code much more readable by 8669 applying the gimp's coding standard (intentation, space, etc.), and 8670 remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use 8671 any deprecated stuff anymore. 8672 86732004-09-02 Michael Schumacher <schumaml@cvs.gnome.org> 8674 8675 * libgimp/gimpui.def 8676 * libgimpbase/gimpbase.def 8677 * libgimpwidgets/gimpwidgets.def: added the preview and progress 8678 related entries 8679 86802004-09-02 Michael Natterer <mitch@gimp.org> 8681 8682 * plug-ins/common/neon.c 8683 * plug-ins/common/noisify.c 8684 * plug-ins/common/sobel.c 8685 * plug-ins/common/softglow.c 8686 * plug-ins/common/spread.c 8687 * plug-ins/common/unsharp.c: fixed various coding style and naming 8688 issues and added some missing signal connections to update the new 8689 previews. 8690 86912004-09-02 DindinX <david@dindinx.org> 8692 8693 * plug-ins/common/despeckle.c: don't assume the preview has always the 8694 same size, and do the memory allocation in preview_update(). As a side 8695 effect, this fix a segfault :-). Also save the preview toggle state 8696 between invocations. 8697 86982004-09-02 Sven Neumann <sven@gimp.org> 8699 8700 * app/display/gimpdisplayshell-render.c (check_combos): light and 8701 dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS. 8702 8703 * libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and 8704 "check-type" properties and draw the checkerboard accordingly. 8705 87062004-09-02 Sven Neumann <sven@gimp.org> 8707 8708 * app/base/base-enums.[ch] 8709 * libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and 8710 GimpCheckType enums to libgimpbase. Correctly prefix the enum 8711 values. 8712 8713 * app/base/temp-buf.c 8714 * app/config/gimpdisplayconfig.c 8715 * app/display/gimpdisplayshell-render.c 8716 * app/pdb/fileops_cmds.c 8717 * tools/pdbgen/pdb/fileops.pdb: changed accordingly. 8718 87192004-09-02 Michael Natterer <mitch@gimp.org> 8720 8721 * plug-ins/script-fu/script-fu-interface.c (script_fu_ok) 8722 * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc): 8723 use a GString for assembling the commands string instead of 8724 g_sprintf()ing into a buffer. Removes the need for a separate loop 8725 over all args to determine the buffer's length and makes the 8726 remaining code smaller and more readable. 8727 87282004-09-02 Sven Neumann <sven@gimp.org> 8729 8730 * libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public, 8731 added some gtk-doc comments. 8732 (gimp_preview_toggle_callback): immidiately invalidate the preview. 8733 8734 * plug-ins/common/gauss.c (gauss): fixed (and simplified) handling 8735 of zero radii by using the new GimpPreview API. 8736 87372004-09-01 Helvetix Victorinox <helvetix@gimp.org> 8738 8739 * app/composite/gimp-composite-mmx.[ch]: Added 8740 gimp_composite_addition_va8_va8_va8_mmx(). 8741 8742 * app/composite/make-installer.py: Regression tests now include 8743 printing the image type for each test. 8744 8745 * app/composite/gimp-composite-mmx-test.c 8746 * app/composite/gimp-composite-regression.c 8747 * app/composite/gimp-composite-sse-test.c 8748 * app/composite/gimp-composite-sse2-test.c 8749 * app/composite/gimp-composite-x86.h: regenerated. 8750 87512004-09-02 Sven Neumann <sven@gimp.org> 8752 8753 * plug-ins/common/borderaverage.c 8754 * plug-ins/common/checkerboard.c 8755 * plug-ins/common/diffraction.c 8756 * plug-ins/common/illusion.c 8757 * plug-ins/common/polar.c 8758 * plug-ins/common/ripple.c 8759 * plug-ins/common/spread.c 8760 * plug-ins/common/video.c: don't pass run_mode to 8761 gimp_rgn_iterator_new(), it's unused. Removes the need for it being 8762 a global variable. 8763 87642004-09-01 Michael Natterer <mitch@gimp.org> 8765 8766 * app/display/gimpdisplay.c 8767 * app/widgets/gimpprogressdialog.c: gracefully handle progress 8768 calls after the widget is destroyed. Re-fixes bug #150194. 8769 87702004-09-01 Sven Neumann <sven@gimp.org> 8771 8772 * libgimp/gimpdrawablepreview.[ch] 8773 * libgimpwidgets/gimppreview.[ch]: always show the "Preview" check 8774 button. Simplified the preview APIs, moved the "size" style 8775 property to the GimpPreview class. 8776 8777 * etc/gtkrc: changed the example accordingly. 8778 8779 * plug-ins/common/despeckle.c 8780 * plug-ins/common/gauss.c 8781 * plug-ins/common/neon.c 8782 * plug-ins/common/sobel.c 8783 * plug-ins/common/softglow.c 8784 * plug-ins/common/spread.c 8785 * plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API. 8786 87872004-09-01 Michael Natterer <mitch@gimp.org> 8788 8789 * plug-ins/script-fu/script-fu-types.h (struct SFOption): changed 8790 "guint history" to "gint history". 8791 8792 * plug-ins/script-fu/script-fu-interface.c: added callbacks for 8793 string entries and combo boxes and connect *all* widgets to callbacks. 8794 8795 (script_fu_ok): don't touch the widgets at all but get the values 8796 directly now that the callbacks correctly write them to their 8797 structs. 8798 8799 (script_fu_reset): don't copy the default values manually but 8800 simply set the default values on the widgets; their callbacks will 8801 do the rest. 8802 8803 * plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script): 8804 added some line breaks and spaces to make it more readable. 8805 88062004-09-01 Michael Natterer <mitch@gimp.org> 8807 8808 * libgimp/Makefile.am 8809 * libgimp/gimpui.h 8810 * libgimp/gimpuitypes.h 8811 * libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which 8812 automatically redirects any progress calls to itself while 8813 it exists. 8814 8815 * plug-ins/script-fu/script-fu-interface.c: removed all progress 8816 callbacks and simply use a GimpProgressBar. 8817 88182004-09-01 Sven Neumann <sven@gimp.org> 8819 8820 * libgimpwidgets/gimppreview.[ch]: set a busy cursor while the 8821 preview is being recalculated. 8822 8823 * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original): 8824 do nothing if there's no drawable. 8825 88262004-09-01 Sven Neumann <sven@gimp.org> 8827 8828 * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x 8829 and y variables. 8830 8831 * libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup. 8832 88332004-09-01 Manish Singh <yosh@gimp.org> 8834 8835 * plug-ins/pygimp/gimpfu.py 8836 * plug-ins/pygimp/gimpmodule.c: Hacked up support for the new 8837 progress interface. Emphasis on hacked. 8838 8839 * plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor 8840 cleanups. 8841 8842 * plug-ins/pygimp/pygimp-image.c 8843 * plug-ins/pygimp/pygimp-tile.c: Minor cleanups. 8844 88452004-08-31 Manish Singh <yosh@gimp.org> 8846 8847 * plug-ins/pygimp/plug-ins/gimpcons.py 8848 * plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop 8849 calls. 8850 88512004-09-01 Sven Neumann <sven@gimp.org> 8852 8853 * libgimp/gimpdrawablepreview.c: increased default preview size to 8854 150 pixels. Added a border of 2 pixels around the bounding box of 8855 the selection. 8856 8857 * libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor 8858 if there's something to pan. Set the correct page size on the 8859 scrollbar adjustments. 8860 88612004-09-01 Sven Neumann <sven@gimp.org> 8862 8863 * libgimpwidgets/gimppreviewarea.[ch]: added new function 8864 gimp_preview_area_set_offsets(). 8865 8866 * libgimpwidgets/gimppreview.c: use the new function to let the 8867 checkerboard scroll with the preview. 8868 88692004-09-01 Sven Neumann <sven@gimp.org> 8870 8871 * libgimpwidgets/gimppreview.[ch]: delay the emission of the 8872 "invalidated" signal using a timeout. Removed hack that used to 8873 invalidate the preview on button-release. 8874 8875 * plug-ins/common/unsharp.c: no need to fiddle with the slider 8876 update policies any longer. 8877 88782004-09-01 Sven Neumann <sven@gimp.org> 8879 8880 * app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to 8881 gimp_dialog_factory_dialog_new() to let the caller decide whether 8882 the window should be presented or not. 8883 8884 * app/actions/dialogs-commands.c 8885 * app/actions/image-commands.c 8886 * app/actions/templates-commands.c 8887 * app/gui/gui-vtable.c 8888 * app/gui/gui.c 8889 * app/widgets/gimpsessioninfo.c: changed accordingly. Do not let 8890 gimp_dialog_factory_dialog_new() present the dialog if we need to 8891 change it after creation. This avoids annoying resizes, noticeable 8892 especially with the error dialog. 8893 88942004-08-31 Sven Neumann <sven@gimp.org> 8895 8896 * app/widgets/gimpdockable.c 8897 * libgimp/gimpdrawablepreview.c: converted tabs to spaces. 8898 88992004-08-31 Sven Neumann <sven@gimp.org> 8900 8901 * libgimp/gimpdrawablepreview.c: added a style property for the 8902 minimum size. 8903 8904 * etc/gtkrc: show how to adjust the size of GimpDrawablePreviews. 8905 89062004-08-31 Michael Natterer <mitch@gimp.org> 8907 8908 * app/widgets/gimpdatafactoryview.c 8909 (gimp_data_factory_view_activate_item): emit "clicked" on the 8910 edit_button only if it exists and is sensitive. Fixes bug #151343. 8911 89122004-08-31 Manish Singh <yosh@gimp.org> 8913 8914 * app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message 8915 to GSourceFunc. 8916 89172004-08-31 Sven Neumann <sven@gimp.org> 8918 8919 * libgimpwidgets/gimppreview.c: handle the widget size dynamically. 8920 Hide scrollbars when there's nothing to scroll. 8921 8922 * libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars 8923 are handled completely in the GimpPreview widget now. 8924 89252004-08-31 Sven Neumann <sven@gimp.org> 8926 8927 * libgimpwidgets/gimppreview.c: removed the hardcoded preview size, 8928 removed some redundant assertions. 8929 89302004-08-31 Michael Natterer <mitch@gimp.org> 8931 8932 * plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code... 8933 Also did some minor cleanups. 8934 8935 * plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here. 8936 8937 * plug-ins/script-fu/script-fu-types.h: new file keeping the 8938 various struct defs needed by both the above files. 8939 8940 * plug-ins/script-fu/Makefile.am 8941 * plug-ins/script-fu/siod-wrapper.c: changed accordingly. 8942 89432004-08-31 Michael Natterer <mitch@gimp.org> 8944 8945 * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback): 8946 notify the "update" property on the preview, not the toggle. 8947 89482004-08-31 Sven Neumann <sven@gimp.org> 8949 8950 * libgimpwidgets/gimppreview.c: allow to pan the preview with all 8951 mouse buttons. Set a cursor to indicate that panning is possible. 8952 89532004-08-31 DindinX <david@dindinx.org> 8954 8955 * libgimpwidgets/gimppreview.c 8956 * libgimpwidgets/gimppreview.h: renamed the "updated" signal to 8957 "invalidated" and the confusing "update" virtual function to "draw". 8958 8959 Gave the properties saner names, too. 8960 8961 Removed _get_width and _get_height functions in favor of a _get_size 8962 one. 8963 8964 Added gimp_preview_invalidate function that emits the "invalidated" 8965 signal if needed. 8966 8967 * libgimp/gimpdrawablepreview.c 8968 * libgimp/gimpdrawablepreview.h: modified accordingly and fixed the 8969 scrollbar range. 8970 8971 * plug-ins/common/despeckle.c 8972 * plug-ins/common/gauss.c 8973 * plug-ins/common/neon.c 8974 * plug-ins/common/sobel.c 8975 * plug-ins/common/softglow.c 8976 * plug-ins/common/spread.c 8977 * plug-ins/common/unsharp.c: modified accordingly. 8978 89792004-08-31 Michael Natterer <mitch@gimp.org> 8980 8981 * plug-ins/script-fu/script-fu-scripts.c: removed the script title 8982 label and moved the "About" button to the action_area. Minor 8983 cleanups. 8984 89852004-08-31 Michael Natterer <mitch@gimp.org> 8986 8987 * app/core/gimpdrawable-transform.[ch]: added GimpProgress 8988 parameter to gimp_drawable_transform_affine(). 8989 8990 * tools/pdbgen/pdb/edit.pdb 8991 * tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend" 8992 and all transform functions. 8993 8994 * app/pdb/edit_cmds.c 8995 * app/pdb/transform_tools_cmds.c: regenerated. 8996 89972004-08-31 Sven Neumann <sven@gimp.org> 8998 8999 * plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW 9000 to restore the default cursor, simply pass NULL to 9001 gdk_window_set_cursor(). 9002 90032004-08-31 Michael Natterer <mitch@gimp.org> 9004 9005 * app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info" 9006 member and construct property. Changed gimp_paint_options_new() 9007 to take only a GimpPaintInfo parameter. 9008 9009 * app/core/gimpitem.c (gimp_item_stroke) 9010 * app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly. 9011 9012 * app/core/gimpchannel.c (gimp_channel_stroke) 9013 * app/vectors/gimpvectors.c (gimp_vectors_stroke): use 9014 paint_options->paint_info->paint_type directly instead of casting 9015 to GimpToolOptions and using 9016 tool_options->tool_info->paint_info->paint_type (eek). Fixes crash 9017 when stroking via the PDB because newly created GimpToolOptions 9018 instances have no "tool_info" pointer yet. 9019 9020 * tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers 9021 accordingly. 9022 9023 * app/pdb/paint_tools_cmds.c: regenerated. 9024 90252004-08-31 Michael Natterer <mitch@gimp.org> 9026 9027 * app/config/gimpconfig.c (gimp_config_iface_duplicate): set 9028 construct_param->foo, not construct_param*s*->foo, so we don't set 9029 the first construct param again and crash. 9030 90312004-08-31 Michael Natterer <mitch@gimp.org> 9032 9033 * plug-ins/common/cubism.c: added "..." to the progress text. 9034 90352004-08-31 Michael Natterer <mitch@gimp.org> 9036 9037 * app/actions/file-actions.c (file_actions): added "..." to "Revert". 9038 90392004-08-31 Sven Neumann <sven@gimp.org> 9040 9041 * libgimp/gimpuitypes.h 9042 * libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview 9043 typedef to the header file that it belongs to. 9044 9045 * libgimp/gimpdrawablepreview.[ch]: minor include cleanups and 9046 gtk-doc fixes. 9047 90482004-08-31 Sven Neumann <sven@gimp.org> 9049 9050 * plug-ins/common/gauss.c (gauss_dialog): update the preview when 9051 the blur radius is being changed. gimp_coordinates_new() seems to 9052 be broken though; there shouldn't be two signal connections needed 9053 here. 9054 90552004-08-31 Sven Neumann <sven@gimp.org> 9056 9057 * libgimp/gimpdrawablepreview.[ch] 9058 * libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to 9059 gtk-doc comments and to the handling of object properties. 9060 90612004-08-31 DindinX <david@dindinx.org> 9062 9063 * libgimpwidgets/gimppreview.c 9064 * libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract 9065 base for a GimpDrawablePreview. 9066 9067 * libgimpwidgets/Makefile.am 9068 * libgimpwidgets/gimpwidgets.h 9069 * libgimpwidgets/gimpwidgetstypes.h: modified accordingly. 9070 9071 * libgimp/gimpdrawablepreview.c 9072 * libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget 9073 to ease the use of previews by plug-ins. 9074 9075 * libgimp/Makefile.am 9076 * libgimp/gimpui.h: Changed accordingly. 9077 9078 * plug-ins/common/despeckle.c 9079 * plug-ins/common/gauss.c 9080 * plug-ins/common/neon.c 9081 * plug-ins/common/sobel.c 9082 * plug-ins/common/softglow.c 9083 * plug-ins/common/spread.c 9084 * plug-ins/common/unsharp.c: use a GimpDrawablePreview with these 9085 plug-ins. 9086 90872004-08-30 Michael Natterer <mitch@gimp.org> 9088 9089 * app/plug-in/plug-in-progress.[ch]: added boolean return values 9090 to plug_in_progress_install(), uninstall() and cancel(). Added 9091 checks to make sure the installed progress_callback exists, has 9092 the correct signature and was installed by this plug-in. 9093 9094 * tools/pdbgen/pdb/progress.pdb: use the return values to let the 9095 PDB wrappers succeed/fail. 9096 9097 * app/pdb/progress_cmds.c: regenerated. 9098 90992004-08-30 Michael Schumacher <schumaml@cvs.gnome.org> 9100 9101 * libgimp/gimp.def: added gimp_progress_install & 9102 gimp_progress_uninstall 9103 91042004-08-30 Sven Neumann <sven@gimp.org> 9105 9106 * libgimp/gimpregioniterator.c: document the fact that "run_mode" 9107 is unused. Also did some code cleanup. 9108 91092004-08-30 Michael Natterer <mitch@gimp.org> 9110 9111 * libgimp/gimpregioniterator.c: always update the progress. 9112 Makes all "run_mode" parameters useless. 9113 91142004-08-30 Michael Natterer <mitch@gimp.org> 9115 9116 * plug-ins/common/gauss.c: add "..." to the progress text. 9117 91182004-08-30 Sven Neumann <sven@gimp.org> 9119 9120 * libgimp/gimpprogress.c: added some gtk-doc comments, could be 9121 improved further. 9122 91232004-08-30 Sven Neumann <sven@gimp.org> 9124 9125 * plug-ins/common/colortoalpha.c 9126 * plug-ins/common/compose.c 9127 * plug-ins/common/decompose.c 9128 * plug-ins/common/film.c 9129 * plug-ins/fits/fits.c: always use the progress API, not doing it 9130 in non-interactive mode has always been wrong. 9131 91322004-08-30 Manish Singh <yosh@gimp.org> 9133 9134 * libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the 9135 user_data pointer on uninstall. Eases language binding work. 9136 91372004-08-30 Sven Neumann <sven@gimp.org> 9138 9139 * libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed 9140 drawing of brushes that extend beyond the preview. 9141 91422004-08-30 Sven Neumann <sven@gimp.org> 9143 9144 * app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set): 9145 avoid excessive use of strdup() and strcmp(). The strings are all 9146 constant anyway. 9147 91482004-08-30 Michael Natterer <mitch@gimp.org> 9149 9150 Brought the PDB progress into a working state. Fixes bug #6010, 9151 addresses bugs #97266 and #135185 and unfortunately reopens bug 9152 #150194 (will fix that later). 9153 9154 * libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand. 9155 9156 * app/core/gimppdbprogress.c 9157 * libgimp/gimpprogress.c: use the enum instead of integer 9158 constants for the different progress commands. Cleanup. 9159 9160 * app/plug-in/plug-in-progress.c 9161 * app/plug-in/plug-in-run.c 9162 * app/plug-in/plug-in.c: switch back to real refcounting for 9163 plug_in->progress (reopens bug #150194) and enabled the PDB 9164 progress code. 9165 9166 * plug-ins/script-fu/script-fu-scripts.c: cleaned up the 9167 progress stuff and the script-fu interface a bit. 9168 9169 * plug-ins/pygimp/gimpenums.py 9170 * plug-ins/script-fu/script-fu-constants.c 9171 * tools/pdbgen/enums.pl: regenerated. 9172 91732004-08-29 Manish Singh <yosh@gimp.org> 9174 9175 * app/plug-in/plug-in.c (plug_in_open): set can_recurse on the 9176 recv_message watch, so we don't block on recursive calls to the 9177 handler. plug_in_recv_message needs some refcounting help now 9178 though. 9179 91802004-08-29 Helvetix Victorinox <helvetix@gimp.org> 9181 9182 * app/composite/gimp-composite-x86.h 9183 * app/composite/gimp-composite-sse.c 9184 * app/composite/gimp-composite-sse2.c: Fixed a bunch of 9185 warnings due to bad type casting. 9186 9187 * app/composite/gimp-composite-mmx.c 9188 * app/composite/gimp-composite-sse.c 9189 * app/composite/gimp-composite-x86.h 9190 * app/composite/gimp-composite-sse2.c: 9191 The last changes to fix the the clobber registers bug #147013. 9192 Commented out some dead code to be reviewed later. 9193 91942004-08-29 Michael Natterer <mitch@gimp.org> 9195 9196 Added an API to allow plug-ins to embed the progress for the 9197 actions they trigger into their own GUI (attention: half-done and 9198 broken code ahead...) 9199 9200 * app/core/Makefile.am 9201 * app/core/core-types.h 9202 * app/core/gimppdbprogress.[ch]: new object implementing dispatching 9203 progress calls to a temporary PDB procedure in a plug-in. 9204 9205 * app/Makefile.am: force to link gimppdbprogress.o, bah! 9206 9207 * app/plug-in/plug-in-progress.[ch]: added API to install, 9208 uninstall and cancel a PDB progress for this plug-in, but disabled 9209 the implementation because it doesn't work yet. 9210 9211 * tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new 9212 install, uninstall and cancel functions. 9213 9214 * libgimp/Makefile.am 9215 * libgimp/gimp.h 9216 * libgimp/gimpprogress.[ch]: added an API around the PDB progress 9217 stuff. 9218 9219 * app/pdb/internal_procs.c 9220 * app/pdb/progress_cmds.c 9221 * libgimp/gimpprogress_pdb.[ch]: regenerated. 9222 9223 * plug-ins/script-fu/script-fu-scripts.c: use the new API to show 9224 the progress in the script-fu dialog. 9225 92262004-08-29 Michael Schumacher <schumaml@cvs.gnome.org> 9227 9228 * libgimpwidgets/gimpwidgets.def: added 9229 gimp_scale_entry_set_logarithmic 9230 92312004-08-29 Sven Neumann <sven@gimp.org> 9232 9233 * app/config/gimpconfigwriter.c: don't emit critical warnings 9234 about a messed up state of GimpConfigWriter if the writer is 9235 disabled because of a write error that occured earlier. 9236 92372004-08-29 DindinX <david@dindinx.org> 9238 9239 * app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize. 9240 9241 * app/core/core-enums.c: Regenerated. 9242 9243 * app/actions/dockable-actions.c 9244 9245 * app/config/gimpcoreconfig.c 9246 * app/config/gimpcoreconfig.h 9247 * app/config/gimpdisplayconfig.c 9248 * app/config/gimpdisplayconfig.h 9249 9250 * app/core/gimpundo.c 9251 9252 * app/display/gimpnavigationeditor.c 9253 9254 * app/gui/dialogs.c 9255 * app/gui/file-open-location-dialog.c 9256 9257 * app/tools/gimppaintoptions-gui.c 9258 * app/tools/gimptextoptions.c 9259 9260 * app/widgets/gimpbrushselect.c 9261 * app/widgets/gimpcontainerpopup.c 9262 * app/widgets/gimpcontainerview.c 9263 * app/widgets/gimpdialogfactory.c 9264 * app/widgets/gimpfontselect.c 9265 * app/widgets/gimpgradientselect.c 9266 * app/widgets/gimppaletteselect.c 9267 * app/widgets/gimppatternselect.c 9268 * app/widgets/gimpselectioneditor.c 9269 * app/widgets/gimpsessioninfo.c 9270 * app/widgets/gimptemplateeditor.c 9271 * app/widgets/gimpundoeditor.c 9272 * app/widgets/gimpundoeditor.h 9273 * app/widgets/gimpviewablebutton.c: Changed accordingly. 9274 92752004-08-28 Helvetix Victorinox <helvetix@gimp.org> 9276 9277 * app/composite/gimp-composite-sse.c 9278 * app/composite/gimp-composite-sse2.c: More updates to accomodate 9279 the clobber registers. Additional progress against bug #147013. 9280 9281 * app/composite/gimp-composite-sse.h: Fixed a bug where the wrong 9282 manifest constant definition caused sse2 instructions to never be 9283 compiled. 9284 92852004-08-28 Sven Neumann <sven@gimp.org> 9286 9287 * plug-ins/common/vpropagate.c (run): fixed confusion about which 9288 mode to use when being run with last values (bug #151308). 9289 92902004-08-28 Simon Budig <simon@gimp.org> 9291 9292 * plug-ins/common/plugindetails.c: workaround to avoid a warning 9293 by gcc about the use of "%c" in the format string for strftime. 9294 92952004-08-28 Sven Neumann <sven@gimp.org> 9296 9297 * libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao 9298 S. O. Bueno which adds an API that allows to make the scale widget 9299 of a GimpScaleEntry behave logarithmic. Fixes bug #149420. 9300 9301 * app/widgets/gimpbrusheditor.c: use the new functionality for the 9302 radius control. 9303 93042004-08-28 Sven Neumann <sven@gimp.org> 9305 9306 * plug-ins/common/compose.c (compose_dialog): applied patch from 9307 Markus Triska that improves which layers are choosen by 9308 default (bug #148172). 9309 93102004-08-28 Sven Neumann <sven@gimp.org> 9311 9312 * app/core/gimpimage-contiguous-region.c 9313 (find_contiguous_region_helper): applied a patch from Eric Cheung 9314 that changes the function to use a GQueue to implement recursion 9315 instead of recursive function calls. Fixes bug #151124. 9316 9317 * plug-ins/common/noisify.c (noisify_dialog): left-align the 9318 preview. 9319 93202004-08-28 Sven Neumann <sven@gimp.org> 9321 9322 * app/widgets/gimphelp-ids.h 9323 * app/widgets/gimptoolbox.c (toolbox_create_image_area): added a 9324 help-id for the image area. 9325 93262004-08-27 Michael Natterer <mitch@gimp.org> 9327 9328 Moved the gimp_progress_init() and gimp_progress_update() PDB 9329 functions to their own group because they don't belong to the 9330 "Plug-In" namespace and will soon get more functions. 9331 9332 * tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff... 9333 9334 * tools/pdbgen/pdb/progress.pdb: ...and added it here. 9335 9336 * tools/pdbgen/Makefile.am 9337 * tools/pdbgen/groups.pl 9338 * app/pdb/Makefile.am 9339 * libgimp/Makefile.am: changed accordingly. 9340 9341 * app/pdb/progress_cmds.c 9342 * libgimp/gimpprogress_pdb.[ch]: new generated files. 9343 9344 * app/pdb/internal_procs.c 9345 * app/pdb/plug_in_cmds.c 9346 * libgimp/gimp_pdb.h 9347 * libgimp/gimpplugin_pdb.[ch]: regenerated. 9348 93492004-08-27 Michael Natterer <mitch@gimp.org> 9350 9351 * app/widgets/gimpcontainereditor.c 9352 (gimp_container_editor_construct): call 9353 gimp_container_editor_select_item() manually at construction time 9354 so views show the initially selected object's state correctly 9355 (e.g. the brush spacing). Fixes bug #151227. 9356 93572004-08-27 DindinX <david@dindinx.org> 9358 9359 * app/widgets/gimpnavigationpreview.c 9360 * app/widgets/gimpnavigationpreview.h: renamed these files to ... 9361 9362 * app/widgets/gimpnavigationview.c 9363 * app/widgets/gimpnavigationview.h: to these. 9364 And renamed the GimpNavigationPreview type to GimpNavigationView. 9365 9366 Hopefully, this is the last change in file names for the Preview->View 9367 renaming process. 9368 9369 * app/display/gimpnavigationeditor.c 9370 9371 * app/widgets/Makefile.am 9372 * app/widgets/widgets-types.h: Changed accordingly. 9373 93742004-08-26 Michael Natterer <mitch@gimp.org> 9375 9376 * app/core/gimpitem.[ch]: removed "gboolean use_default_values" 9377 from GimpItem::stroke(). 9378 9379 * app/core/gimpchannel.c 9380 * app/core/gimpselection.c 9381 * app/vectors/gimpvectors.c: changed accordingly. 9382 93832004-08-26 Michael Natterer <mitch@gimp.org> 9384 9385 * app/core/gimpitem.c (gimp_item_stroke): implement the whole 9386 paint_options fiddling here instead of in each subclass and pass 9387 either GimpStrokeOptions or GimpPaintOptions (instead of 9388 GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke(). 9389 9390 Also copied code (that needs to be abstracted to a utility 9391 function) from the tool_manager which makes sure we really use the 9392 global brush, pattern etc. if these options are checked in prefs. 9393 Fixes bug #150716. 9394 9395 * app/core/gimpchannel.c (gimp_channel_stroke) 9396 * app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the 9397 duplicated code mentioned above and simply use the paint_options 9398 passed. 9399 94002004-08-26 DindinX <david@dindinx.org> 9401 9402 * app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is 9403 really derived from GimpViewRenderer and not from 9404 GimpViewRendererDrawable. 9405 94062004-08-26 DindinX <david@dindinx.org> 9407 9408 * app/widgets/gimppreviewrenderer-utils.c 9409 * app/widgets/gimppreviewrenderer-utils.h 9410 * app/widgets/gimppreviewrendererbrush.c 9411 * app/widgets/gimppreviewrendererbrush.h 9412 * app/widgets/gimppreviewrendererdrawable.c 9413 * app/widgets/gimppreviewrendererdrawable.h 9414 * app/widgets/gimppreviewrenderergradient.c 9415 * app/widgets/gimppreviewrenderergradient.h 9416 * app/widgets/gimppreviewrendererimage.c 9417 * app/widgets/gimppreviewrendererimage.h 9418 * app/widgets/gimppreviewrendererimagefile.c 9419 * app/widgets/gimppreviewrendererimagefile.h 9420 * app/widgets/gimppreviewrendererlayer.c 9421 * app/widgets/gimppreviewrendererlayer.h 9422 * app/widgets/gimppreviewrenderervectors.c 9423 * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... 9424 9425 * app/widgets/gimpviewrenderer-utils.c 9426 * app/widgets/gimpviewrenderer-utils.h 9427 * app/widgets/gimpviewrendererbrush.c 9428 * app/widgets/gimpviewrendererbrush.h 9429 * app/widgets/gimpviewrendererdrawable.c 9430 * app/widgets/gimpviewrendererdrawable.h 9431 * app/widgets/gimpviewrenderergradient.c 9432 * app/widgets/gimpviewrenderergradient.h 9433 * app/widgets/gimpviewrendererimage.c 9434 * app/widgets/gimpviewrendererimage.h 9435 * app/widgets/gimpviewrendererimagefile.c 9436 * app/widgets/gimpviewrendererimagefile.h 9437 * app/widgets/gimpviewrendererlayer.c 9438 * app/widgets/gimpviewrendererlayer.h 9439 * app/widgets/gimpviewrenderervectors.c 9440 * app/widgets/gimpviewrenderervectors.h: ... to these names. And also 9441 changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. 9442 9443 * app/tools/gimppaintoptions-gui.c 9444 9445 * app/widgets/Makefile.am 9446 * app/widgets/gimpcomponenteditor.c 9447 * app/widgets/gimpfiledialog.c 9448 * app/widgets/gimpgradienteditor.c 9449 * app/widgets/gimpview.c 9450 * app/widgets/widgets-types.h 9451 * app/widgets/gimpviewrenderer.c 9452 * app/widgets/gimpviewrenderer.h: modified accordingly. 9453 94542004-08-26 Sven Neumann <sven@gimp.org> 9455 9456 * app/sanity.c (sanity_check_filename_encoding): try to convert 9457 the result of gimp_directory() to UTF-8 and bail out with a 9458 moderately helpful error message if this conversion fails. Works 9459 around bug #150917. Also marked these strings for translation. 9460 94612004-08-26 Sven Neumann <sven@gimp.org> 9462 9463 * app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush 9464 as the default tool as suggested in bug #151091. 9465 94662004-08-26 DindinX <david@dindinx.org> 9467 9468 * app/widgets/gimppreview-popup.c 9469 * app/widgets/gimppreview-popup.h 9470 * app/widgets/gimppreviewrenderer.c 9471 * app/widgets/gimppreviewrenderer.h: really removed these files from 9472 cvs. 9473 94742004-08-25 Manish Singh <yosh@gimp.org> 9475 9476 * plug-ins/common/gifload.c: Guard against bogus logical screen 9477 dimensions. Fixes bug #151053. 9478 94792004-08-26 DindinX <david@dindinx.org> 9480 9481 * app/widgets/gimppreview-popup.c 9482 * app/widgets/gimppreview-popup.h: renamed these files... 9483 9484 * app/widgets/gimpview-popup.c 9485 * app/widgets/gimpview-popup.h: .. to these files, and changed the 9486 GimpPreviewPopup type to GimpViewPopup. 9487 9488 * app/widgets/gimppreviewrenderer.c 9489 * app/widgets/gimppreviewrenderer.h: renamed these files... 9490 9491 * app/widgets/gimpviewrenderer.c 9492 * app/widgets/gimpviewrenderer.h: .. to these files, and changed 9493 GimpPreviewRenderer to GimpViewRenderer. 9494 9495 This is the second step of the great Preview->View renaming process. 9496 9497 * app/display/gimpdisplayshell-layer-select.c 9498 * app/display/gimpnavigationeditor.c 9499 9500 * app/widgets/Makefile.am 9501 * app/widgets/gimpbrushfactoryview.c 9502 * app/widgets/gimpbufferview.c 9503 * app/widgets/gimpcellrendererviewable.c 9504 * app/widgets/gimpcellrendererviewable.h 9505 * app/widgets/gimpcomponenteditor.c 9506 * app/widgets/gimpcontainerbox.c 9507 * app/widgets/gimpcontainercombobox.c 9508 * app/widgets/gimpcontainereditor.c 9509 * app/widgets/gimpcontainerentry.c 9510 * app/widgets/gimpcontainergridview.c 9511 * app/widgets/gimpcontainerpopup.c 9512 * app/widgets/gimpcontainertreeview-dnd.c 9513 * app/widgets/gimpcontainertreeview.c 9514 * app/widgets/gimpcontainerview.c 9515 * app/widgets/gimpdatafactoryview.c 9516 * app/widgets/gimpitemtreeview.c 9517 * app/widgets/gimplayertreeview.c 9518 * app/widgets/gimpnavigationpreview.c 9519 * app/widgets/gimppatternfactoryview.c 9520 * app/widgets/gimppreviewrenderer-utils.c 9521 * app/widgets/gimppreviewrendererbrush.c 9522 * app/widgets/gimppreviewrendererbrush.h 9523 * app/widgets/gimppreviewrendererdrawable.c 9524 * app/widgets/gimppreviewrendererdrawable.h 9525 * app/widgets/gimppreviewrenderergradient.c 9526 * app/widgets/gimppreviewrenderergradient.h 9527 * app/widgets/gimppreviewrendererimage.c 9528 * app/widgets/gimppreviewrendererimage.h 9529 * app/widgets/gimppreviewrendererimagefile.c 9530 * app/widgets/gimppreviewrendererimagefile.h 9531 * app/widgets/gimppreviewrendererlayer.c 9532 * app/widgets/gimppreviewrenderervectors.c 9533 * app/widgets/gimpselectioneditor.c 9534 * app/widgets/gimptemplateview.c 9535 * app/widgets/gimptooloptionseditor.c 9536 * app/widgets/gimptoolview.c 9537 * app/widgets/gimpview.c 9538 * app/widgets/gimpview.h 9539 * app/widgets/gimpviewablebutton.c 9540 * app/widgets/widgets-enums.h 9541 * app/widgets/widgets-types.h: Modified accordingly. 9542 95432004-08-25 Sven Neumann <sven@gimp.org> 9544 9545 * app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop 9546 adding message boxes and redirect messages to stderr if there are 9547 too many messages. 9548 95492004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> 9550 9551 * devel-docs/ggr.txt: fix incorrect statement, add note re SVG. 9552 95532004-08-25 Sven Neumann <sven@gimp.org> 9554 9555 * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat(). 9556 9557 * app/widgets/Makefile.am 9558 * app/widgets/widgets-types.h 9559 * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new 9560 GimpMessageBox for each message added. Fixes bug #92604. 9561 9562 * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box() 9563 functionality. 9564 9565 * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog. 9566 9567 * app/gui/dialogs-constructors.[ch] 9568 * app/gui/dialogs.c: manage GimpErrorDialog as singleton. 9569 9570 * app/gui/gui-vtable.c (gui_message): use the new error dialog. 9571 9572 * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL 9573 domain. 9574 9575 * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail 9576 when being called with a NULL domain. 9577 95782004-08-25 DindinX <david@dindinx.org> 9579 9580 * app/display/gimpnavigationeditor.[ch]: eradicate some more previews 9581 in favor of views. 9582 95832004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> 9584 9585 * devel-docs/Makefile.am 9586 * devel-docs/ggr.txt: added new file decribing the ggr (Gimp 9587 gradient) file format. 9588 95892004-08-25 DindinX <david@dindinx.org> 9590 9591 * app/display/gimpnavigationview.c 9592 * app/display/gimpnavigationview.h: renamed these files to... 9593 9594 * app/display/gimpnavigationeditor.c 9595 * app/display/gimpnavigationeditor.h: ... these files, and of course 9596 changed GimpNavigationView to GimpNavigationEditor since it is really 9597 inherited from GimpEditor anyway. 9598 9599 This will leave the gimp_navigation_view namespace for the renaming 9600 from gimp_navigation_preview. 9601 9602 * app/display/Makefile.am 9603 * app/display/display-types.h 9604 * app/display/gimpdisplayshell-callbacks.c 9605 * app/gui/dialogs-constructors.c: Changed accordlingly. 9606 96072004-08-25 Michael Natterer <mitch@gimp.org> 9608 9609 * app/display/gimpdisplayshell-title.c 9610 (gimp_display_shell_format_title): print bad '%' sequences 9611 literally instead of warning (g_warning() is for programming 9612 errors only and must never be triggered by bad or intermediate 9613 user input). Fixes bug #150676 9614 96152004-08-24 Sven Neumann <sven@gimp.org> 9616 9617 * app/widgets/gimpmessagebox.c: put the icon to the right for RTL 9618 layouts. 9619 9620 * app/display/gimpdisplayshell-close.c 9621 * app/gui/quit-dialog.c: use a GimpMessageBox. 9622 96232004-08-24 Sven Neumann <sven@gimp.org> 9624 9625 * app/widgets/gimpmessagebox.[ch]: added API to change the labels. 9626 Modeled after the proposed new API for GtkMessageDialog. 9627 9628 * app/widgets/gimpwidgets-utils.c: changed accordingly. 9629 96302004-08-24 DindinX <david@dindinx.org> 9631 9632 * app/widgets/gimppreview.c 9633 * app/widgets/gimppreview.h: renamed these two files to... 9634 9635 * app/widgets/gimpview.c 9636 * app/widgets/gimpview.h: ... these files. 9637 9638 Also renamed GimpPreview to GimpView. 9639 This is the first step of the great Preview->View renaming process. 9640 9641 * app/actions/palettes-commands.c 9642 9643 * app/display/gimpdisplayshell-layer-select.c 9644 * app/display/gimpnavigationview.c 9645 9646 * app/gui/palette-import-dialog.c 9647 9648 * app/tools/gimppaintoptions-gui.c 9649 9650 * app/widgets/Makefile.am 9651 * app/widgets/gimpaction.c 9652 * app/widgets/gimpactiongroup.c 9653 * app/widgets/gimpbrusheditor.c 9654 * app/widgets/gimpbufferview.c 9655 * app/widgets/gimpcontainerbox.c 9656 * app/widgets/gimpcontainergridview.c 9657 * app/widgets/gimpcontainergridview.h 9658 * app/widgets/gimpdevicestatus.c 9659 * app/widgets/gimpdnd.c 9660 * app/widgets/gimpdockbook.c 9661 * app/widgets/gimpfiledialog.c 9662 * app/widgets/gimpgradienteditor.c 9663 * app/widgets/gimpnavigationpreview.c 9664 * app/widgets/gimpnavigationpreview.h 9665 * app/widgets/gimppaletteeditor.c 9666 * app/widgets/gimppreview-popup.c 9667 * app/widgets/gimppropwidgets.c 9668 * app/widgets/gimpselectioneditor.c 9669 * app/widgets/gimpthumbbox.c 9670 * app/widgets/gimptoolbox-image-area.c 9671 * app/widgets/gimptoolbox-indicator-area.c 9672 * app/widgets/gimptooloptionseditor.c 9673 * app/widgets/gimpviewabledialog.c 9674 * app/widgets/widgets-types.h: changed accordingly. 9675 96762004-08-24 Sven Neumann <sven@gimp.org> 9677 9678 * app/widgets/Makefile.am 9679 * app/widgets/widgets-types.h 9680 * app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox. 9681 9682 * app/widgets/gimpwidgets-utils.c: use it for message dialogs. 9683 96842004-08-23 Sven Neumann <sven@gimp.org> 9685 9686 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset 9687 the filename if gtk_file_chooser_set_uri() failed. 9688 9689 * app/actions/file-commands.c 9690 * app/gui/file-save-dialog.c: trivial cleanups. 9691 9692 * app/widgets/gimpwidgets-utils.c: removed an unused extern 9693 variable declaration. 9694 96952004-08-23 DindinX <david@dindinx.org> 9696 9697 * app/tools/tools-utils.c: fixed a typo that broke the build. 9698 96992004-08-22 Sven Neumann <sven@gimp.org> 9700 9701 * app/tools/Makefile.am 9702 * app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(), 9703 9704 * app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain(). 9705 9706 * app/tools/gimppainttool.c: changed accordingly. 9707 9708 * app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain() 9709 instead of duplicating that functionality. 9710 9711 * app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain() 9712 instead of implementing completely different constraints. 9713 97142004-08-22 Simon Budig <simon@gimp.org> 9715 9716 * app/vectors/gimpbezierstroke.c: Implemented the ellipse basic 9717 shape differently to avoid possible rounding issues with 9718 the _arcto () command. 9719 9720 * app/vectors/gimpvectors-import.c: properly close the rounded 9721 rectangles. 9722 97232004-08-21 Sven Neumann <sven@gimp.org> 9724 9725 * app/vectors/gimpvectors-import.c (parse_svg_transform): support 9726 optional center coordinates for the "rotate" transformations. 9727 (parse_svg_transform): apply transformations in reverse order. The 9728 SVG spec is rather confusing here. 9729 97302004-08-21 Sven Neumann <sven@gimp.org> 9731 9732 * app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed 9733 a bug I introduced with my last commit. 9734 9735 * app/vectors/gimpvectors-import.c: added support for the basic 9736 SVG shape "rect". Fixed handling of SVG lengths in basic shapes. 9737 97382004-08-21 Sven Neumann <sven@gimp.org> 9739 9740 * app/vectors/gimpbezierstroke.[ch]: added new function 9741 gimp_bezier_stroke_new_ellipse() that provides a simple API to 9742 create a bezier stroke that represents an ellipse. 9743 9744 * app/vectors/gimpvectors-import.c: added support for the basic 9745 SVG shapes "circle" and "ellipse". 9746 97472004-08-21 Simon Budig <simon@gimp.org> 9748 9749 * plug-ins/common/gih.c: Fix some GUI issues. Make the relation 9750 between the dimension parameter and the rank thingies more clear 9751 also changed to a nicer layout. 9752 97532004-08-21 Sven Neumann <sven@gimp.org> 9754 9755 * app/vectors/gimpvectors-import.c: added support for the basic 9756 SVG shapes "polyline" and "polygon". 9757 97582004-08-21 Sven Neumann <sven@gimp.org> 9759 9760 * app/vectors/gimpvectors-import.c: added support for importing 9761 the basic SVG shape "line". Other shapes will follow... 9762 97632004-08-21 Sven Neumann <sven@gimp.org> 9764 9765 * app/actions/layers-actions.[ch] 9766 * app/actions/layers-commands.[ch] 9767 * app/widgets/gimplayertreeview.c: added actions to handle layer 9768 masks as suggested in bug #150446. 9769 9770 * menus/layers-menu.xml: added menu entries for new actions, 9771 commented out raise/lower menu entries. 9772 97732004-08-20 Sven Neumann <sven@gimp.org> 9774 9775 * modules/controller_linux_input.c: declare local function as static. 9776 97772004-08-19 Michael Schumacher <schumaml@cvs.gnome.org> 9778 9779 * plug-ins/common/guillotine.c: modified the coordinate insertion 9780 into the file name to leave the file extension intact, changed the 9781 format of the coordinates. Fixes bug #101901. 9782 97832004-08-18 Manish Singh <yosh@gimp.org> 9784 9785 * app/widgets/gimpcellrendereraccel.c 9786 * app/widgets/gimphistogrambox.c 9787 * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts. 9788 97892004-08-18 Sven Neumann <sven@gimp.org> 9790 9791 * app/gui/color-notebook.c: no need to set a size_request here. 9792 9793 * libgimpwidgets/gimpcolorselection.c: HIG-ified spacings. 9794 9795 * libgimpwidgets/gimpcolorscales.c 9796 * modules/colorsel_cmyk.c: don't set a minimum width on the color 9797 scales. Improves behaviour for narrow color dockables. 9798 97992004-08-18 Sven Neumann <sven@gimp.org> 9800 9801 * modules/colorsel_triangle.c: fixed crashes that occured with 9802 small sizes, some code cleanups and a simple optimization. 9803 98042004-08-18 Sven Neumann <sven@gimp.org> 9805 9806 * app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR. 9807 9808 * app/widgets/gimpdock.c 9809 * app/widgets/gimpdockable.c: help-ids are never used directly, 9810 use the defines from app/widgets/gimphelp-ids.h instead. 9811 98122004-08-17 Simon Budig <simon@gimp.org> 9813 9814 * modules/colorsel_triangle.c: Made the triangle colorselector 9815 resizeable. Removed minimum size request (would probably need some 9816 testing for *very* small sizes though). 9817 98182004-08-17 Bill Skaggs <weskaggs@primate.ucdavis.edu> 9819 9820 * app/widgets/gimpdock.c 9821 * app/widgets/gimpdockable.c: add help-ids. 9822 98232004-08-17 Sven Neumann <sven@gimp.org> 9824 9825 * app/plug-in/plug-in-progress.c (plug_in_progress_start): reset 9826 the "cancel" signal handler id when a new progress is set. 9827 98282004-08-17 Sven Neumann <sven@gimp.org> 9829 9830 * modules/colorsel_cmyk.c: minor cleanups. 9831 9832 * modules/colorsel_water.c: let the widget take the available 9833 space, don't set a minimum size. 9834 98352004-08-17 Sven Neumann <sven@gimp.org> 9836 9837 * app/plug-in/plug-in-progress.c 9838 * app/plug-in/plug-in-run.c 9839 * app/plug-in/plug-in.c: don't keep a strong reference to the 9840 GimpProgress object, instead use a weak reference and deal with 9841 the progress being destroyed while the plug-in is running. 9842 Fixes bug #150194. 9843 98442004-08-16 Sven Neumann <sven@gimp.org> 9845 9846 * app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed 9847 labels in CMYK mode. Fixes bug #150213. 9848 98492004-08-16 DindinX <david@dindinx.org> 9850 9851 * plug-ins/common/iwarp.c: fixed a typo preventing the preview to be 9852 redrawn correctly in some case. Reported by AndyFitz. 9853 98542004-08-15 Sven Neumann <sven@gimp.org> 9855 9856 * modules/colorsel_triangle.c: minor cleanups. 9857 9858 * modules/colorsel_water.c: GimpPreviewArea seems like overkill 9859 here, use a GtkDrawingArea instead. 9860 98612004-08-15 DindinX <david@dindinx.org> 9862 9863 * modules/colorsel_triangle.c 9864 * modules/colorsel_water.c: Replaced the GtkPreviews by 9865 GimpPreviewAreas. 9866 98672004-08-14 Manish Singh <yosh@gimp.org> 9868 9869 * libgimpbase/gimpprotocol.c (_gp_params_read): make sure array 9870 length values are not negative, to prevent bad calls to g_new. 9871 Addresses bug #150154. 9872 98732004-08-14 Sven Neumann <sven@gimp.org> 9874 9875 * plug-ins/help/Makefile.am: no need to link gimp-help-lookup with 9876 any GIMP libraries. 9877 9878 * plug-ins/help/domain.[ch]: allow to specify the location of the 9879 index files independently from the base URL. 9880 9881 * plug-ins/help/help.c: changed accordingly. 9882 9883 * plug-ins/help/gimp-help-lookup.c: added command-line options to 9884 specify base URI and root directory for index files. 9885 98862004-08-14 Sven Neumann <sven@gimp.org> 9887 9888 * plug-ins/help/locales.c (locales_parse): don't mess up the order 9889 of languages. 9890 9891 * plug-ins/help/gimp-help-lookup.c: parse command-line options, 9892 added --help output. 9893 98942004-08-14 Sven Neumann <sven@gimp.org> 9895 9896 * plug-ins/help/help.[ch]: moved some defines to the header file. 9897 9898 * plug-ins/help/domain.c: trivial change to remove the libgimpbase 9899 dependency. 9900 9901 * plug-ins/help/Makefile.am 9902 * plug-ins/help/gimp-help-lookup.c: added a very simple 9903 command-line tool that allows to lookup a help-id. 9904 99052004-08-13 DindinX <david@dindinx.org> 9906 9907 * plug-ins/common/edge.c: update the preview when the user choose a 9908 different algorithm from the combo box. This was one of the main 9909 reasons to have a preview here, after all. 9910 99112004-08-13 Sven Neumann <sven@gimp.org> 9912 9913 * plug-ins/common/edge.c (edge_dialog): use a combo box instead of 9914 too many radio buttons. 9915 99162004-08-12 Michael Natterer <mitch@gimp.org> 9917 9918 * app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new): 9919 make sure that all actions, even if they have no menu proxy, can 9920 be invoked by their accelerators. Fixes bug #149938. 9921 9922 * app/widgets/gimpimagedock.c (gimp_image_dock_constructor): 9923 removed the same code here. 9924 9925 * app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new 9926 function which disconnects from "accel_changed" of the accel_group 9927 before upchaining (== before emitting "destroy"). 9928 9929 The above changes make this one redundant, but since the crash in 9930 bug #149938 was triggered by "accel_changed" emitted in the middle 9931 of g_object_unref(tree_model), it feels better to be paranoic here 9932 (fiddling with objects in destruction is no fun). 9933 9934 (gimp_action_view_accel_edited): don't warn if assigning the same 9935 accel to the same action again. 9936 9937 (gimp_action_view_new): don't leak all accel_closures. 9938 99392004-08-12 DindinX <david@dindinx.org> 9940 9941 * plug-ins/common/edge.c: added a preview. 9942 99432004-08-12 Sven Neumann <sven@gimp.org> 9944 9945 * plug-ins/common/sel_gauss.c 9946 * plug-ins/common/unsharp.c: place the preview widget into the 9947 upper left corner like all other plug-ins do. 9948 9949 * plug-ins/help/domain.c: added some (disabled) debug output. 9950 99512004-08-12 DindinX <david@dindinx.org> 9952 9953 * plug-ins/common/sel_gauss.c: added a preview. 9954 9955 * plug-ins/common/unsharp.c: removed unused variables. 9956 99572004-08-12 Sven Neumann <sven@gimp.org> 9958 9959 * app/actions/context-actions.c: changed the icons to indicate 9960 what part of the context is affected by the action. Looks better 9961 in the shortcut editor. 9962 99632004-08-11 Michael Natterer <mitch@gimp.org> 9964 9965 * plug-ins/common/cartoon.c 9966 * plug-ins/common/neon.c 9967 * plug-ins/common/photocopy.c 9968 * plug-ins/common/softglow.c: added four new plug-ins contributed 9969 by Spencer Kimball. Ported them from 1.2 to 2.1 APIs. 9970 9971 * plug-ins/common/plugin-defs.pl: added them here. 9972 9973 * plug-ins/common/mkgen.pl: removed tab insanity now that 9974 libgimpoldpreview is gone. 9975 9976 * plug-ins/common/.cvsignore 9977 * plug-ins/common/Makefile.am: regenerated. 9978 99792004-08-11 DindinX <david@dindinx.org> 9980 9981 Bad DindinX! Don't break the build! 9982 9983 * configure.in 9984 * plug-ins/common/mkgen.pl 9985 * plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from 9986 here too. 9987 9988 * plug-ins/common/Makefile.am: regenerated. 9989 99902004-08-11 DindinX <david@dindinx.org> 9991 9992 Removed the GimpOldPreview stuff. Die, crap, die! 9993 9994 * plug-ins/libgimpoldpreview/*: removed. 9995 9996 * plug-ins/Makefile.am 9997 * plug-ins/common/Makefile.am: changed accordingly. 9998 9999 * plug-ins/common/max_rgb.c 10000 * plug-ins/common/noisify.c 10001 * plug-ins/common/tileit.c: removed last forgotten 10002 #include "libgimpoldpreview.h". 10003 100042004-08-11 Michael Natterer <mitch@gimp.org> 10005 10006 * app/widgets/gimpcontainercombobox.[ch] 10007 * app/widgets/gimpcontainertreeview.c: when removing the last item 10008 from the view, manually clear all GimpCellRendererViewables' 10009 "renderer" properties; otherwise we have stale GimpPreviewRenderers 10010 with still-refed viewables hanging around in the cells. 10011 Works around GTK+ bug #149906. 10012 100132004-08-11 Michael Natterer <mitch@gimp.org> 10014 10015 * app/core/gimp.c 10016 * app/core/gimpimagefile.c: converted tabs to spaces, cosmetic 10017 changes. 10018 100192004-08-11 DindinX <david@dindinx.org> 10020 10021 * plug-ins/common/waves.c: GimpPreviewArea-ified. 10022 100232004-08-11 Michael Natterer <mitch@gimp.org> 10024 10025 Restored sane sorting order for menus which are created 10026 entirely by plug-ins (like Xtns/Script-Fu/...). 10027 10028 * app/menus/plug-in-menus.c (plug_in_menus_build_path): made it 10029 return the built path. For each sub-menu created, add a "Menus" 10030 placeholder and a separator. Make sure all sub-menus end up in the 10031 "Menus" placeholder. More readable because we can use the path 10032 returned by the recursive invocation now. 10033 10034 (plug_in_menus_add_proc): simplified by using the path 10035 plug_in_menus_build_path() returns. 10036 100372004-08-11 Michael Natterer <mitch@gimp.org> 10038 10039 * app/core/gimpprogress.[ch]: added virtual function 10040 gboolean GimpProgressInterface::is_active(). 10041 10042 * app/display/gimpdisplay.c 10043 * app/display/gimpstatusbar.c 10044 * app/widgets/gimpfiledialog.c 10045 * app/widgets/gimpprogressbox.c 10046 * app/widgets/gimpprogressdialog.c 10047 * app/widgets/gimpthumbbox.c: implement it. 10048 10049 * app/plug-in/plug-in.h: removed "gboolean progress_active" and 10050 added "gulong progress_cancel_id" instead. 10051 10052 * app/plug-in/plug-in-progress.c: changed accordingly. Make sure 10053 we correctly handle the "cancel" connections of progress instances 10054 passed from other plug-ins. 10055 100562004-08-11 Michael Natterer <mitch@gimp.org> 10057 10058 * app/plug-in/plug-in-message.c 10059 * app/plug-in/plug-in-run.c (plug_in_temp_run) 10060 * libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN 10061 #define and all code which was in #ifndef ENABLE_TEMP_RETURN. 10062 100632004-08-11 Michael Natterer <mitch@gimp.org> 10064 10065 * app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress(). 10066 10067 * app/gui/gui-vtable.c: changed accordingly. 10068 10069 * app/plug-in/plug-in-progress.[ch]: reenabled showing the 10070 progress in a particular display. 10071 100722004-08-11 Michael Natterer <mitch@gimp.org> 10073 10074 * etc/controllerrc: added a commented-out midi controller entry 10075 with some example mappings. 10076 100772004-08-11 DindinX <david@dindinx.org> 10078 10079 * plug-ins/common/plasma.c: converted to GimpPreviewArea. 10080 100812004-08-11 DindinX <david@dindinx.org> 10082 10083 * plug-ins/common/noisify.c: converted to GimpPreviewArea. Also added 10084 scrollbars to move around. The preview was rather useless without 10085 them. 10086 100872004-08-11 Michael Natterer <mitch@gimp.org> 10088 10089 * app/core/gimpdrawable-blend.c 10090 * app/core/gimpprogress.c: some progress cleanup. 10091 10092 * app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no 10093 need to warn if there is already a progress active, just silently 10094 return NULL as all other GimpProgressInterface implementors. 10095 10096 * app/plug-in/plug-in-progress.c: several progress fixes. 10097 It's still a mess. 10098 10099 * plug-ins/common/url.c: don't show progress depending on 10100 run_mode. Run the actual file plug-in with the same run_mode we 10101 were invoked with. 10102 101032004-08-11 Sven Neumann <sven@gimp.org> 10104 10105 * app/gui/file-open-location-dialog.c 10106 * app/widgets/gimpprogressbox.c: increased horizontal size request 10107 to reduce resizing. 10108 101092004-08-11 Michael Natterer <mitch@gimp.org> 10110 10111 * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails): 10112 fixed annoying resizing when thumbnailing exactly one image. 10113 101142004-08-11 Michael Natterer <mitch@gimp.org> 10115 10116 * app/widgets/Makefile.am 10117 * app/widgets/widgets-types.h 10118 * app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring 10119 a label and a progressbar. Implements GimpProgressIterface. 10120 10121 * app/widgets/gimpprogressdialog.[ch]: replaced label and progress 10122 by a GimpProgressBox. Delegate most progress functionality to it. 10123 10124 * app/widgets/gimpwidgets-utils.[ch]: factored out utility 10125 function gimp_dialog_set_sensitive(). 10126 10127 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive): 10128 use it. 10129 10130 * app/gui/file-open-location-dialog.c (file_open_location_response): 10131 embed the called file procedure's progress using a GimpProgressBox. 10132 101332004-08-10 Michael Natterer <mitch@gimp.org> 10134 10135 * app/widgets/gimpfiledialog.[ch] 10136 (gimp_file_dialog_set_sensitive): new function which works on all 10137 widgets in the dialog except the cancel button. 10138 10139 Remember if the active progress is cancelable and added two 10140 booleans "busy" and "canceled". Added GtkDialog::response() 10141 implementation which, if the dialog is busy, cancels the active 10142 progress and sets the dialog's "canceled" state. 10143 10144 Moved the progress bar right above the action area so it is next 10145 to the cancel button and in the same place for both open and save 10146 dialogs. 10147 10148 * app/gui/file-open-dialog.c 10149 * app/gui/file-save-dialog.c: use the new API to make image loading 10150 and saving cancelable again. 10151 10152 * app/widgets/gimpthumbbox.c: use the same stuff to make 10153 thumbnailing cancelable. Increased the minimum height a bit so it 10154 doesn't resize when the progress bars are shown. 10155 101562004-08-10 Michael Natterer <mitch@gimp.org> 10157 10158 Redid the whole internal progress stuff: don't pass around 10159 progress_callback and progress_data; instead, provide a 10160 pointer to a GimpProgressInterface which can be implemented 10161 by a variety of backends. 10162 10163 Addresses (but not yet fixes) bugs #6010, #97266 and #135185. 10164 10165 * app/display/Makefile.am 10166 * app/display/gimpprogress.[ch]: removed the old progress hack. 10167 10168 * app/core/Makefile.am 10169 * app/core/core-types.h 10170 * app/core/gimpprogress.[ch]: implement GimpProgressInterface. 10171 10172 * app/widgets/Makefile.am 10173 * app/widgets/widgets-types.h 10174 * app/widgets/gimpprogressdialog.[ch]: the standalone progress 10175 dialog as widget implementing GimpProgressInterface. 10176 10177 * app/display/gimpdisplay.c 10178 * app/display/gimpstatusbar.[ch] 10179 * app/widgets/gimpfiledialog.[ch] 10180 * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface 10181 implementation to these classes. 10182 10183 * app/core/gimp-gui.[ch] 10184 * app/gui/gui-vtable.c: replaced the old progress vtable entries 10185 by two new to create and destroy a GimpProgressDialog in case 10186 no other progress is available. 10187 10188 * app/pdb/procedural_db.[ch] 10189 * app/plug-in/plug-in-run.[ch] 10190 * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and 10191 all plug-ins. 10192 10193 * app/plug-in/plug-in.[ch] 10194 * app/plug-in/plug-ins.c 10195 * app/plug-in/plug-in-message.c 10196 * app/plug-in/plug-in-progress.c: handle the case there the 10197 plug-in was crated with a progress as well as the case where it 10198 wasn't. 10199 10200 * app/app_procs.c 10201 * app/batch.c 10202 * app/xcf/xcf.c 10203 * app/file/file-open.[ch] 10204 * app/file/file-save.[ch] 10205 * app/widgets/gimphelp.c 10206 * app/widgets/gimpbrushselect.c 10207 * app/widgets/gimpfontselect.c 10208 * app/widgets/gimpgradientselect.c 10209 * app/widgets/gimppaletteselect.c 10210 * app/widgets/gimppatternselect.c: changed accordingly. 10211 10212 * app/core/gimpimagefile.[ch] 10213 * app/display/gimpdisplayshell-dnd.c 10214 * app/gui/file-open-dialog.c 10215 * app/gui/file-open-location-dialog.c 10216 * app/gui/file-save-dialog.c 10217 * app/widgets/gimplayertreeview.c 10218 * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file 10219 related functions. Embed the progress in the file dialog where 10220 possible. 10221 10222 * app/core/gimpdrawable-blend.[ch] 10223 * app/core/gimpdrawable-transform.[ch] 10224 * app/core/gimpimage-convert.[ch] 10225 * app/core/gimpimage-flip.[ch] 10226 * app/core/gimpimage-resize.[ch] 10227 * app/core/gimpimage-rotate.[ch] 10228 * app/core/gimpimage-scale.[ch] 10229 * app/core/gimpitem-linked.[ch] 10230 * app/core/gimpitem.[ch] 10231 * app/core/gimpchannel.c 10232 * app/core/gimpdrawable.c 10233 * app/core/gimplayer.c 10234 * app/core/gimpselection.c 10235 * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. 10236 10237 * app/tools/gimpblendtool.c 10238 * app/tools/gimptransformtool.c 10239 * app/gui/convert-dialog.c 10240 * app/actions/documents-commands.c 10241 * app/actions/file-commands.c 10242 * app/actions/image-commands.c 10243 * app/actions/layers-commands.c 10244 * app/actions/plug-in-commands.c 10245 * app/actions/vectors-commands.c 10246 * tools/pdbgen/pdb/convert.pdb 10247 * tools/pdbgen/pdb/edit.pdb 10248 * tools/pdbgen/pdb/image.pdb 10249 * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. 10250 10251 * app/pdb/*_cmds.c: regenerated. 10252 102532004-08-10 DindinX <david@dindinx.org> 10254 10255 * plug-ins/common/blinds.c: GimpPreviewArea-ified. 10256 102572004-08-10 DindinX <david@dindinx.org> 10258 10259 * plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum 10260 for the color model instead of some defines and use gboolean instead 10261 of gint where appropriate. 10262 102632004-08-10 Sven Neumann <sven@gimp.org> 10264 10265 * app/core/gimpbrushgenerated.c (gimp_brush_generated_load): 10266 plugged more file descriptor leaks. 10267 102682004-08-10 DindinX <david@dindinx.org> 10269 10270 * app/core/gimpbrushgenerated.c: don't leak a file descriptor when 10271 reading a bad .vbr file. 10272 102732004-08-10 Sven Neumann <sven@gimp.org> 10274 10275 * plug-ins/common/unsharp.c: don't show progress on the image 10276 window while updating the preview. 10277 102782004-08-09 Sven Neumann <sven@gimp.org> 10279 10280 * plug-ins/common/unsharp.c (unsharp_region): reset the progress 10281 when done; some code cleanup. 10282 102832004-08-09 DindinX <david@dindinx.org> 10284 10285 * plug-ins/common/unsharp.c: continuously show the (original) image 10286 during a scrollbar movement. This makes it easier to navigate. 10287 102882004-08-09 Michael Natterer <mitch@gimp.org> 10289 10290 Applied (slightly modified) patch from Shlomi Fish which adds a 10291 progress bar to the RGB -> INDEXED conversion. Fixes bug #145274 10292 and shows that we really really need a GimpProgressInterface in 10293 the core to give progress users full access to the progress API. 10294 10295 * app/core/gimpimage-convert.[ch]: added special 10296 GimpImageConvertProgress function typedef to cope with the 10297 different stages of converting. Support passing such a callback & 10298 data to gimp_image_convert() and update the progress accordingly. 10299 10300 * app/gui/convert-dialog.[ch]: added a convert progress callback 10301 and pass it to gimp_image_convert(). 10302 10303 * app/actions/image-commands.c 10304 * tools/pdbgen/pdb/convert.pdb: changed accordingly. 10305 10306 * app/pdb/convert_cmds.c: regenerated. 10307 103082004-08-09 Sven Neumann <sven@gimp.org> 10309 10310 * data/misc/gimp.desktop.in.in: added GenericName and Version, 10311 updated Categories. 10312 103132004-08-09 Michael Natterer <mitch@gimp.org> 10314 10315 * app/plug-in/plug-ins.c 10316 (plug_ins_file_register_magic) 10317 (plug_ins_file_register_mime): don't dereference 10318 gimp->current_plug_in->plug_in_def if it's NULL. 10319 Fixes bug #149678. 10320 10321 (plug_ins_file_register_mime): moved returning the proc_def inside 10322 the right if() statement. 10323 103242004-08-09 Hans Breuer <hans@breuer.org> 10325 10326 * app/core/gimp-edit.c (gimp_edit_paste_as_new): 10327 gimp_create_display() with the right parameters order 10328 10329 * app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons) 10330 handle gtk_style_lookup_icon_set() returnig NULL 10331 10332 * app/gimpcore.def app/widgets/makefile.msc 10333 themes/default/images/makefile.msc : updated 10334 103352004-08-09 Sven Neumann <sven@gimp.org> 10336 10337 * plug-ins/common/postscript.c (save_ps_header): use the basename 10338 as Title, not the full filename. Fixes bug #149669. 10339 103402004-08-08 Sven Neumann <sven@gimp.org> 10341 10342 * plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a 10343 character array, don't flush the buffer for each byte but wait 10344 until it is filled. 10345 103462004-08-08 Sven Neumann <sven@gimp.org> 10347 10348 * plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use 10349 g_strdup_vprintf() instead of guessing the string length. Also 10350 declare the function using G_GNUC_PRINTF(). 10351 103522004-08-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> 10353 10354 * plug-ins/ifscompose/README.ifscompose: fix out of date info, 10355 pointed out by the author. 10356 103572004-08-08 Sven Neumann <sven@gimp.org> 10358 10359 * libgimpwidgets/Makefile.am: do not build test-preview-area by 10360 default, put it into EXTRA_PROGRAMS. Fixes parallel builds. 10361 103622004-08-08 Michael Natterer <mitch@gimp.org> 10363 10364 * app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive): 10365 new function which checks a GimpImageType against the 10366 proc_def->image_types_val mask. 10367 10368 * app/actions/plug-in-actions.c: use the new function here. Also 10369 separated setting the "Repeat last" and "Reshow last" actions' 10370 labels from setting their sensitivity and made them use the same 10371 sensitivity logic as all other plug-in actions. Fixes bug #149567. 10372 103732004-08-07 Simon Budig <simon@gimp.org> 10374 10375 * libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal 10376 when the hex entry is changed. 10377 103782004-08-07 Sven Neumann <sven@gimp.org> 10379 10380 * app/sanity.c: abort if the configured filename encoding can't be 10381 converted to UTF-8. Fixes bug #149464 for the HEAD branch. 10382 103832004-08-07 Sven Neumann <sven@gimp.org> 10384 10385 * libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose): 10386 corrected dither offset. 10387 103882004-08-07 DindinX <david@dindinx.org> 10389 10390 * plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of 10391 GimpOldPreview. 10392 103932004-08-07 Sven Neumann <sven@gimp.org> 10394 10395 * libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of 10396 GtkPreview. 10397 10398 * libgimp/gimpbrushmenu.c 10399 * libgimp/gimppatternmenu.c: minor cleanup. 10400 104012004-08-07 DindinX <david@dindinx.org> 10402 10403 * plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some 10404 cleanup and removed tabs. 10405 104062004-08-07 Sven Neumann <sven@gimp.org> 10407 10408 * configure.in: bumped version number to 2.1.4. 10409 104102004-08-07 DindinX <david@dindinx.org> 10411 10412 * plug-ins/common/illusion.c: ported to GimpPreviewArea. 10413 104142004-08-07 DindinX <david@dindinx.org> 10415 10416 * libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED 10417 and INDEXEDA image types. 10418 10419 * plug-ins/common/grid.c: ported to GimpPreviewArea. 10420 104212004-08-06 DindinX <david@dindinx.org> 10422 10423 * plug-ins/common/glasstile.c: ported to GimpPreviewArea. 10424 104252004-08-06 DindinX <david@dindinx.org> 10426 10427 * plug-ins/common/nlfilt.c: ported to GimpPreviewArea. 10428 104292004-08-06 Michael Natterer <mitch@gimp.org> 10430 10431 * app/tools/gimptransformtool.h: removed the recently added 10432 "gdouble aspect_ratio"... 10433 10434 * app/tools/gimpscaletool.[ch]: ...and added it where it belongs. 10435 104362004-08-06 Michael Natterer <mitch@gimp.org> 10437 10438 Transform tool cleanup: 10439 10440 * app/tools/gimptransformtool.[ch]: added new virtual function 10441 GimpTransformTool::dialog_update(). 10442 Made wrapper for ::recalc() public and function 10443 transform_bounding_box() private. 10444 Call ::dialog_update() and transform_bounding_box() from the 10445 ::recalc() wrapper. 10446 10447 * app/tools/gimpperspectivetool.[ch] 10448 * app/tools/gimprotatetool.[ch] 10449 * app/tools/gimpscaletool.[ch] 10450 * app/tools/gimpsheartool.[ch]: turned all info_dialog update 10451 functions into GimpTransformTool::dialog_update() implementations 10452 and don't call them from ::recalc(), also removed calls to 10453 transform_bounding_box(); both functions are called by the parent 10454 class now. Call gimp_transform_tool_recalc() when dialog values 10455 were changed, not the tool's internal function. 10456 Moved all static variables to the instance structs. 10457 104582004-08-06 Michael Natterer <mitch@gimp.org> 10459 10460 * app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari 10461 Pollak which enables controlling the shear direction from the 10462 dialog and changing the shear direction without hitting "Reset". 10463 Fixes bug #149467. 10464 10465 Also moved all static variables to the GimpShearTool struct and 10466 converted tabs to spaces. 10467 104682004-08-06 DindinX <david@dindinx.org> 10469 10470 * plug-ins/common/nova.c: ported to GimpPreviewArea. 10471 104722004-08-06 Sven Neumann <sven@gimp.org> 10473 10474 * Made 2.1.3 release. 10475 104762004-08-06 DindinX <david@dindinx.org> 10477 10478 * plug-ins/common/polar.c: ported to GimpPreviewArea (from 10479 GimpOldPreview). 10480 104812004-08-06 Sven Neumann <sven@gimp.org> 10482 10483 * libgimpcolor/test-color-parser.c: include <glib-object.h>. 10484 104852004-08-06 Sven Neumann <sven@gimp.org> 10486 10487 * plug-ins/common/depthmerge.c: 10488 * plug-ins/common/despeckle.c: removed unused variables. 10489 104902004-08-06 DindinX <david@dindinx.org> 10491 10492 * plug-ins/common/flarefx.c: ported to GimpPreviewArea (from 10493 GimpOldPreview) 10494 104952004-08-06 Sven Neumann <sven@gimp.org> 10496 10497 * plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove 10498 tw_sess.c here. 10499 105002004-08-05 DindinX <david@dindinx.org> 10501 10502 * plug-ins/common/wind.c: ported to GimpPreviewArea (from 10503 GimpOldPreview) 10504 105052004-08-05 Michael Natterer <mitch@gimp.org> 10506 10507 * app/tools/gimpiscissorstool.c: increased the handle size from 8 10508 to 9 pixels (which is the same as in the path tool) as suggested 10509 in bug #134250. 10510 105112004-08-05 Michael Natterer <mitch@gimp.org> 10512 10513 * app/display/gimpstatusbar.c: make the cursor coordinates label 10514 insensitive when displaying out-of-image coordinates. 10515 105162004-08-05 Michael Natterer <mitch@gimp.org> 10517 10518 * app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB): 10519 s/pseudocolor visuals/8-bit (256 colors) displays/. 10520 Fixes bug #137078. 10521 105222004-08-05 Michael Natterer <mitch@gimp.org> 10523 10524 Enabled previewing items without selecting them in all list and 10525 grid views using mouse button 2. Implicitly enables previewing of 10526 items in container popups and thus fixes bug #121011: 10527 10528 * app/widgets/gimppreview.c (gimp_preview_button_press_event) 10529 * app/widgets/gimpcellrendererviewable.c 10530 (gimp_cell_renderer_viewable_clicked): show the preview also on 10531 mouse button 2 click. 10532 10533 * app/widgets/gimpcontainertreeview.c 10534 (gimp_container_tree_view_button_press): dispatch mouse button 2 10535 clicks to GimpCellRendererViewable, but don't select or change 10536 anything in the tree_view. 10537 10538 Unrelated cleanup: 10539 10540 * app/widgets/gimppreview.c (gimp_preview_button_press_event): 10541 don't offset bevent->x,y by widget->allocation.x,y before calling 10542 gimp_preview_popup_show() ... 10543 10544 * app/widgets/gimppreview-popup.c (gimp_preview_popup_show): 10545 ... instead, do it here generically (check if the parent widget is 10546 GTK_WIDGET_NO_WINDOW()). 10547 105482004-08-05 Michael Natterer <mitch@gimp.org> 10549 10550 * libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty): 10551 allocate the empty_iter using g_new0(). Fixes valgrind warnings 10552 about reads from uninitialized memory. 10553 105542004-08-05 Michael Natterer <mitch@gimp.org> 10555 10556 * app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for 10557 all "Set" actions (like context-foreground-red-set). 10558 105592004-08-05 Michael Natterer <mitch@gimp.org> 10560 10561 * app/tools/gimpscaletool.c 10562 * app/tools/gimptransformtool.h: applied patch from Jordi Gay 10563 (attached to bug #131111) which adds an aspect ratio spinbutton to 10564 the scale dialog and keeps the aspect ratio intact when width or 10565 height are changed using the dialog. Fixes bug #132274. 10566 10567 * app/tools/gimpcroptool.c 10568 * app/tools/gimpscaletool.c: don't set the aspect spinbuttons to 10569 "wrap" and decrease their climb_rate. 10570 105712004-08-05 Michael Natterer <mitch@gimp.org> 10572 10573 * app/actions/context-actions.c 10574 * app/actions/context-commands.[ch] 10575 * menus/image-menu.xml.in: added actions, callbacks and menu items 10576 for the brush shape and spikes. 10577 105782004-08-04 Simon Budig <simon@gimp.org> 10579 10580 * plug-ins/common/grid.c: changed the default colors for the 10581 first invocation to the current foregroud color which is more 10582 likely to be useful than the blue shades. 10583 105842004-08-04 Sven Neumann <sven@gimp.org> 10585 10586 * themes/Default/images/Makefile.am 10587 * themes/Default/images/stock-brush-generated-*-16.png: removed ... 10588 10589 * themes/Default/images/stock-shape-*-16.png: ... and added back 10590 with more generic names. 10591 10592 * libgimpwidgets/gimpstock.[ch] 10593 * app/widgets/gimpbrusheditor.c: changed accordingly. 10594 10595 * app/tools/gimpinkoptions-gui.c: use the new stock icons here as 10596 well. 10597 10598 * app/widgets/Makefile.am 10599 * app/widgets/widgets-types.h 10600 * app/widgets/gimpblobeditor.[ch]: added a simple blob shape 10601 editor widget factored out of app/tools/gimpinkoptions-gui.c. 10602 106032004-08-04 Simon Budig <simon@gimp.org> 10604 10605 * app/core/gimpbrushgenerated.c: Enhanced the range of the hardness 10606 parameter to make more soft brushes possible. Please note that this 10607 makes existing generated brushes look more soft. But since people 10608 apparently rarely use more than one or two generated brushes and 10609 these get changed frequently I guess it should be OK. 10610 106112004-08-04 Michael Natterer <mitch@gimp.org> 10612 10613 Allow URI drops from apps linked against GLib < 2.4.4 to GIMP 10614 linked against GLib >= 2.4.5. Fixes bug #148140. 10615 10616 * app/core/gimp-utils.[ch]: added gimp_check_glib_version(). 10617 10618 * app/widgets/gimpselectiondata.c: added runtime check for GLib 10619 versions that encode file:// URIs correctly (>= 2.4.5). For older 10620 (broken) GLibs, leave the code path as is, for newer (fixed) ones, 10621 perform an additional check if the dropped URI is in the (broken) 10622 escaped-UTF-8 format and convert it to local filename encoding. 10623 10624 * app/gui/gui.c: warn the user that non-ASCII filenames can't 10625 be used when linked against GLib 2.4.4. 10626 106272004-08-04 Michael Natterer <mitch@gimp.org> 10628 10629 * app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in" 10630 to "PlugInProcDef *last_plug_in". Added function 10631 gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed. 10632 10633 * app/actions/plug-in-commands.c 10634 * app/plug-in/plug-in-run.c: changed accordingly. 10635 10636 * app/actions/plug-in-actions.c: factored out updating of the 10637 "Reshow Last" and "Rerun Last" actions to a private function. 10638 Connect each "plug-in" action group to Gimp::last-plug-in-changed 10639 and update the actions' label and sensitivity in the 10640 callback. Fixes bug #149139. 10641 106422004-08-04 Michael Natterer <mitch@gimp.org> 10643 10644 * app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h" 10645 106462004-08-04 Manish Singh <yosh@gimp.org> 10647 10648 * configure.in: Really really really really fix WINDRES logic. 10649 106502004-08-03 DindinX <david@dindinx.org> 10651 10652 * plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs 10653 work. 10654 106552004-08-03 Michael Natterer <mitch@gimp.org> 10656 10657 * app/widgets/gimpcontainergridview.c 10658 (gimp_container_grid_view_item_context): ref/unref the view around 10659 the calls to gimp_container_view_item_selected() and _item_context() 10660 because the former may destroy the view which leads to a crash 10661 when trying the latter. Fixes bug #148955. 10662 106632004-08-03 Michael Natterer <mitch@gimp.org> 10664 10665 * app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress): 10666 new function which checks if undo compression is possible: 10667 10668 (1) is the image dirty? Fixes bug #148853. 10669 (2) is redo stack empty? 10670 (3) do both the passed undo object_type and undo_type 10671 match the top undo item? 10672 10673 Consistently name the GType and GimpUndoType passed to undo 10674 functions "object_type" and "undo_type" to avoid confusion. 10675 10676 * app/actions/layers-commands.c 10677 * app/tools/gimpeditselectiontool.c 10678 * app/tools/gimptexttool.c 10679 * app/widgets/gimpitemtreeview.c 10680 * app/widgets/gimplayertreeview.c: use the new utility function 10681 instead of checking the above conditions manually. 10682 106832004-08-03 Michael Natterer <mitch@gimp.org> 10684 10685 * app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't 10686 leak the brush's name if parsing the shape fails. 10687 10688 (gimp_brush_generated_dirty): shut up bogus compiler warnings 10689 about uninitialized variables. 10690 106912004-08-03 Shlomi Fish <shlomif@iglu.org.il> 10692 10693 * plug-ins/imagemap/imap_preview.c 10694 * plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea. 10695 106962004-08-03 DindinX <david@dindinx.org> 10697 10698 * plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea. 10699 107002004-08-03 DindinX <david@dindinx.org> 10701 10702 * plug-ins/fp/fp.c: converted to GimpPreviewArea. 10703 107042004-08-03 DindinX <david@dindinx.org> 10705 10706 * plug-ins/rcm/rcm_callback.c 10707 * plug-ins/rcm/rcm_dialog.c 10708 * plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea. 10709 107102004-08-02 Simon Budig <simon@gimp.org> 10711 10712 * app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes 10713 with >= 2 spikes. Spotted by Joao S. O. Bueno. 10714 10715 Fixes bug #149099. 10716 107172004-08-02 DindinX <david@dindinx.org> 10718 10719 * plug-ins/common/whirlpinch.c: ported to GimpPreviewArea. 10720 107212004-08-02 DindinX <david@dindinx.org> 10722 10723 * plug-ins/common/video.c: ported to GimpPreviewArea. 10724 107252004-08-02 DindinX <david@dindinx.org> 10726 10727 * plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the 10728 preview, too. 10729 107302004-08-01 DindinX <david@dindinx.org> 10731 10732 * plug-ins/common/tileit.c: ported to GimpPreviewArea. 10733 107342004-08-01 DindinX <david@dindinx.org> 10735 10736 * plug-ins/common/sinus.c: ported to GimpPreviewArea. 10737 107382004-08-01 Manish Singh <yosh@gimp.org> 10739 10740 * configure.in: Really really really fix WINDRES logic. 10741 107422004-08-01 Manish Singh <yosh@gimp.org> 10743 10744 * plug-ins/common/mkgen.pl: update install-% rule to match newer 10745 libtool commands. 10746 10747 * plug-ins/common/Makefile.am: regenerated. 10748 107492004-08-01 Manish Singh <yosh@gimp.org> 10750 10751 * configure.in: Really really fix WINDRES logic. 10752 107532004-08-01 Manish Singh <yosh@gimp.org> 10754 10755 * configure.in: Really fix WINDRES logic. 10756 107572004-08-01 DindinX <david@dindinx.org> 10758 10759 * plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea. 10760 107612004-08-01 Hans Breuer <hans@breuer.org> 10762 10763 * app/display/makefile.msc app/widgets/makefile.msc : build 10764 but *dont link* display-enums.obj, widget-enums.obj and 10765 gimpdisplayoptions.obj. They must be in the dll 10766 * app/makefile.msc : build gimp.exe and gimp-console.exe both 10767 using the same gimp-core.dll 10768 * app/gimpcore.def : new file, exports for gimp-core.dll 10769 * app/Makefile.am : added to EXTRA_DIST 10770 10771 * cursors/makefile.msc : new file to create gimp-tool-cursors.h 10772 * cursors/Makefile.am : added to EXTRA_DIST 10773 10774 * **/makefile.msc : updated 10775 10776 * app/main.c app/app_procs.c : moved code to close the console 10777 from the former to the later. It only is to be used if The Gimp 10778 is not build as console app. 10779 10780 * plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same 10781 drawable twice 10782 * plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid 10783 crashing on File/Import 10784 107852004-08-01 Simon Budig <simon@gimp.org> 10786 10787 * app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially 10788 reset the number of spikes to 2. 10789 107902004-08-01 Simon Budig <simon@gimp.org> 10791 10792 * app/core/gimpbrushgenerated.[ch]: Added optional spikes for 10793 the generated brushes, enabling star shaped generated brushes. 10794 10795 * app/widgets/gimpbrusheditor.[ch]: GUI for this. 10796 10797 * app/core/gimpbrush.c: changed accordingly. 10798 107992004-08-01 DindinX <david@dindinx.org> 10800 10801 * plug-ins/common/mapcolor.c 10802 * plug-ins/common/sample_colorize.c: ported to GimpPreviewArea. 10803 10804 * plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though 10805 it should use some pngs instead. 10806 108072004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> 10808 10809 * configure.in: modified the checks. hopefully it works on all 10810 platforms this time. 10811 108122004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> 10813 10814 * configure.in: move an AM_CONDITIONAL out of an if block 10815 108162004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> 10817 10818 * configure.in: added checks for windres. Fixes bug #148443 10819 together with my last commit. 10820 108212004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> 10822 10823 * app/Makefile.am: added checks and rules to build and link the 10824 win32 icon resource if the resource compiler windres is found by 10825 configure. First part of a fix for bug #148443. 10826 108272004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> 10828 10829 * libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill 10830 108312004-08-01 Shlomi Fish <shlomif@iglu.org.il> 10832 10833 * plug-ins/flame/flame.c: ported to GimpPreviewArea. 10834 108352004-08-01 Simon Budig <simon@gimp.org> 10836 10837 * app/core/core-enums.h 10838 * app/core/gimpbrushgenerated.[ch]: Implement three different 10839 brush shapes for generated brushes. 10840 10841 * app/core/gimpbrush.c: changed accordingly. 10842 * app/core/core-enums.c: regenerated. 10843 10844 * app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape. 10845 * themes/Default/images/stock-brush-generated-*-16.png: New stock 10846 icons for the brush shapes. 10847 10848 * themes/Default/images/Makefile.am 10849 * libgimpwidgets/gimpstock.[ch]: changed accordingly 10850 10851 untabified the files touched. 10852 108532004-08-01 DindinX <david@dindinx.org> 10854 10855 * plug-ins/common/iwarp.c: ported to GimpPreviewArea. 10856 108572004-07-31 DindinX <david@dindinx.org> 10858 10859 * plug-ins/common/gqbist.c: ported to GimpPreviewArea. 10860 108612004-07-31 DindinX <david@dindinx.org> 10862 10863 * plug-ins/common/fractaltrace.c: ported to GimpPreviewArea. 10864 108652004-07-31 DindinX <david@dindinx.org> 10866 10867 * plug-ins/common/exchange.c: ported to GimpPreviewArea. 10868 108692004-07-31 DindinX <david@dindinx.org> 10870 10871 * plug-ins/common/emboss.c: ported to GimpPreviewArea. 10872 108732004-07-31 DindinX <david@dindinx.org> 10874 10875 * plug-ins/common/diffraction.c: ported to GimpPreviewArea. 10876 108772004-07-31 DindinX <david@dindinx.org> 10878 10879 * plug-ins/common/despeckle.c: use even more GimpPreviewArea's 10880 facilities. 10881 10882 * plug-ins/common/destripe.c: ported to GimpPreviewArea. 10883 108842004-07-31 Shlomi Fish <shlomif@iglu.org.il> 10885 10886 * plug-ins/gflare/gflare.c: ported to GimpPreviewArea. 10887 108882004-07-31 DindinX <david@dindinx.org> 10889 10890 * plug-ins/common/despeckle.c: ported to GimpPreviewArea. 10891 108922004-07-31 Shlomi Fish <shlomif@iglu.org.il> 10893 10894 * plug-ins/gimpressionist/brush.c 10895 * plug-ins/gimpressionist/orientmap.c 10896 * plug-ins/gimpressionist/paper.c 10897 * plug-ins/gimpressionist/preview.c 10898 * plug-ins/gimpressionist/size.c: 10899 Converted the code from using GtkPreview to GimpPreviewArea. 10900 109012004-07-30 Seth Burgess <sjburges@gimp.org> 10902 10903 * plug-ins/common/gauss.c: added some non-interactive modes (if called 10904 from the pdb with RUN_INTERACTIVE). 10905 109062004-07-31 Sven Neumann <sven@gimp.org> 10907 10908 * libgimpwidgets/gimpcolorselect.c: minor cleanup. 10909 109102004-07-31 Sven Neumann <sven@gimp.org> 10911 10912 * libgimp/gimppatternmenu.c: ported to GimpPreviewArea. 10913 10914 * libgimp/gimpbrushmenu.c: some small changes for consistency. 10915 109162004-07-31 Sven Neumann <sven@gimp.org> 10917 10918 * libgimpwidgets/gimppreviewarea.[ch]: added new function 10919 gimp_preview_area_fill(). 10920 10921 * libgimpwidgets/test-preview-area.c: added a test for new function. 10922 10923 * libgimp/gimpbrushmenu.c: ported to GimpPreviewArea. 10924 109252004-07-31 DindinX <david@dindinx.org> 10926 10927 * plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a 10928 GtkPreview. Some code cleanup, too. 10929 109302004-07-31 Sven Neumann <sven@gimp.org> 10931 10932 * libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and 10933 a GdkPixbuf instead of the deprecated GtkPreview widget. 10934 109352004-07-30 DindinX <david@dindinx.org> 10936 10937 * plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of 10938 GtkPreview. 10939 109402004-07-30 Sven Neumann <sven@gimp.org> 10941 10942 Applied a bunch of small changes contributed by Tim Mooney to fix 10943 stack corruption on Tru64 and Aix (bug #129867). 10944 10945 * app/Makefile.am 10946 * plug-ins/script-fu/Makefile.am: changed the dependency order so 10947 that $(REGEXREPL) is linked earlier. 10948 10949 * regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream 10950 fix for re_max_failures value. 10951 109522004-07-30 Sven Neumann <sven@gimp.org> 10953 10954 * configure.in: always do the check for perl and use the 10955 substituted perl executable name in the call for gimp-mkenums. 10956 Fixes the build on platforms where perl is not available as 10957 /usr/bin/perl. Closes bug #148813. 10958 10959 * app/widgets/gimpenumstore.c: added missing include. 10960 109612004-07-30 DindinX <david@dindinx.org> 10962 10963 * plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus 10964 some minor code cleanups. 10965 109662004-07-30 DindinX <david@dindinx.org> 10967 10968 * plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a 10969 GimpPreviewArea and the other to a simple GtkDrawingArea, since this 10970 makes the code simpler. 10971 109722004-07-30 Shlomi Fish <shlomif@iglu.org.il> 10973 10974 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw): 10975 corrected a typo causing mayhem in previews of non-alpha grayscale 10976 images. Fixes bug #148873. 10977 109782004-07-30 Sven Neumann <sven@gimp.org> 10979 10980 * plug-ins/common/ccanalyze.c (fillPreview): optimized preview 10981 filling a little bit, removed trailing whitespace. 10982 109832004-07-30 DindinX <david@dindinx.org> 10984 10985 * plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea, 10986 and some small cleanups (g_malloc to g_new, removing tabs) 10987 109882004-07-30 Sven Neumann <sven@gimp.org> 10989 10990 * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw): 10991 optimized alpha blending. 10992 109932004-07-30 Sven Neumann <sven@gimp.org> 10994 10995 Applied a bunch of AIX portability fixes (bug #148813): 10996 10997 * configure.in: when testing for Xmu library, link with -lXt -lX11. 10998 10999 * app/gui/tips-parser.c 11000 * app/gui/user-install-dialog.c 11001 * app/tools/tools-enums.h 11002 * app/widgets/gimpdasheditor.c 11003 * app/widgets/widgets-enums.h 11004 * libgimpthumb/gimpthumb-error.h 11005 * libgimpwidgets/gimpcolorbutton.c 11006 * plug-ins/common/edge.c: removed trailing commas from enums. 11007 11008 * plug-ins/common/snoise.c: renamed defines to avoid collision 11009 with system headers. 11010 11011 * plug-ins/imagemap/imap_cmd_move.c: no C++ style comments. 11012 11013 * app/paint-funcs/paint-funcs-generic.h 11014 * app/paint-funcs/paint-funcs.c: use integers for bit fields. 11015 110162004-07-30 Sven Neumann <sven@gimp.org> 11017 11018 * plug-ins/common/bumpmap.c: removed preview code that isn't used 11019 any longer. 11020 110212004-07-30 DindinX <david@dindinx.org> 11022 11023 * plug-ins/common/bumpmap.c: use GimpPreviewArea instead of 11024 GtkPreview (which leads to much simpler code) 11025 110262004-07-29 Sven Neumann <sven@gimp.org> 11027 11028 * libgimpwidgets/gimppreviewarea.c: only invalidate the buffer 11029 on size_allocate; allocate a new one on the next call to 11030 gimp_preview_area_draw(). Fixed buffer offset in expose method. 11031 11032 * libgimpwidgets/Makefile.am 11033 * libgimpwidgets/test-preview-area.c: more a benchmark than a 11034 test; quite similar to testrgb from the GTK+ source tree. 11035 110362004-07-29 DindinX <david@dindinx.org> 11037 11038 * plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview 11039 widgets to GimpPreviewArea. 11040 110412004-07-29 Michael Natterer <mitch@gimp.org> 11042 11043 * libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed 11044 unused #if 0'ed prototype and unused #includes, minor cleanups. 11045 110462004-07-29 Shlomi Fish <shlomif@iglu.org.il> 11047 11048 * plug-ins/gimpressionist/*.[ch]: normalized the names of the fields 11049 of gimpressionist_vals_t. 11050 110512004-07-29 Sven Neumann <sven@gimp.org> 11052 11053 * libgimpwidgets/Makefile.am 11054 * libgimpwidgets/gimpwidgets.def 11055 * libgimpwidgets/gimpwidgets.h 11056 * libgimpwidgets/gimpwidgetstypes.h 11057 * libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a 11058 replacement for GtkPreview, loosely based on patches from Geert 11059 Jordaens and David Odin. Fixes bug #144759. 11060 11061 * plug-ins/common/sharpen.c: use the new widget instead of a 11062 GtkPreview; saves about 100 lines of rather complex code :) 11063 110642004-07-29 Michael Natterer <mitch@gimp.org> 11065 11066 * etc/controllerrc: changed default configuration of the keyboard 11067 controller: scroll the display one step on cursor_key, scroll by 11068 one page on <shift>+cursor_key and scroll to top/bottom/left/right 11069 on <control>+cursor_key. Fixes bug #53988. 11070 11071 Moved the old opacity-modifying actions to <alt>+cursor_key. 11072 110732004-07-29 Michael Natterer <mitch@gimp.org> 11074 11075 Replaced the concept of having a boolean indicating if an undo 11076 step dirties the image by a bitfield indicating which parts 11077 of the image are dirtied: 11078 11079 * app/core/core-enums.[ch]: reordered two values in enum 11080 GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask. 11081 11082 The values of GimpDirtyMask are still questionable and will 11083 probably change... 11084 11085 * app/core/gimpimage.[ch]: removed signal "undo_start" and added 11086 a GimpDirtyMask parameter to the "dirty" and "clean" signals. 11087 11088 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced 11089 "gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass 11090 it to gimp_image_dirty(). 11091 11092 (gimp_image_undo_group_start): added *ugly* code which tries to 11093 figure GimpDirtyMask from the group's GimpUndoType and store it in 11094 the GimpUndoGroup. Call gimp_image_dirty() instead of the removed 11095 gimp_image_undo_start(). This means the undo group now dirties the 11096 image just like one of its undo steps, but that's no problem since 11097 undoing cleans it in the same way. 11098 11099 * app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g 11100 11101 (gimp_undo_pop): emit clean/dirty signals *before* performing the 11102 actual undo step so listeners can detach from the image before it 11103 is changed by undo. 11104 11105 * app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a 11106 GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push(). 11107 11108 * app/core/gimpimagemap.[ch]: removed "gboolean interactive" 11109 because it makes no sense to use GimpImageMap noninteractively. 11110 Don't freeze()/thaw() undo while the image_map is active which 11111 fixes many ways of trashing the image's undo state but probably 11112 introduces new ways of doing evil things. 11113 11114 * app/display/gimpdisplay-foreach.c 11115 * app/display/gimpdisplayshell-handlers.c: changed according 11116 to the GimpImage::clean()/dirty() signal changes. Small fixes 11117 in the quit dialog's dirty image container. 11118 11119 * app/tools/gimptoolcontrol.[ch]: added member and API to 11120 set/get the dirty_mask. 11121 11122 * app/tools/gimpcroptool.c 11123 * app/tools/gimpimagemaptool.c 11124 * app/tools/gimpiscissorstool.c 11125 * app/tools/gimptexttool.c 11126 * app/tools/gimptransformtool.c: whenever setting "preserve" to 11127 FALSE, also set a "dirty_mask" which specifies on which image 11128 changes the tool wants to be canceled. 11129 11130 * app/tools/tool_manager.c: removed "undo_start" connection and 11131 connect to both "dirty" *and* "clean" to check if the active_tool 11132 needs to be canceled. Cancel the tool only if the dirty_mask 11133 passed in the signal has common bits with the tool's dirty_mask. 11134 11135 Fixes bug #109561 and probably opens some new ones... 11136 111372004-07-29 Michael Schumacher <schumaml@cvs.gnome.org> 11138 11139 * libgimp/gimp.def 11140 * libgimp/gimpui.def: added some missing symbols 11141 111422004-07-29 Sven Neumann <sven@gimp.org> 11143 11144 * libgimpbase/gimpbase.def: added new symbols. 11145 111462004-07-29 Michael Natterer <mitch@gimp.org> 11147 11148 Added support for motion event history as provided by some input 11149 device drivers. If you have a tablet driver supporting this, 11150 please try and report back. 11151 11152 * app/display/gimpdisplayshell.h (struct GimpDisplayShell): added 11153 member "guint32 last_motion_time". 11154 11155 * app/display/gimpdisplayshell-callbacks.c 11156 (gimp_display_shell_tool_events): remember the last_motion_time on 11157 button_press() and after motion() and ask the current device for 11158 its motion history; in motion(), if the active_tool asks for exact 11159 motions, check if the input device recorded a motion history and 11160 process the history instead of the motion event. 11161 11162 (gimp_display_shell_get_time_coords): new utility function which 11163 gets GimpCoords from a GdkTimeCoord struct as used by the motion 11164 history. 11165 111662004-07-29 Shlomi Fish <shlomif@iglu.org.il> 11167 11168 * plug-ins/gimpressionist/repaint.c: converted a multiple if into 11169 a nested one. 11170 111712004-07-29 Sven Neumann <sven@gimp.org> 11172 11173 * app/core/core-enums.h: removed enums GimpImageType and 11174 GimpImageBaseType ... 11175 11176 * libgimpbase/gimpbaseenums.h: ... and added them here. Also moved 11177 all enums from gimpbasetypes.h to this new file. 11178 11179 * libgimpbase/Makefile.am 11180 * tools/pdbgen/Makefile.am: changed accordingly. 11181 11182 * app/core/core-enums.c 11183 * libgimp/gimpenums.h 11184 * libgimpbase/gimpbaseenums.c 11185 * tools/pdbgen/enums.pl: regenerated. 11186 11187 * libgimpbase/gimpparasite.c 11188 * libgimpbase/gimpprotocol.c 11189 * libgimp/gimp.c: include <glib-object.h> 11190 11191 * libgimpbase/gimpbasetypes.[ch]: added API to set and get a 11192 translation domain on a GType. This is used for translatable enum 11193 values. 11194 11195 * libgimpbase/gimputils.[ch]: added API to retrieve the translated 11196 name for an enum value. 11197 11198 * app/widgets/gimpenumstore.c 11199 * app/widgets/gimpenumwidgets.c: use the new API in libgimpbase. 11200 112012004-07-29 Sven Neumann <sven@gimp.org> 11202 11203 * libgimp/gimpdrawable.c: fixed gtk-doc comments. 11204 112052004-07-29 Dave Neary <bolsh@gimp.org> 11206 11207 * app/core/gimpdrawable-transform.c: Stop signed ints overflowing 11208 while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2. 11209 Fixes bug #128594 for drawables less than 32K wide. 11210 112112004-07-29 Michael Natterer <mitch@gimp.org> 11212 11213 * app/gui/preferences-dialog.c: renamed "Cleared saved foobar now" 11214 buttons to "Reset saves foobar to default values". Fixes bug #5673. 11215 Added mnemonics for all the configure/save/reset buttons. 11216 112172004-07-29 Sven Neumann <sven@gimp.org> 11218 11219 * plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script): 11220 applied patch by Kevin Cozens that moves a g_free() to the right 11221 place (bug #148729). 11222 112232004-07-28 Michael Natterer <mitch@gimp.org> 11224 11225 * app/actions/actions.c (action_groups): register the 11226 GIMP_STOCK_VISIBLE icon with the "view" action group. 11227 112282004-07-28 Shlomi Fish <shlomif@iglu.org.il> 11229 11230 * plug-ins/gimpressionist/brush.c: removed a redundant parameter 11231 from one of the internal functions. 11232 * plug-ins/gimpressionist/utils.c: Made sure that resources that 11233 are selected by the presets will position their list views 11234 accordingly. 11235 112362004-07-28 Sven Neumann <sven@gimp.org> 11237 11238 * autogen.sh: if the check for libtoolize fails, try glibtoolize. 11239 112402004-07-28 Shlomi Fish <shlomif@iglu.org.il> 11241 11242 * plug-ins/gimpressionist/presets.c: created a base function for 11243 two functions with duplicate code. 11244 112452004-07-28 Sven Neumann <sven@gimp.org> 11246 11247 * plug-ins/imagemap/imap_default_dialog.c: no need to include 11248 "libgimp/stdplugins-intl.h" here. 11249 112502004-07-28 Michael Natterer <mitch@gimp.org> 11251 11252 * app/gui/preferences-dialog.c (prefs_dialog_new): reordered 11253 buttons in the Interface -> Keyboard Shortcuts section to be 11254 consistent with other sections which provide configure/save/clear 11255 buttons. 11256 112572004-07-28 Michael Natterer <mitch@gimp.org> 11258 11259 * app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init) 11260 * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init): 11261 don't call gimp_tool_control_set_preserve (tool->control, FALSE) 11262 because these tools don't cache any image state and don't care 11263 about the image changing under their feet. 11264 112652004-07-28 Michael Natterer <mitch@gimp.org> 11266 11267 * app/display/gimpdisplayshell.c (gimp_display_shell_reconnect): 11268 emit "reconnect" *before* emitting scale and scroll events so 11269 listeners (the navigation view) can switch to the new image at the 11270 right time. 11271 112722004-07-28 Sven Neumann <sven@gimp.org> 11273 11274 Applied a patch from Brion Vibber that makes the TWAIN plug-in 11275 available on Mac OS X (bug #147962): 11276 11277 * configure.in 11278 * plug-ins/Makefile.am: check for Mac OS X twain support. 11279 11280 * plug-ins/twain/Makefile.am 11281 * plug-ins/twain/tw_local.h 11282 * plug-ins/twain/tw_mac.c 11283 * plug-ins/twain/tw_platform.h 11284 * plug-ins/twain/tw_win.c: new files with platform specific code. 11285 11286 * plug-ins/twain/README 11287 * plug-ins/twain/tw_dump.[ch] 11288 * plug-ins/twain/tw_func.[ch] 11289 * plug-ins/twain/tw_util.[ch] 11290 * plug-ins/twain/twain.c: changed accordingly. 11291 11292 * plug-ins/twain/gimp-twain.png: twain application icon used by 11293 the Mac port. 11294 11295 * plug-ins/twain/tw_sess.c: removed, doesn't seem to be used. 11296 112972004-07-28 Michael Natterer <mitch@gimp.org> 11298 11299 * tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in 11300 parameter description. 11301 11302 * app/pdb/image_cmds.c 11303 * libgimp/gimpimage_pdb.c: regenerated. 11304 113052004-07-28 DindinX <david.odin@cpe.fr> 11306 11307 * plug-ins/common/unsharp.c: Added a toggle button to enable/disable 11308 preview updating. Should fix #144972. 11309 113102004-07-28 DindinX <david.odin@cpe.fr> 11311 11312 * plug-ins/common/shift.c 11313 * plug-ins/common/sinus.c 11314 * plug-ins/common/snoise.c 11315 * plug-ins/common/spheredesigner.c: added missing calls to 11316 g_rand_free (), remove tabs while I was at it. 11317 11318 * plug-ins/common/smooth_palette.c: minor cleanup 11319 11320 * plug-ins/common/spread.c: removed tabs. 11321 113222004-07-28 Michael Natterer <mitch@gimp.org> 11323 11324 * app/core/core-enums.h: added still unused flags type 11325 GimpDirtyMask. 11326 11327 * app/base/Makefile.am 11328 * app/core/Makefile.am 11329 * app/display/Makefile.am 11330 * app/paint/Makefile.am 11331 * app/text/Makefile.am 11332 * app/tools/Makefile.am 11333 * app/widgets/Makefile.am 11334 * libgimpthumb/Makefile.am: changed calls to gimp-mkenums to 11335 support GTypeFlags and to make the value arrays private to the 11336 get_type() functions. 11337 11338 * app/base/base-enums.c 11339 * app/core/core-enums.c 11340 * app/display/display-enums.c 11341 * app/paint/paint-enums.c 11342 * app/text/text-enums.c 11343 * app/tools/tools-enums.c 11344 * app/widgets/widgets-enums.c: regenerated. 11345 113462004-07-28 Michael Natterer <mitch@gimp.org> 11347 11348 * app/paint/gimpclone.c: converted tabs to spaces. 11349 113502004-07-28 DindinX <david.odin@cpe.fr> 11351 11352 * plug-ins/common/spread.c: fix a smallish memory leak. 11353 113542004-07-28 Sven Neumann <sven@gimp.org> 11355 11356 * tools/gimp-mkenums: synced with glib-mkenums (execept for the 11357 newly added template feature). 11358 113592004-07-28 Michael Natterer <mitch@gimp.org> 11360 11361 * libgimp/gimpbrushselect.c 11362 * libgimp/gimpfontselect.c 11363 * libgimp/gimpgradientselect.c 11364 * libgimp/gimppalettemenu.c 11365 * libgimp/gimppaletteselect.c 11366 * libgimp/gimppatternselect.c (gimp_*_select_destroy): don't 11367 leak the selected object's name and its data (brush mask etc). 11368 11369 * libgimp/gimpfontmenu.c: moved the icon to the left side of the 11370 button. 11371 11372 * libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to 11373 API docs. 11374 113752004-07-28 Michael Natterer <mitch@gimp.org> 11376 11377 * app/widgets/gimpactiongroup.c 11378 (gimp_action_group_set_action_label): forgot to strip mnemonics 11379 here. 11380 113812004-07-28 Michael Natterer <mitch@gimp.org> 11382 11383 Enabled disabling all menu mnemonics. Addresses bug #120034: 11384 11385 * app/config/gimpguiconfig.[ch] 11386 * app/config/gimprc-blurbs.h: added boolean RESTART property 11387 "menu-menonics". 11388 11389 * app/gui/preferences-dialog.c: added a GUI for it. 11390 11391 * app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY 11392 property "mnemonics". 11393 11394 (gimp_action_group_add_*_actions): call gimp_strip_uline() on 11395 the actions' labels if mnemonics is FALSE. 11396 11397 * app/widgets/gimpactionfactory.[ch] 11398 * app/actions/actions.c: pass gui_config->menu_menmonics to 11399 all action groups. 11400 114012004-07-27 Sven Neumann <sven@gimp.org> 11402 11403 * menus/image-menu.xml.in: commented out "Context" menu now that 11404 we have a shortcut editor. 11405 114062004-07-27 Sven Neumann <sven@gimp.org> 11407 11408 * app/core/gimpgradient-load.c: don't leak empty SVG gradients. 11409 114102004-07-27 Sven Neumann <sven@gimp.org> 11411 11412 * app/actions/image-commands.c: include "libgimpbase/gimpbase.h", 11413 not an individual header out of libgimpbase. 11414 114152004-07-27 Sven Neumann <sven@gimp.org> 11416 11417 * libgimpbase/Makefile.am 11418 * libgimpbase/gimpbase.h 11419 * libgimpbase/gimpbase.def 11420 * libgimpbase/gimpmemsize.[ch]: added new files with memsize 11421 related functions (moved here from gimputil.c) and 11422 GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]). 11423 11424 * libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here. 11425 11426 * libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from 11427 app/config/gimpconfig-types.[ch]). 11428 11429 * libgimpbase/gimpbase-private.c 11430 * libgimp/gimptile.c 11431 * libgimp/gimpunitcache.c 11432 * plug-ins/help/domain.c 11433 * app/xcf/xcf-read.c: need to include glib-object.h. 11434 11435 * plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT. 11436 11437 * app/config/gimpconfig-types.[ch]: removed code that lives in 11438 libgimpbase now. 11439 11440 * app/config/gimpconfig-deserialize.c: changed accordingly. 11441 11442 * app/config/gimpbaseconfig.c 11443 * app/config/gimpdisplayconfig.c 11444 * app/core/gimpcontext.c 11445 * app/gui/grid-dialog.c 11446 * app/tools/gimpcolortool.c 11447 * app/widgets/gimpaction.c 11448 * app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h 11449 any longer. 11450 11451004-07-27 Michael Natterer <mitch@gimp.org> 11452 11453 * libgimp/Makefile.am 11454 * libgimp/gimp.h 11455 * libgimp/gimpui.h 11456 * libgimp/gimppalettemenu.[ch] 11457 * libgimp/gimppaletteselect.[ch]: added palette select wrapper and 11458 widget (straight copy & string replace of the font select stuff). 11459 Fixes bug #136130. 11460 11461 * plug-ins/script-fu/script-fu-enums.h 11462 * plug-ins/script-fu/script-fu-scripts.c 11463 * plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can 11464 be used in scripts. 11465 11466 * plug-ins/script-fu/scripts/test-sphere.scm: added a palette 11467 parameter to the test script. 11468 114692004-07-27 Michael Natterer <mitch@gimp.org> 11470 11471 * app/core/gimpimage.c (gimp_image_finalize): remove the image 11472 from the image hash table and set its "gimp" pointer to NULL 11473 *after* all layers, channels, vectors and the selection are 11474 finalized; otherwise these items have no chance of removing 11475 themselves from the item hash table (because image->gimp is 11476 already NULL). Spotted by pgimeno and nomis. 11477 (should be backported after it got some testing) 11478 114792004-07-27 Sven Neumann <sven@gimp.org> 11480 11481 * app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change. 11482 114832004-07-27 Michael Natterer <mitch@gimp.org> 11484 11485 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make 11486 sure we always set a non-null URI. 11487 114882004-07-27 Sven Neumann <sven@gimp.org> 11489 11490 * app/widgets/gimphelp-ids.h removed unused help IDs 11491 GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs 11492 for these entries are generated from the procedure names. 11493 114942004-07-27 Sven Neumann <sven@gimp.org> 11495 11496 * app/widgets/gimphelp.c (gimp_help): print the help-id and 11497 help-domain to stdout if gimp was started with the --verbose 11498 command-line option. 11499 115002004-07-27 Sven Neumann <sven@gimp.org> 11501 11502 * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): 11503 show extensions in the filters menu. Is this a good idea at all? 11504 115052004-07-27 Sven Neumann <sven@gimp.org> 11506 11507 * libgimp/gimpbrushmenu.c 11508 * libgimp/gimppatternmenu.c: attempt to make the brush and pattern 11509 selectors look less like buttons (supposed to fix bug #147777). 11510 115112004-07-27 Sven Neumann <sven@gimp.org> 11512 11513 * libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events): 11514 also accept the short hexadecimal notation (3 hex digits). 11515 115162004-07-26 Sven Neumann <sven@gimp.org> 11517 11518 * libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS): 11519 added new files. 11520 115212004-07-26 Sven Neumann <sven@gimp.org> 11522 11523 * app/widgets/Makefile.am 11524 * app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets. 11525 11526 * app/widgets/gimpcomponenteditor.c 11527 * app/widgets/gimpcontainertreeview.c 11528 * app/widgets/gimpitemtreeview.c 11529 * app/widgets/gimplayertreeview.c 11530 * app/widgets/gimptoolview.c 11531 * app/widgets/widgets-types.h: changed accordingly. 11532 11533 * libgimpwidgets/Makefile.am 11534 * libgimpwidgets/gimpwidgets.def 11535 * libgimpwidgets/gimpwidgets.h 11536 * libgimpwidgets/gimpwidgetsmarshal.list 11537 * libgimpwidgets/gimpwidgetstypes.h 11538 * libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell 11539 renderer moved here from app/widgets. 11540 11541 * libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the 11542 new toggle cell renderer. 11543 115442004-07-26 Michael Natterer <mitch@gimp.org> 11545 11546 * app/pdb/procedural_db.[ch] (procedural_db_free_data): new 11547 function which clears the whole list of data set by plug-ins. 11548 11549 (procedural_db_free): use it. 11550 11551 * app/actions/plug-in-actions.c 11552 * app/actions/plug-in-commands.[ch]: added action, callback and 11553 confirmation dialog for "Reset all filters to default values". 11554 Somehow addresses bug #81015. 11555 11556 * app/widgets/gimphelp-ids.h: added a help ID for the new action. 11557 11558 * menus/image-menu.xml.in: added it to the "Filters" submenu. 11559 115602004-07-26 Sven Neumann <sven@gimp.org> 11561 11562 * libgimpwidgets/gimpcellrenderercolor.c 11563 (gimp_cell_renderer_color_get_size): fine-tuning. 11564 115652004-07-26 Michael Natterer <mitch@gimp.org> 11566 11567 * app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR. 11568 11569 * app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor 11570 to GimpParamSpecRGB. 11571 11572 * app/config/gimpconfig-deserialize.c 11573 * app/config/gimpconfig-dump.c 11574 * app/config/gimpconfig-serialize.c 11575 * app/config/gimpscanner.c 11576 * app/core/gimp-utils.c 11577 * app/core/gimpcontext.c 11578 * app/core/gimpgrid.c 11579 * app/display/gimpdisplayoptions.c 11580 * app/text/gimptext.c 11581 * app/tools/gimpcolortool.c 11582 * app/widgets/gimpaction.c 11583 * app/widgets/gimpcolorbar.c 11584 * app/widgets/gimppropwidgets.c: changed accordingly. 11585 115862004-07-26 Shlomi Fish <shlomif@iglu.org.il> 11587 11588 * plug-ins/gimpressionist/: added a de-allocation to the PPM's 11589 allocated by the size map dialog. 11590 115912004-07-26 Sven Neumann <sven@gimp.org> 11592 11593 * app/core/gimpgradient-load.c: load all linear gradients from an 11594 SVG file, not only the first one. 11595 115962004-07-26 Michael Natterer <mitch@gimp.org> 11597 11598 * app/core/gimpdatafactory.h: added "gboolean writable" to the 11599 GimpDataFactoryLoaderEntry struct. Return a GList* instead of 11600 GimpData* from GimpDataLoadFunc so it's possible to load more than 11601 one data object from one file. 11602 11603 * app/core/gimpdatafactory.c (gimp_data_factory_load_data): 11604 changed accordingly: add all items of the returned lists to the 11605 data factory. Make the data object writable only if it's in the 11606 writable path *and* its loader entry says it's a writable format 11607 *and* the returned list contains exactly one element. 11608 11609 * app/core/gimp.c (gimp_real_initialize): declare all loader 11610 entries as writable where we have code to read and write exactly 11611 one object per file; all others are not writable. 11612 11613 * app/core/gimpbrush.[ch] 11614 * app/core/gimpbrushgenerated.[ch] 11615 * app/core/gimpbrushpipe.[ch] 11616 * app/core/gimpgradient-load.[ch] 11617 * app/core/gimppalette.[ch] 11618 * app/core/gimppattern.[ch] (all load functions): return a list 11619 containing the loaded object instead of the object itself. 11620 116212004-07-26 Sven Neumann <sven@gimp.org> 11622 11623 * libgimpwidgets/Makefile.am 11624 * libgimpwidgets/gimpwidgets.def 11625 * libgimpwidgets/gimpwidgets.h 11626 * libgimpwidgets/gimpwidgetstypes.h 11627 * libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell 11628 renderer. 11629 11630 * libgimpwidgets/gimpcolorarea.[ch]: exported the function that 11631 renders the color to a buffer for internal use in libgimpwidgets. 11632 11633 * libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer 11634 for the completion popup. 11635 116362004-07-26 Sven Neumann <sven@gimp.org> 11637 11638 * libgimpcolor/gimpcolor.def 11639 * libgimpwidgets/gimpwidgets.def: added new symbols. 11640 116412004-07-26 Sven Neumann <sven@gimp.org> 11642 11643 * libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type. 11644 11645 * libgimpcolor/gimpadaptivesupersample.c 11646 * libgimpcolor/gimpcolorspace.c 11647 * libgimpcolor/gimprgb-parse.c 11648 * libgimp/gimp.h: include <glib-object.h> instead of <glib.h>. 11649 116502004-07-26 Shlomi Fish <shlomif@iglu.org.il> 11651 11652 * plug-ins/gimpressionist/: placed all the orientation map-related 11653 public functions in orientmap.h. Now we're freeing the PPM's that it 11654 is allocating by a call to orientation_map_free_resources(). 11655 116562004-07-26 Michael Natterer <mitch@gimp.org> 11657 11658 * app/core/core-types.h: removed unused typedef 11659 GimpDataObjectLoaderFunc. 11660 116612004-07-26 Sven Neumann <sven@gimp.org> 11662 11663 * libgimpcolor/gimprgb-parse.c 11664 * libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names() 11665 that gives access to the list of SVG color keywords. 11666 11667 * libgimpwidgets/Makefile.am 11668 * libgimpwidgets/gimpwidgets.h 11669 * libgimpwidgets/gimpwidgetstypes.h 11670 * libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that 11671 allows to enter colors in hex notation or by using color names. 11672 11673 * libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry. 11674 116752004-07-26 Michael Natterer <mitch@gimp.org> 11676 11677 * app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection() 11678 to gimp_edit_selection_tool_start(). Removed enum EditType. 11679 11680 * app/tools/tools-enums.h: added enum GimpTranslateMode instead. 11681 11682 * app/tools/gimpmovetool.c: changed accordingly. 11683 11684 * app/tools/gimpselectiontool.[ch]: added protected utility 11685 function gimp_selection_tool_start_edit(). 11686 11687 * app/tools/gimpfreeselecttool.c 11688 * app/tools/gimpfuzzyselecttool.c 11689 * app/tools/gimprectselecttool.c: use the new function instead of 11690 duplicating the same code three times, don't include 11691 "gimpeditselectiontool.h". 11692 11693 * app/tools/gimpiscissorstool.c: don't include 11694 "gimpeditselectiontool.h". 11695 116962004-07-26 Michael Natterer <mitch@gimp.org> 11697 11698 * app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the 11699 image's undo to prevent live-movement from ending up on the undo 11700 stack. Instead, just stop pushing undo steps after the initial 11701 movement. Simplifies edit_select's undo code quite a bit and fixes 11702 bug #148458. 11703 117042004-07-26 Sven Neumann <sven@gimp.org> 11705 11706 * libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events): 11707 accept SVG color names in the hex entry. Not very intuitive but 11708 probably a nice experts feature and it can be improved later. 11709 117102004-07-26 Michael Natterer <mitch@gimp.org> 11711 11712 * app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking 11713 at GIMP_MINOR_VERSION. 11714 11715 * app/app_procs.c: don't #include "tools/gimp-tools.h". 11716 117172004-07-26 Sven Neumann <sven@gimp.org> 11718 11719 * plug-ins/bmp/bmp.h 11720 * plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that 11721 fixes extra data overflow, nonstandard 16bpp field arrangement 11722 and unrecognized compression (bug #143682). 11723 117242004-07-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> 11725 11726 * plug-ins/common/decompose.c: clamp results of LAB decomposition 11727 so that out-of-gamut conversions do not overflow and get badly 11728 distorted. Fixes bug #147603. Note that it would probably be a 11729 good idea to do similar things for other conversion types. 11730 117312004-07-25 Shlomi Fish <shlomif@iglu.org.il> 11732 11733 * plug-ins/gimpressionist/: converted checks for initialization of 11734 ppm's done by checking the "col" buffer, to macro calls. 11735 117362004-07-25 Shlomi Fish <shlomif@iglu.org.il> 11737 11738 * plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst 11739 crashes if given malicious presets with out of range values, in 11740 the radio buttons group numeric values: "placetype", "orienttype", 11741 etc. "). 11742 11743 This was done by adding clamps to the relevant values in the preset. 11744 117452004-07-25 Raphaël Quinet <quinet@gamers.org> 11746 11747 * INSTALL: Minor fixes and improvements. Suggest using a 11748 different prefix and setting PKG_CONFIG_LIBDIR if old versions of 11749 GTK+ libs are found and cannot be removed without breaking other 11750 packages. 11751 117522004-07-23 Shlomi Fish <shlomif@iglu.org.il> 11753 11754 * plug-ins/gimpressionist/: created a header "orientation.h" 11755 for the Orientation tab specific declarations. 11756 117572004-07-23 Sven Neumann <sven@gimp.org> 11758 11759 * libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code 11760 for grayscale previews. 11761 117622004-07-23 Sven Neumann <sven@gimp.org> 11763 11764 * app/core/gimpgradient-load.c (svg_parser_end_element): fixed 11765 handling of the last gradient segment and did some code cleanup. 11766 117672004-07-23 Sven Neumann <sven@gimp.org> 11768 11769 * app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved 11770 error message. 11771 (svg_parser_end_element): don't crash on empty gradient definitions. 11772 117732004-07-23 Sven Neumann <sven@gimp.org> 11774 11775 * libgimpcolor/test-color-parser.c: added more test samples. 11776 11777 * libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the 11778 new tests. 11779 11780 * app/core/gimpgradient-load.c: changed SVG parser to handle 11781 gradients that are defined more deeply in the SVG hierarchy. Added 11782 a simplistic CSS style parser to deal with gradient definitions 11783 that use CSS to define the gradient stop properties (closes bug 11784 #148127). 11785 117862004-07-23 Sven Neumann <sven@gimp.org> 11787 11788 * app/core/gimpdatafactory.c: some newlines to improve error 11789 messages. 11790 11791 * app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed 11792 error handling. 11793 117942004-07-23 Sven Neumann <sven@gimp.org> 11795 11796 * libgimpcolor/Makefile.am 11797 * libgimpcolor/test-color-parser.c: added a simple unit test 11798 framework for the color parser. 11799 11800 * libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values. 11801 11802 * libgimpmath/test-md5.c: minor cleanup. 11803 118042004-07-23 Sven Neumann <sven@gimp.org> 11805 11806 * libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support 11807 for the "transparent" color name. 11808 118092004-07-22 Sven Neumann <sven@gimp.org> 11810 11811 * libgimpcolor/gimprgb-parse.c 11812 * libgimpcolor/gimprgb.h: improved the CSS color parser code, 11813 added new function gimp_rgba_parse_css(), added support for HSL 11814 color values. 11815 118162004-07-22 Sven Neumann <sven@gimp.org> 11817 11818 * libgimpcolor/gimprgb-parse.c 11819 * libgimpcolor/gimprgb.h: use a signed integer to pass the string 11820 length to the new parser functions. The API explicitely asks for 11821 -1 to be passed... 11822 11823 * app/core/gimp.c 11824 * app/core/gimpgradient-load.[ch] 11825 * app/core/gimpgradient.h: added preliminary support for loading 11826 simple SVG gradients (see bug #148127). Be careful with this new 11827 feature; editing the loaded gradient will cause the SVG file to be 11828 overwritten! Work in progress... 11829 118302004-07-22 Sven Neumann <sven@gimp.org> 11831 11832 * app/core/Makefile.am 11833 * app/core/gimpgradient-load.[ch] 11834 * app/core/gimpgradient-save.[ch] 11835 * app/core/gimpgradient.[ch]: moved gradient file handling out of 11836 gimpgradient.c to new files. 11837 11838 * app/core/gimp.c 11839 * app/actions/gradients-commands.c: changed accordingly. 11840 11841 * libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name. 11842 118432004-07-22 Michael Natterer <mitch@gimp.org> 11844 11845 * data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax. 11846 118472004-07-22 Sven Neumann <sven@gimp.org> 11848 11849 * app/widgets/gimpactionview.c: rephrased the text for the dialog 11850 that appears if a new shortcut collides with an existing one. 11851 11852 * libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name() 11853 which accepts RGB colors in hexadecimal notation or as SVG color 11854 keywords. 11855 118562004-07-22 Michael Natterer <mitch@gimp.org> 11857 11858 * app/display/gimpdisplayshell.c (gimp_display_shell_resume): 11859 s/pause/resume/ in the API docs. 11860 118612004-07-22 Michael Natterer <mitch@gimp.org> 11862 11863 * tools/gimp-remote.c (main): correctly convert relative paths to 11864 URIs. Append the resulting URI only if it's not NULL. 11865 118662004-07-22 Michael Natterer <mitch@gimp.org> 11867 11868 * app/widgets/gimptoolbox.c (toolbox_create_tools): connect to 11869 "accel-changed" of the accel_group using connect_object(), not 11870 just connect() so we don't crash when it's emitted after the 11871 toolbox is destroyed. 11872 118732004-07-21 Ray Strode <rstrode@redhat.com> 11874 11875 * gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop 11876 file for new MIME system. 11877 118782004-07-21 Sven Neumann <sven@gimp.org> 11879 11880 * plug-ins/common/gif.c: declared global const variable as static. 11881 Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why). 11882 118832004-07-21 Michael Natterer <mitch@gimp.org> 11884 11885 * app/widgets/gimptemplateeditor.c 11886 * plug-ins/common/gif.c 11887 * plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of 11888 text views. Fixes bug #148025. 11889 118902004-07-21 Michael Natterer <mitch@gimp.org> 11891 11892 Enabled the various "Clear saved foobar now" buttons in prefs: 11893 11894 * app/gui/session.[ch] 11895 * app/menus/menus.[ch] 11896 * app/widgets/gimpdevices.[ch]: implemented the _clear() 11897 functions: unlink() the rc file and set an internal flag that it 11898 has been deleted. Added "gboolean always_save" parameter to the 11899 _save() functions and don't save anything if it is FALSE and the 11900 internal deletion flag has been set. 11901 11902 * app/gui/gui.c 11903 * app/widgets/gimpdevicestatus.c: changed accordingly. 11904 11905 * app/gui/preferences-dialog.c: added callbacks for all "Save now" 11906 and "Clear now" buttons and show error messages if clearing fails. 11907 Inform the user that she has to restart GIMP to see the effect of 11908 the clearing. 11909 119102004-07-21 Michael Natterer <mitch@gimp.org> 11911 11912 * app/core/gimpmarshal.list 11913 * app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete" 11914 parameter to the GimpCellRendererAccel::accel_edited() signal. 11915 11916 * app/widgets/gimpactionview.c: distinguish between deletion of an 11917 accelerator and the user entering an invalid accelerator. 11918 119192004-07-21 Shlomi Fish <shlomif@iglu.org.il> 11920 11921 * plug-ins/gimpressionist/: normalized the identifiers in 11922 placement.c. 11923 119242004-07-21 Michael Natterer <mitch@gimp.org> 11925 11926 * app/actions/context-actions.c: changed names of actions which 11927 select brushes, patterns etc. from e.g. "context-brush-first" to 11928 "context-brush-select-first". 11929 11930 * menus/image-menu.xml.in: changed accordingly. 11931 119322004-07-21 Michael Natterer <mitch@gimp.org> 11933 11934 * app/gui/preferences-dialog.c: remember the keyboard shortcut 11935 dialog and show it only once. 11936 11937 * app/widgets/gimpactionview.c 11938 * app/widgets/gimpcellrendereraccel.c: minor cleanups. 11939 11940 Seems to work pretty well now and thus fixes bug #142922. 11941 119422004-07-21 Michael Natterer <mitch@gimp.org> 11943 11944 * app/core/gimpmarshal.list 11945 * app/widgets/Makefile.am 11946 * app/widgets/widgets-types.h 11947 * app/widgets/gimpcellrendereraccel.[ch]: new cell renderer 11948 which displays an accelerator and allows to edit it (ripped 11949 out of libegg and modified). 11950 11951 * app/widgets/gimpactionview.c: use the new renderer and connect 11952 to its "accel-edited" signal (its callback is one huge mess that 11953 needs to be cleaned up). Added ugly hack to work around GTK+ API 11954 limitation that seems to prevent implementing a shortcut editor in 11955 a sane way. 11956 11957 * app/actions/file-actions.c 11958 * app/actions/image-actions.c 11959 * app/actions/tools-actions.c: added ugly hacks here, too. 11960 11961 * app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut 11962 editor by Close. 11963 119642004-07-20 Sven Neumann <sven@gimp.org> 11965 11966 * configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that 11967 the missing po files have been added (tips/pa.po is still missing 11968 though). 11969 119702004-07-20 Michael Natterer <mitch@gimp.org> 11971 11972 * app/widgets/gimpactionfactory.[ch] 11973 * app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id" 11974 properties to GtkActionGroup and allow to register them in the 11975 GimpActionFactory. 11976 11977 * app/actions/actions.c: register user visible labels and icons 11978 with all action groups. 11979 11980 * app/widgets/Makefile.am 11981 * app/widgets/widgets-types.h 11982 * app/widgets/gimpactionview.[ch]: new widget which shows a 11983 treeview of action groups and their actions & shortcuts. 11984 11985 * app/widgets/gimpaction.[ch]: added gimp_action_name_compare() 11986 utility function. 11987 11988 * app/widgets/gimpwidgets-utils.[ch]: added 11989 gimp_get_accel_string() utility function. 11990 11991 * app/widgets/gimpcontrollers.[ch]: added 11992 gimp_controllers_get_ui_manager() which will be used for setting 11993 up the controller mapping dialog. 11994 11995 * app/gui/preferences-dialog.c: added a "Configure Keyboard 11996 Shortcuts" button which pops up a GimpActionView. Work in 11997 progress... 11998 119992004-07-20 Michael Natterer <mitch@gimp.org> 12000 12001 * app/actions/image-actions.c: make sure that the "image-new" and 12002 "image-new-from-image" actions always have the same shortcut. 12003 120042004-07-20 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12005 12006 * plug-ins/Lighting/lighting_main.c 12007 * plug-ins/Lighting/lighting_main.h 12008 * plug-ins/Lighting/lighting_preview.c 12009 * plug-ins/Lighting/lighting_preview.h 12010 * plug-ins/Lighting/lighting_shade.c 12011 * plug-ins/Lighting/lighting_ui.c: completely reworked UI for 12012 lighting page. Now supports up to 6 lights (more is trivial). 12013 Added ability to temporarily isolate selected light. Added 12014 light intensity controls. Can interactively position each light 12015 (does not quite work yet for directional lights). 12016 120172004-07-20 Michael Natterer <mitch@gimp.org> 12018 12019 * app/actions/tools-actions.c: added an icon to the 12020 "tools-visibility" action. 12021 120222004-07-20 Sven Neumann <sven@gimp.org> 12023 12024 * app/composite/gimp-composite.c (gimp_composite_init): now that 12025 the output depends on --verbose, enable it for stable releases also. 12026 120272004-07-20 Shlomi Fish <shlomif@iglu.org.il> 12028 12029 * plug-ins/gimpressionist/presets.c: fixed the incorrect strings 12030 for input and output of the preset's fields. (a relic of an 12031 irresponsible search-and-replace script). 12032 12033 * plug-ins/gimpressionist/: normalized the identifiers of 12034 orientmap.c. 12035 120362004-07-20 Helvetix Victorinox <helvetix@gimp.org> 12037 12038 * app/composite/Makefile.am (regenerate): Updated make-installer.py 12039 command line to take advantage of the new compile time method of 12040 determining which instruction set to compile. 12041 12042 * app/composite/gimp-composite.c (gimp_composite_init): Print the 12043 list of active instruction sets if the --verbose command line 12044 switch is ON (via be_verbose) 12045 12046 * app/composite/gimp-composite-x86.h: Factored code from the mmx, 12047 and sse implementations. 12048 12049 * app/composite/make-installer.py: Raised the number of test 12050 iterations from 1 to 10. 12051 12052 * app/composite/gimp-composite-3dnow.[ch] 12053 * app/composite/gimp-composite-3dnow-test.c 12054 * app/composite/gimp-composite-3dnow-installer.c 12055 * app/composite/gimp-composite-altivec.[ch] 12056 * app/composite/gimp-composite-altivec-test.c 12057 * app/composite/gimp-composite-altivec-installer.c 12058 * app/composite/gimp-composite-mmx.[ch] 12059 * app/composite/gimp-composite-altivec-test.c 12060 * app/composite/gimp-composite-altivec-installer.c 12061 * app/composite/gimp-composite-sse.[ch] 12062 * app/composite/gimp-composite-sse-test.c 12063 * app/composite/gimp-composite-sse-installer.c 12064 * app/composite/gimp-composite-sse2.[ch] 12065 * app/composite/gimp-composite-sse2-test.c 12066 * app/composite/gimp-composite-sse2-installer.c 12067 * app/composite/gimp-composite-vis.[ch] 12068 * app/composite/gimp-composite-vis-test.c: 12069 Regenerated sources via make-installer.py 12070 120712004-07-20 Sven Neumann <sven@gimp.org> 12072 12073 * app/app_procs.c 12074 * app/base/base.[ch] 12075 * app/composite/gimp-composite.[ch]: pass "be_verbose" to the base 12076 and composite subsystems. 12077 120782004-07-20 Sven Neumann <sven@gimp.org> 12079 12080 * autogen.sh: added some empty lines to improve readability of the 12081 output in case of problems. 12082 12083 * configure.in: bumped version number to 2.1.3. 12084 120852004-07-19 Helvetix Victorinox <helvetix@gimp.org> 12086 12087 * app/composite/gimp-composite-mmx.c 12088 (xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx) 12089 * app/composite/gimp-composite-mmx.c 12090 (xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx) 12091 * app/composite/gimp-composite-mmx.c 12092 (gimp_composite_difference_rgba8_rgba8_rgba8_mmx) 12093 * app/composite/gimp-composite-mmx.c 12094 (gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber 12095 register corrections. 12096 120972004-07-20 Sven Neumann <sven@gimp.org> 12098 12099 * Made 2.1.2 release. 12100 121012004-07-20 Sven Neumann <sven@gimp.org> 12102 12103 * plug-ins/winicon/icoload.c 12104 * plug-ins/winicon/icosave.c: added explicit casts to please the 12105 compiler. 12106 121072004-07-20 Sven Neumann <sven@gimp.org> 12108 12109 * plug-ins/gimpressionist/Makefile.am (gimpressionist_sources): 12110 added paper.h. 12111 12112 * plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back 12113 arcball.h. 12114 12115 * plug-ins/MapObject/mapobject_main.c 12116 * plug-ins/MapObject/mapobject_preview.c: no need to include 12117 arcball.h here. 12118 12119 * plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples 12120 12121 * plug-ins/gfig/gfig-examples/Makefile.am: cleanup. 12122 121232004-07-20 Sven Neumann <sven@gimp.org> 12124 12125 * plug-ins/Lighting/lighting_ui.c: fixed some GUI issues: 12126 left-align labels, use stock buttons, added line-breaks to make 12127 the code fit into 80 columns. 12128 121292004-07-19 Sven Neumann <sven@gimp.org> 12130 12131 * plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with 12132 the new code: don't include individual glib headers, never ever 12133 use sprintf(), mark user-visible strings for translations, use 12134 default messages, removed trailing whitespace. 12135 121362004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12137 12138 * plug-ins/Lighting/lighting_ui.c: added ability to save and load 12139 presets for lights. 12140 121412004-07-19 Shlomi Fish <shlomif@iglu.org.il> 12142 12143 * plug-ins/gimpressionist/orientation.c: normalized some variables 12144 in the module and fixed some indentation. 12145 121462004-07-19 Helvetix Victorinox <helvetix@gimp.org> 12147 12148 * app/composite/gimp-composite-mmx.c 12149 (gimp_composite_addition_rgba8_rgba8_rgba8_mmx) 12150 * app/composite/gimp-composite-mmx.c 12151 (gimp_composite_burn_rgba8_rgba8_rgba8_mmx) 12152 * app/composite/gimp-composite-x86.h: Correction of clobbered 12153 register lists, as additional progress against bug #147013. 12154 121552004-07-19 Michael Natterer <mitch@gimp.org> 12156 12157 * app/core/gimpmarshal.list: removed unused VOID:UINT,STRING. 12158 121592004-07-19 Michael Natterer <mitch@gimp.org> 12160 12161 * app/gui/file-open-location-dialog.c 12162 (file_open_location_dialog_show): added the "web" icon left of 12163 label & entry. 12164 121652004-07-19 Michael Natterer <mitch@gimp.org> 12166 12167 * app/paint/gimppaintcore.h: removed enum GimpPaintCoreState. 12168 12169 * app/paint/paint-enums.h: added enum GimpPaintState (with values 12170 that have a name space). 12171 12172 * app/paint/gimppaintcore.[ch] 12173 * app/paint/gimpairbrush.c 12174 * app/paint/gimpbrushcore.c 12175 * app/paint/gimpclone.c 12176 * app/paint/gimpconvolve.c 12177 * app/paint/gimpdodgeburn.c 12178 * app/paint/gimperaser.c 12179 * app/paint/gimpink.c 12180 * app/paint/gimppaintbrush.c 12181 * app/paint/gimppaintcore-stroke.c 12182 * app/paint/gimpsmudge.c 12183 * app/tools/gimppainttool.c: changed accordingly. 12184 12185 * app/tools/gimpinktool.c: removed unused #include. 12186 121872004-07-19 Sven Neumann <sven@gimp.org> 12188 12189 * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse): 12190 moved variable declarations to the scope they are being used in, 12191 removed trailing whitespace, minor cleanups. 12192 121932004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12194 12195 * app/core/gimpchannel-combine.c: put in two lines accidentally 12196 omitted in previous change, improve doc comment. 12197 121982004-07-19 Michael Natterer <mitch@gimp.org> 12199 12200 * libgimpbase/gimpwin32-io.h: added copyright header, added 12201 #defines for access(), F_OK, R_OK and X_OK. 12202 12203 * app/core/gimpdata.c: include the above instead of defining 12204 the workarounds here. 12205 12206 * app/base/tile-swap.c 12207 * app/config/gimpconfig-dump.c 12208 * libgimpthumb/gimpthumb-utils.c 12209 * libgimpthumb/gimpthumbnail.c: for consistency, #include 12210 gimpwin32-io.h with "" instead of <>. 12211 122122004-07-19 Michael Natterer <mitch@gimp.org> 12213 12214 * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse): 12215 comments not intended for gtk-doc must not start with '/**'. 12216 122172004-07-19 Michael Natterer <mitch@gimp.org> 12218 12219 * app/plug-in/plug-in.h (struct _PlugIn): removed obsolete 12220 compile-time check for GLIB >= 2.3.5. 12221 122222004-07-19 Shlomi Fish <shlomif@iglu.org.il> 12223 12224 * ChangeLog: Fixed a copy-and-paste error with the dates of my commits. 12225 * plug-ins/gimpressionist/ppmtool.c: removed a few commented-out 12226 asserts, and the function that was used to implement them. 12227 122282004-07-19 Michael Natterer <mitch@gimp.org> 12229 12230 * app/widgets/widgets-types.h: reordered and commented to match 12231 API docs. 12232 122332004-07-19 Sven Neumann <sven@gimp.org> 12234 12235 * plug-ins/imagemap/imap_browse.[ch]: renamed struct member 12236 file_selection to file_chooser. 12237 122382004-07-19 Michael Natterer <mitch@gimp.org> 12239 12240 * app/config/config-types.h: removed GimpConfigInterface typedef, 12241 added comments to typedefs which don't belong here. 12242 12243 * app/config/gimpconfig.h: added GimpConfigInterface typedef. 12244 12245 * app/core/core-types.h 12246 * app/display/display-types.h: added commented out typedefs for 12247 types that live in config-types.h for obscure reasons. 12248 12249 * app/core/core-types.h: reordered stuff to match the order in the 12250 API docs (makes keeping stuff in sync much easier). 12251 122522004-07-19 Shlomi Fish <shlomif@iglu.org.il> 12253 12254 * plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors 12255 pairs for ppm_ with just the destructors. 12256 122572004-07-19 Shlomi Fish <shlomif@iglu.org.il> 12258 12259 * plug-ins/gimpressionist/repaint.c: normalized some identifiers of 12260 repaint.c, and corrected some indentation there. 12261 122622004-07-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12263 12264 * app/core/gimpchannel-combine.c: improve anti-aliasing for 12265 elliptical selections, as described in bug #147836. 12266 122672004-07-18 Sven Neumann <sven@gimp.org> 12268 12269 * app/composite/gimp-composite-mmx.h: don't start a comment with 12270 /** unless it's meant to be parsed by gtk-doc. 12271 12272 * app/actions/Makefile.am: 12273 * app/actions/file-dialog-commands.[ch]: removed, not used any 12274 longer. 12275 122762004-07-18 Philip Lafleur <plafleur@cvs.gnome.org> 12277 12278 * app/paint/gimpink-blob.c (blob_make_convex): Check if the 12279 array index is legal before using it, not the other way around. 12280 Fixes bug #144856. 12281 122822004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> 12283 12284 * plug-ins/common/polar.c (dialog_update_preview): Fixed a 12285 write to unallocated memory that was causing crashes in various 12286 spots. 12287 122882004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> 12289 12290 * plug-ins/common/polar.c (polarize_func): moved array 12291 initialization out of variable declaration. Fixes bug #147799. 12292 122932004-07-17 Michael Natterer <mitch@gimp.org> 12294 12295 * app/widgets/gimphelp-ids.h: added the removed help IDs back. 12296 12297 * app/widgets/gimpfileprocview.[ch]: cache all file_procs' help 12298 IDs and added gimp_file_proc_view_get_help_id() which returns the 12299 selected item's help ID. 12300 12301 * app/widgets/gimpfiledialog.c: added a custom help func which 12302 shows the help for the selected file_proc if the proc_view has the 12303 focus. 12304 123052004-07-17 Sven Neumann <sven@gimp.org> 12306 12307 * app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB 12308 for "file-open-location". 12309 12310 * app/widgets/gimpfiledialog.c: create the scrolled window with 12311 shadow_type GTK_SHADOW_IN. 12312 12313 * app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip 12314 procedures that register a prefix (the URL loader). 12315 12316 * app/widgets/gimphelp-ids.h: removed help IDs that used to be 12317 used from the file-open and file-save menus. 12318 12319 * plug-ins/common/xwd.c (query): "X window dump" seems to be more 12320 appropriate than "X window image". 12321 123222004-07-17 Sven Neumann <sven@gimp.org> 12323 12324 * app/actions/Makefile.am 12325 * app/actions/file-dialog-actions.[ch] 12326 * app/actions/file-open-actions.[ch] 12327 * app/actions/file-save-actions.[ch]: these aren't needed any 12328 longer. 12329 12330 * app/actions/actions.c: changed accordingly. 12331 12332 * app/menus/Makefile.am 12333 * app/menus/file-dialog-menu.[ch] 12334 * app/menus/file-open-menu.[ch] 12335 * app/menus/file-save-menu.[ch]: these aren't needed any longer. 12336 12337 * app/menus/menus.c: changed accordingly. 12338 12339 * menus/Makefile.am 12340 * menus/file-open-menu.xml 12341 * menus/file-save-menu.xml: these are also not needed any longer. 12342 123432004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> 12344 12345 * plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from 12346 Brion Vibber that fixes corruption when saving RLE-encoded 12347 BMPs on big endian hosts. Fixes bug #147759. 12348 123492004-07-17 Shlomi Fish <shlomif@iglu.org.il> 12350 12351 * plug-ins/gimpressionist/: normalized the identifiers of 12352 general.c and general.h. Also, renamed a callback from _store 12353 to simply _callback to avoid confusion with the _store methods. 12354 Some of the member variables of the pcvals struct were changed 12355 as a result. 12356 123572004-07-16 Helvetix Victorinox <helvetix@gimp.org> 12358 12359 * app/composite/gimp-composite-mmx.[ch] 12360 * app/composite/gimp-composite-sse.[ch] 12361 * app/composite/gimp-composite-sse2.[ch]: 12362 12363 We've had trouble compiling with the Intel compiler which 12364 identifies itself as GCC, but doesn't support the same extended 12365 assembly features/misfeatures as GCC. With the help of the Intel 12366 compiler group, we've determined that the Intel compiler can be 12367 identified at compile time by the definition of the preprocessor 12368 variable __INTEL_COMPILER. 12369 12370 These changes make all of the assembly code currently written to 12371 simply avoid the Intel compiler. 12372 12373 This is an interim solution to get a build working despite the 12374 Intel compiler. A more correct solution has been identified, see 12375 the discussion of bug #147013 for more information. 12376 123772004-07-17 Sven Neumann <sven@gimp.org> 12378 12379 * app/xcf/xcf.c (xcf_init): also register the internal XCF 12380 handlers according to the new scheme. 12381 12382 * plug-ins/common/Makefile.am 12383 * plug-ins/common/plugin-defs.pl 12384 * plug-ins/common/hrz.c: removed the HRZ file plug-in since it 12385 doesn't seem to be very useful. 12386 123872004-07-17 Sven Neumann <sven@gimp.org> 12388 12389 * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add) 12390 (plug_ins_init_file): use g_slist_prepend() instead of 12391 g_slist_append(). 12392 12393 * plug-ins/common/url.c (query): ported to the new PDB registration 12394 scheme. 12395 123962004-07-16 Sven Neumann <sven@gimp.org> 12397 12398 * app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures 12399 by their menu labels. 12400 12401 * app/widgets/gimpfileprocview.c: removed the sort function here. 12402 124032004-07-16 Sven Neumann <sven@gimp.org> 12404 12405 * app/widgets/Makefile.am 12406 * app/widgets/widgets-types.h 12407 * app/widgets/gimpfileprocview.[ch]: added new widget that offers 12408 a treeview on file procedures. 12409 12410 * app/widgets/gimpfiledialog.[ch]: replaced the file type option 12411 menu with the new GimpFileProcView widget. 12412 (gimp_file_dialog_set_image): reset the file type to Automatic 12413 (fixes bug #141535). 12414 12415 * app/actions/file-commands.c 12416 * app/gui/file-open-dialog.[ch] 12417 * app/gui/file-save-dialog.[ch]: changed accordingly. 12418 12419 * plug-ins/common/bz2.c 12420 * plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2" 12421 extension. It's redundant and breaks the code that sets the 12422 extension from the selected file-type. 12423 12424 * plug-ins/common/dicom.c: register a shorter menu label. 12425 12426 * plug-ins/common/gbr.c 12427 * plug-ins/common/gih.c 12428 * plug-ins/common/pat.c 12429 * plug-ins/common/url.c: register stock icons. 12430 124312004-07-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12432 12433 * plug-ins/Lighting/lighting_main.[ch] 12434 * plug-ins/Lighting/lighting_preview.[ch] 12435 * plug-ins/Lighting/lighting_shade.c 12436 * plug-ins/Lighting/lighting_ui.c: Made this plug-in support 12437 multiple light sources; implemented three, architecture now 12438 supports any number. Changed material properties to more intuitve 12439 names; added "metallic" property. Cleaned out some unused, 12440 commented-out code. 12441 124422004-07-16 Michael Natterer <mitch@gimp.org> 12443 12444 * tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of 12445 "libgimpbase/gimpparasite.h" for getting the GimpParasite type. 12446 12447 * tools/pdbgen/app.pl 12448 * tools/pdbgen/pdb/drawable.pdb 12449 * tools/pdbgen/pdb/edit.pdb 12450 * tools/pdbgen/pdb/gradients.pdb 12451 * tools/pdbgen/pdb/guides.pdb 12452 * tools/pdbgen/pdb/image.pdb: removed redundant #includes. 12453 12454 * tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic. 12455 Consistently fail if there is no currently queried plugin. 12456 12457 * app/pdb/*.c: regenerated. 12458 124592004-07-16 Michael Natterer <mitch@gimp.org> 12460 12461 * app/display/gimpdisplayshell-transform.c: made gtk-doc even 12462 happier; clarified meaning of the "use_offsets" parameter. 12463 124642004-07-16 Sven Neumann <sven@gimp.org> 12465 12466 * app/core/gimpdata.c: 12467 * app/display/gimpcanvas.c: 12468 * app/display/gimpdisplayshell.c 12469 * app/display/gimpdisplayshell-transform.c: corrected API 12470 documentation, removed trailing whitespace. 12471 12472 Please do always build the documentation if you add or change any 12473 gtk-doc comments. 12474 124752004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12476 12477 * app/display/gimpcanvas.c: 12478 * app/display/gimpdisplayshell-transform.c: added gtk-doc 12479 comments for all public functions that lack them. 12480 12481 * app/display/gimpdisplayshell.c: added a couple of 12482 gtk-doc comments. 12483 124842004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12485 12486 * app/core/gimpdata.c: added gtk-doc comments for 12487 public functions. 12488 124892004-07-15 Shlomi Fish <shlomif@iglu.org.il> 12490 12491 * plug-ins/gimpressionist/: normalized the identifiers of 12492 paper.c and paper.h. Made one variable local to the function 12493 instead of module static. 12494 124952004-07-15 Shlomi Fish <shlomif@iglu.org.il> 12496 12497 * plug-ins/gimpressionist/: normalized the ppmtools.c and 12498 ppmtool.h identifiers. Also fixed some (but not all) of the 12499 syntax. 12500 125012004-07-15 Philip Lafleur <plafleur@cvs.gnome.org> 12502 12503 * plug-ins/winicon/icoload.c: 12504 * plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber 12505 that fixes byte-swapping on big endian hosts. Fixes bug #147610. 12506 125072004-07-15 Sven Neumann <sven@gimp.org> 12508 12509 * plug-ins/helpbrowser/dialog.c 12510 * plug-ins/helpbrowser/uri.c: don't warn if no help pages are 12511 installed and the Home button is clicked. 12512 125132004-07-15 Michael Natterer <mitch@gimp.org> 12514 12515 * app/file/file-open.c (file_open_layer): don't crash if no 12516 layer or only one layer is visible. Fixes bug #143804. 12517 12518 * app/app_procs.c (app_run): fixed log domain registration. 12519 125202004-07-15 Michael Natterer <mitch@gimp.org> 12521 12522 * app/core/gimpviewable.[ch]: corrected API docs and fixed 12523 function parameter names to silent gtk-doc warnings. 12524 125252004-07-15 Michael Natterer <mitch@gimp.org> 12526 12527 * app/app_procs.c (app_run): register a log handler for the 12528 "Gimp-Menus" domain. 12529 125302004-07-15 Philip Lafleur <plafleur@cvs.gnome.org> 12531 12532 * plug-ins/common/mng.c: cleanup. 12533 125342004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12535 12536 * app/core/gimpviewable.c: added gtk-doc comments for public 12537 functions. 12538 125392004-07-15 Michael Natterer <mitch@gimp.org> 12540 12541 * app/actions/file-commands.h: reordered to match the .c file. 12542 12543 * app/core/gimpitem.c 12544 * app/vectors/gimpvectors-import.c: fixed API docs. 12545 125462004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> 12547 12548 * plug-ins/common/png.c: 12549 * plug-ins/common/mng.c: Fixed erroneously reported warning 12550 message when saving indexed layers with an alpha channel but 12551 no transparent pixels. 12552 125532004-07-14 Sven Neumann <sven@gimp.org> 12554 12555 * app/app_procs.c (app_run): register a log handler for the 12556 "Gimp-Actions" domain. 12557 125582004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12559 12560 * devel-docs/objects.txt: . . . and removed because it is 12561 redundant with devel-docs/app/app.hierarchy. 12562 125632004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12564 12565 * devel-docs/objects.txt: added file containing a map of Gimp's 12566 GObject hierarchy . 12567 125682004-07-14 Michael Natterer <mitch@gimp.org> 12569 12570 * app/display/gimpstatusbar.[ch]: massively changed: removed 12571 message_ids, the message mem chunk and all signals. Added new 12572 function gimp_statusbar_replace() which updates a message without 12573 moving it to the top of the stack. Fixes bug #120175. 12574 12575 * app/display/gimpdisplayshell-title.[ch]: renamed 12576 gimp_display_shell_update_title() to 12577 gimp_display_shell_title_update() and switched from pop()/push() 12578 to replace() so the title message keeps its place in the stack. 12579 Added new function gimp_display_shell_title_init() which push()es 12580 the title message to the stack. 12581 12582 * app/display/gimpdisplayshell.c (gimp_display_shell_new): call 12583 gimp_display_shell_title_init() so the "title" message is at the 12584 bottom of the stack. 12585 12586 * app/display/gimpdisplayshell-callbacks.c 12587 * app/display/gimpdisplayshell-handlers.c: changed accordingly. 12588 125892004-07-14 Sven Neumann <sven@gimp.org> 12590 12591 * plug-ins/script-fu/script-fu-console.[ch] 12592 * plug-ins/script-fu/script-fu.c 12593 * plug-ins/script-fu/siod-wrapper.[ch] 12594 * plug-ins/script-fu/siod/slib.c: applied a patch from Kevin 12595 Cozens that removes an unneeded pipe which was causing problems 12596 on long output from the SIOD interpreter (bug #139200). Also 12597 shortened the welcome message. 12598 125992004-07-14 Sven Neumann <sven@gimp.org> 12600 12601 * plug-ins/pagecurl/pagecurl.c: GUI polishing. 12602 126032004-07-14 Shlomi Fish <shlomif@iglu.org.il> 12604 12605 * plug-ins/gimpressionist/: Added more underscores to identifiers. 12606 Fixed some of the style issues (added whitespace before the '(' in 12607 function calls). 12608 126092004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> 12610 12611 * plug-ins/common/mng.c: Now writes a global palette chunk, and 12612 empty palette chunks for the frames that use it. This saves a 12613 bit of diskspace. 12614 126152004-07-14 Michael Natterer <mitch@gimp.org> 12616 12617 * app/core/gimpimage.c: added properties "gimp", "id", "width", 12618 "height" and "base-type". Moved all code from gimp_image_new() 12619 to GObject::constructor(). 12620 12621 * app/core/gimpimage-convert.c 12622 * app/core/gimpimage-crop.c 12623 * app/core/gimpimage-resize.c 12624 * app/core/gimpimage-rotate.c 12625 * app/core/gimpimage-scale.c 12626 * app/core/gimpimage-undo-push.c: set "width", "height" and 12627 "base-type" with g_object_set() so "notify" is emitted on the 12628 properties. 12629 12630 * app/core/gimpimage-undo.c (gimp_image_undo_pop_stack): 12631 freeze/thaw property notifications around undoing/redoing so they 12632 are not emitted in the middle of the undo operation. 12633 126342004-07-14 Michael Natterer <mitch@gimp.org> 12635 12636 * app/core/gimpitem.c: converted tabs to spaces, cleanup, 12637 reviewed new API docs. 12638 126392004-07-14 Sven Neumann <sven@gimp.org> 12640 12641 * plug-ins/common/tiff.c: applied a patch done by Brion Vibber 12642 and Philip Lafleur that fixes loading of CMYK TIFF images on 12643 big-endian hardware (bug #147328). 12644 126452004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> 12646 12647 * plug-ins/common/mng.c (respin_cmap): Properly check the return 12648 value of find_unused_ia_color(). The plugin will now save indexed 12649 MNGs correctly; fixes bug #139947. Also converted tabs to spaces. 12650 126512004-07-14 Michael Natterer <mitch@gimp.org> 12652 12653 Code review & cleanup: 12654 12655 * app/config/gimpguiconfig.[ch]: removed transparency-size, 12656 transparency-type and snap-distance properties... 12657 12658 * app/config/gimpdisplayconfig.[ch]: ...and added them here. 12659 12660 * app/display/gimpdisplayshell.c 12661 * app/tools/gimpmovetool.c: changed accordingly. 12662 12663 * app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a 12664 "max_memsize" parameter instead of looking it up in GimpGuiConfig. 12665 12666 * app/actions/image-commands.c: changed accordingly. 12667 12668 * app/core/gimparea.c 12669 * app/core/gimpdrawable.c: converted tabs to spaces, cleanup. 12670 12671 * app/core/gimpprojection.[ch]: renamed IdleRenderStruct to 12672 GimpProjectionIdleRender, reordered functions, cleanup. 12673 12674 * app/display/gimpdisplay-handlers.c 12675 * app/display/gimpdisplay.c: removed unused #includes. 12676 12677 * app/display/gimpdisplayshell.[ch] 12678 * app/display/gimpdisplayshell-close.c: renamed 12679 shell->warning_dialog to shell->close_dialog, some random 12680 cleanups. 12681 12682 * app/display/gimpdisplayshell-handlers.c 12683 * app/widgets/gimpselectioneditor.c: minor coding style cleanup. 12684 126852004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12686 12687 * app/core/gimpitem.c: added documentation comments to some 12688 of the functions. 12689 126902004-07-14 Michael Natterer <mitch@gimp.org> 12691 12692 * app/display/Makefile.am 12693 * app/display/gimpdisplayshell-close.[ch]: new files for 12694 gimp_display_shell_close() and its dialog & callback. 12695 12696 * app/display/gimpdisplayshell.[ch]: removed from here. 12697 12698 * app/actions/view-actions.c (view_close_view_cmd_callback): 12699 changed accordingly. 12700 127012004-07-14 Sven Neumann <sven@gimp.org> 12702 12703 * plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of 12704 a plethora of booleans. Added some macros for readability. Allow 12705 to use a reversed gradient for colorizing the curl. 12706 127072004-07-14 Michael Natterer <mitch@gimp.org> 12708 12709 * app/core/Makefile.am 12710 * app/core/core-types.h 12711 * app/core/gimppickable.[ch]: new interface which has 12712 get_image_type(), get_tiles() and get_color_at() methods. 12713 12714 * app/core/gimpdrawable.[ch] 12715 * app/core/gimpimagemap.[ch] 12716 * app/core/gimpprojection.[ch]: implement GimpPickableInterface 12717 and removed public get_colot_at() functions. 12718 12719 * app/core/gimpimage-pick-color.[ch]: removed typedef 12720 GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use 12721 gimp_pickable_pick_color() instead. 12722 12723 * app/core/gimpimage-contiguous-region.c 12724 * app/core/gimpimage-crop.c 12725 * app/gui/info-window.c 12726 * app/paint/gimpconvolve.c 12727 * app/paint/gimpsmudge.c 12728 * app/tools/gimpbycolorselecttool.c 12729 * app/tools/gimpimagemaptool.c 12730 * app/widgets/gimpselectioneditor.c: use GimpPickable functions 12731 instead of the various get_color_at() functions. Simplifies code 12732 which has a "sample_merged" boolean. Various cleanups. 12733 127342004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12735 12736 * plug-ins/gimpressionist/presets.c: Added underscores between 12737 words in function names according to the GIMP's (and common 12738 sense) convention. 12739 127402004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12741 12742 * plug-ins/gimpressionist/: Moved the global declarations of 12743 img_has_alpha and create_colorpage to more specialized headers. 12744 127452004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12746 12747 * plug-ins/gimpressionist/: Added the paper.h header for the functions 12748 defined in the paper.c module. (thus removing more declarations 12749 from gimpressionist.h) 12750 127512004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> 12752 12753 * plug-ins/gfig/gfig-dialog.c 12754 * plug-ins/gfig/gfig-preview.[ch} 12755 * plug-ins/gfig/gfig.h: Made Cancel work properly. Moved "show grid", 12756 "snap to grid", and "show image" checkbuttons back onto main 12757 interface. Eliminated GtkPreview and removed undef of 12758 GTK_DISABLE_DEPRECATED from gfig-preview.c. Removed some 12759 unused code. 12760 127612004-07-13 Sven Neumann <sven@gimp.org> 12762 12763 * plug-ins/gflare/gflare.c (preview_handle_idle): use 12764 gtk_widget_queue_draw_area() instead of the deprecated 12765 gtk_widget_draw() routine. 12766 12767 * plug-ins/gimpressionist/orientmap.c 12768 * plug-ins/gimpressionist/paper.c 12769 * plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw() 12770 instead of the deprecated gtk_widget_draw() routine. 12771 127722004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12773 12774 * plug-ins/gimpressionist/preview.c 12775 * plug-ins/gimpressionist/sizemap.c: 12776 eliminated two compile-time warnings. 12777 127782004-07-13 Michael Natterer <mitch@gimp.org> 12779 12780 Added a GimpProjection object which maintains the idle projection 12781 logic that was in GimpDisplay and takes care of constructing the 12782 projection even without any display open. Makes color picking and 12783 other reads from the projection work without display and fixes the 12784 major bug that we were constructing the projection n times (!) 12785 for n displays. 12786 12787 * app/core/Makefile.am 12788 * app/core/gimpimage-projection.[ch]: removed. 12789 12790 * app/core/core-types.h 12791 * app/core/gimpmarshal.list 12792 * app/core/gimparea.[ch] 12793 * app/core/gimpprojection.[ch] 12794 * app/core/gimpprojection-construct.[ch]: new files assembled from 12795 the pieces of gimpdisplay.c and gimpimage-projection.c. 12796 12797 * app/core/gimpimage.[ch]: create a GimpProjection. 12798 Removed explicit projection realloc calls because the projection 12799 connects to the relevant GimpImage signals now. 12800 Added gimp_image_coords_in_active_drawable(). 12801 12802 * app/display/Makefile.am 12803 * app/display/gimpdisplay-area.[ch]: removed. 12804 12805 * app/display/gimpdisplay.[ch]: stripped away the idle render stuff 12806 and just keep a list of update_areas which is painted on flush(). 12807 Removed gimp_display_coords_in_active_drawable(). 12808 12809 * app/display/gimpdisplay-foreach.[ch]: removed 12810 gimp_display_finish_draw(). 12811 12812 * app/core/gimpchannel.c 12813 * app/core/gimpimage-contiguous-region.c 12814 * app/core/gimpimage-convert.c 12815 * app/core/gimpimage-crop.c 12816 * app/core/gimpimage-merge.c 12817 * app/core/gimpimage-pick-color.c 12818 * app/core/gimpimage-scale.c 12819 * app/core/gimppalette-import.c 12820 * app/display/gimpdisplay-handlers.c 12821 * app/display/gimpdisplayshell-render.c 12822 * app/display/gimpdisplayshell.c 12823 * app/gui/info-window.c 12824 * app/tools/gimpbucketfilltool.c 12825 * app/tools/gimpbycolorselecttool.c 12826 * app/tools/gimpclonetool.c 12827 * app/tools/gimpcolortool.c 12828 * app/tools/gimpeditselectiontool.c 12829 * app/tools/gimpfliptool.c 12830 * app/tools/gimpimagemaptool.c 12831 * app/tools/gimpiscissorstool.c 12832 * app/tools/gimppainttool.c 12833 * app/tools/gimpselectiontool.c 12834 * app/tools/gimptransformtool.c 12835 * app/widgets/gimpselectioneditor.c: changed accordingly. 12836 128372004-07-13 Sven Neumann <sven@gimp.org> 12838 12839 * libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated. 12840 12841 * libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new(). 12842 12843 * plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog. 12844 12845 * plug-ins/Lighting/Makefile.am 12846 * plug-ins/Lighting/*.xpm: removed XPM files... 12847 12848 * configure.in 12849 * plug-ins/Lighting/images: ... and added them as PNG images here. 12850 These should be redone with antialiased edges. 12851 12852 * plug-ins/Lighting/lighting_stock.[ch] 12853 * plug-ins/Lighting/lighting_ui.c: register stock icons and use 12854 those instead of GimpPixmaps. 12855 12856 * plug-ins/MapObject/Makefile.am 12857 * plug-ins/MapObject/*.xpm: removed duplicated XPM files. 12858 12859 * plug-ins/MapObject/mapobject_stock.[ch]: register stock icons 12860 reusing the generated header from the Lighting plug-in. 12861 12862 * plug-ins/MapObject/mapobject_ui.c: use them. 12863 12864 * plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until 12865 GimpPixmap has been replaced here as well. 12866 128672004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12868 12869 * plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist 12870 will delete global presets if the user running GIMP has priviliges to 12871 do so). This was done by creating a function to check if a preset is 12872 global, and by making sure the delete button is in-sensitive when 12873 this is the case. 12874 128752004-07-13 Sven Neumann <sven@gimp.org> 12876 12877 * libgimpwidgets/gimpcolorbutton.c 12878 * libgimpwidgets/gimpcolornotebook.c 12879 * libgimpwidgets/gimpcolorscale.c 12880 * libgimpwidgets/gimpcolorscales.c 12881 * libgimpwidgets/gimpcolorselect.c 12882 * libgimpwidgets/gimpcolorselection.c 12883 * libgimpwidgets/gimpframe.c 12884 * libgimpwidgets/gimppickbutton.c 12885 * libgimpwidgets/gimpunitmenu.c: some code review and cosmetics. 12886 128872004-07-13 Shlomi Fish <shlomif@iglu.org.il> 12888 12889 * plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's 12890 identifiers (= variable names and function name) 12891 128922004-07-13 Sven Neumann <sven@gimp.org> 12893 12894 * app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL 12895 string values. 12896 128972004-07-13 Sven Neumann <sven@gimp.org> 12898 12899 * plug-ins/common/jpeg.c: override the output_message error 12900 handler in order to propagate warnings to the user interface 12901 (related to bug #145212). 12902 129032004-07-13 Sven Neumann <sven@gimp.org> 12904 12905 * app/core/gimp-utils.[ch]: added new function 12906 gimp_g_value_get_memsize() that attempts to calculate the memory 12907 requirements for a GValue. 12908 12909 * app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the 12910 new function to obtain a better estimate for the size of the text 12911 undo. 12912 129132004-07-13 Sven Neumann <sven@gimp.org> 12914 12915 * app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged 12916 a tiny memory leak. 12917 129182004-07-13 Sven Neumann <sven@gimp.org> 12919 12920 * app/core/gimpimage-undo.c: resurrected some bit-rotting debug 12921 code. Might become useful one day. 12922 129232004-07-13 Sven Neumann <sven@gimp.org> 12924 12925 * autogen.sh: when automake 1.8 is being used, require at least 12926 version 1.8.3. Earlier versions of the automake-1.8 series don't 12927 handle gimp-console correctly. 12928 129292004-07-13 Michael Natterer <mitch@gimp.org> 12930 12931 * app/config/gimpconfig-dump.c 12932 * app/display/gimpdisplayshell-title.c 12933 (gimp_display_shell_format_title): applied patch from Dave Neary 12934 which adds %B which expands to (modified) if the image is 12935 dirty. Also added %A which expands to (clean) because we also have 12936 a short indicator for the clean image. Fixes bug #130943. 12937 129382004-07-13 Sven Neumann <sven@gimp.org> 12939 12940 * app/Makefile.am: removed hack for gimp-console compilation. 12941 automake seems to handle it correctly all by itself. 12942 129432004-07-12 Michael Schumacher <schumaml@cvs.gnome.org> 12944 12945 * app/app_procs.c: added 12946 #ifdef G_OS_WIN32 12947 #include <windows.h> 12948 #endif 12949 129502004-07-12 Michael Natterer <mitch@gimp.org> 12951 12952 * app/widgets/gimpbufferview.[ch]: added a preview of the global 12953 buffer. 12954 129552004-07-12 Sven Neumann <sven@gimp.org> 12956 12957 * app/Makefile.am: make sure that gimp-console is enabled for 12958 'make dist'. Use it to dump the system gimprc and gimprc man-page. 12959 129602004-07-12 Michael Natterer <mitch@gimp.org> 12961 12962 * app/text/gimptextundo.[ch]: removed member "guint time"... 12963 12964 * app/core/gimpundo.[ch]: ...and added it here. 12965 12966 * app/tools/gimptexttool.c (gimp_text_tool_apply): changed 12967 accordingly. Reordered undo compression code to look like other 12968 pieces of code which do undo compression. 12969 129702004-07-12 Michael Natterer <mitch@gimp.org> 12971 12972 * app/core/gimpundo.[ch] 12973 * app/core/gimpitemundo.[ch] 12974 * app/text/gimptextundo.[ch]: removed all _new() functions and 12975 added properties and GObject::constructor() implementations 12976 instead. 12977 12978 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added 12979 "GType undo_gtype" parameter and allow to pass name-value pairs as 12980 "...". Use the new GParameter utility functions to construct the 12981 appropriate undo step with g_object_newv(). 12982 12983 (gimp_image_undo_push_item): removed. 12984 12985 (gimp_image_undo_push_undo): removed. Merged its code back into 12986 gimp_image_undo_push(), where it originally came from. 12987 12988 * app/core/gimpimage-undo-push.c 12989 * app/core/gimpundostack.c 12990 * app/paint/gimppaintcore-undo.c 12991 * app/tools/gimptransformtool-undo.c 12992 * app/widgets/gimpundoeditor.c: changed accordingly. 12993 129942004-07-12 Sven Neumann <sven@gimp.org> 12995 12996 * plug-ins/gfig/gfig-dialog.c 12997 * plug-ins/gfig/gfig-preview.c 12998 * plug-ins/gfig/gfig-style.c 12999 * plug-ins/gfig/gfig.c: some include cleanups. Use 13000 libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely. 13001 Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c. 13002 130032004-07-12 Michael Natterer <mitch@gimp.org> 13004 13005 * plug-ins/script-fu/scripts/round-corners.scm: applied patch from 13006 Dave Neary that changes the behavior from undo disable/enable to 13007 using an undo group if the script doesn't work on a copy of the 13008 image. Fixes bug #146344. 13009 130102004-07-12 Michael Natterer <mitch@gimp.org> 13011 13012 * menus/toolbox-menu.xml.in: applied patch from Brion Vibber 13013 which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358. 13014 130152004-07-12 Michael Natterer <mitch@gimp.org> 13016 13017 * app/core/gimp-modules.c: don't do anything if gimp->no_interface 13018 is TRUE. 13019 130202004-07-12 Michael Natterer <mitch@gimp.org> 13021 13022 Made the gimp-console binary compile. 13023 Finishes core/GUI separation and fixes bug #71514: 13024 13025 * configure.in: removed the crazy-hacker warning for 13026 --enable-gimp-console. 13027 13028 * app/Makefile.am: for gimp-console, copy app_procs.c to 13029 app_procs_console.c and compile it instead of app_procs.c with 13030 -DGIMP_CONSOLE_COMPILATION 13031 13032 * app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION 13033 to skip GUI stuff for the gimp-console case. 13034 Renamed app_gui_libs_init() to app_libs_init(), renamed 13035 app_gui_abort() to app_abort() and added app_exit() so everything 13036 that needs #ifdefs lives here now. 13037 13038 * app/main.c: changed accordingly. 13039 13040 * app/gui/gui.c (gui_abort): really abort (call exit()). 13041 130422004-07-12 Sven Neumann <sven@gimp.org> 13043 13044 * INSTALL: made the suggestion to use binary packages more 13045 prominent, mention --enable-gimp-console. 13046 130472004-07-12 Sven Neumann <sven@gimp.org> 13048 13049 * app/sanity.[ch]: removed the gtk+ sanity check here ... 13050 13051 * app/gui/gui.c: ... and do it here from gui_libs_init(). 13052 13053 * app/main.c: changed accordingly. 13054 130552004-07-12 Sven Neumann <sven@gimp.org> 13056 13057 * app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run 13058 our own main-loop like we already used to do when being run 13059 non-interactively. 13060 130612004-07-12 Michael Natterer <mitch@gimp.org> 13062 13063 * app/widgets/gimpdialogfactory.c 13064 (gimp_dialog_factories_set_busy_foreach) 13065 (gimp_dialog_factories_unset_busy_foreach): set/unset the busy 13066 cursor on all windows which have widget->window, not only for 13067 those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when 13068 dialogs are hidden while the busy cursor is active and later shown 13069 again. 13070 130712004-07-12 Michael Natterer <mitch@gimp.org> 13072 13073 * app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY 13074 property. Some minor cleanup. 13075 130762004-07-12 Michael Natterer <mitch@gimp.org> 13077 13078 * app/core/Makefile.am 13079 * app/core/gimp-gui.[ch]: new files defining a GimpGui vtable 13080 struct and contianing all the vtable wrapper functions. Reordered 13081 and renamed some functions for consistency. 13082 13083 * app/core/gimp.[ch]: removed all the vtable code. 13084 13085 * app/gui/gui-vtable.c: changed accordingly. 13086 130872004-07-12 Sven Neumann <sven@gimp.org> 13088 13089 * app/display/gimpdisplay-foreach.c 13090 (gimp_displays_get_dirty_images): remove images from the 13091 container when they become clean. Should move to the Gimp object. 13092 13093 * app/gui/quit-dialog.c: some cosmetic changes. 13094 130952004-07-12 Sven Neumann <sven@gimp.org> 13096 13097 * plug-ins/common/tiff.c: applied a patch from Brion Vibber that 13098 sets the 'Save color values from transparent pixels' insensitive 13099 when there's no alpha channel. 13100 131012004-07-11 Hans Breuer <hans@breuer.org> 13102 13103 * **/makefile.msc : updated 13104 app/actions/makefile.msc app/menus/makefile.msc : (new files) 13105 app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST 13106 13107 * libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c 13108 app/widgets/gimppropwidgets.c : bumped compiler version check, 13109 msvc6 still can't cast from unsigned __int64 to double 13110 13111 * app/actions/debug-actions.c : only use debug_*_callback 13112 and thus debug_action if ENABLE_DEBUG_MENU 13113 13114 * app/core/gimpalette-import.c : added gimpwin32-io.h 13115 13116 * plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/ 13117 13118 * plug-ins/common/screenshot.c : make it compile with msvc, 13119 but still no win32 specific implementation ... 13120 131212004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13122 13123 * plug-ins/gfig/gfig-dobject.h: fix commit error that 13124 broke build. 13125 131262004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13127 13128 * plug-ins/gfig/gfig-dialog.c 13129 * plug-ins/gfig/gfig-dobject.[ch] 13130 * plug-ins/gfig/gfig.c: added buttons to select an object, and 13131 raise or lower the selected object; also a few minor cleanups. 13132 131332004-07-11 Philip Lafleur <plafleur@cvs.gnome.org> 13134 13135 * app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a 13136 patch from Robert Ögren, moved here from toolbox_check_device(). 13137 Only change devices if the event came from a widget that accepts 13138 extension events. Fixes bug #115774. 13139 131402004-07-11 Michael Natterer <mitch@gimp.org> 13141 13142 * app/core/gimp-utils.[ch] (gimp_parameters_append) 13143 (gimp_parameters_append_valist) 13144 (gimp_parameters_free): new utility functions which create and 13145 destroy GParameter arrays for g_object_newv(). 13146 13147 * app/gui/gui-vtable.c (gui_pdb_dialog_new): use them. 13148 131492004-07-10 Michael Natterer <mitch@gimp.org> 13150 13151 Removed any remaining GUI dependency from the PDB wrappers: 13152 13153 * app/core/gimp.[ch]: added vtable entries for the display and 13154 help stuff. 13155 13156 * app/widgets/gimphelp.[ch]: renamed gimp_help() to 13157 gimp_help_show(). 13158 13159 * app/gui/gui-vtable.c: implement the new display and help vtable 13160 entries. 13161 13162 * tools/pdbgen/pdb.pl 13163 * tools/pdbgen/pdb/display.pdb 13164 * tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp 13165 object instead of using stuff from display/ and widgets/. 13166 13167 * tools/pdbgen/app.pl: removed bad hacks which enabled including 13168 stuff from gui/, display/ and widgets/. 13169 13170 * app/Makefile.am: link widgets-enums.o, display-enums.o and 13171 gimpdisplayoptions.o into the gimp-console binary because they are 13172 needed for the config system and don't depend on any GUI stuff. 13173 13174 * app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/ 13175 13176 * app/pdb/display_cmds.c 13177 * app/pdb/help_cmds.c: regenerated. 13178 131792004-07-10 Sven Neumann <sven@gimp.org> 13180 13181 * app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap. 13182 131832004-07-10 Sven Neumann <sven@gimp.org> 13184 13185 * app/display/gimpdisplay-foreach.[ch]: added new function 13186 gimp_displays_get_dirty_images(). 13187 13188 * app/gui/quit-dialog.c: show a container treeview of all dirty 13189 images in the quit dialog. Still work in progress... 13190 131912004-07-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13192 13193 * gimp/plug-ins/gfig/gfig-circle.c 13194 * gimp/plug-ins/gfig/gfig-dialog.c 13195 * gimp/plug-ins/gfig/gfig-dobject.c 13196 * gimp/plug-ins/gfig/gfig-ellipse.c 13197 * gimp/plug-ins/gfig/gfig-poly.c 13198 * gimp/plug-ins/gfig/gfig-preview.c 13199 * gimp/plug-ins/gfig/gfig-star.c 13200 * gimp/plug-ins/gfig/gfig-style.c 13201 * gimp/plug-ins/gfig/gfig-style.h 13202 * gimp/plug-ins/gfig/gfig.c 13203 * gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for 13204 fillable objects; other miscellaneous cleanups and minor fixes. 13205 132062004-07-09 Sven Neumann <sven@gimp.org> 13207 13208 * app/gui/gui.c: removed the quit dialog code here. 13209 13210 * app/gui/Makefile.am 13211 * app/gui/quit-dialog.[ch]: added new files that hold the old code 13212 for now. 13213 132142004-07-09 Michael Natterer <mitch@gimp.org> 13215 13216 * app/pdb/procedural_db.c: #include <glib-object.h> instead of 13217 <gtk/gtk.h>. 13218 132192004-07-09 Michael Natterer <mitch@gimp.org> 13220 13221 * app/gui/Makefile.am 13222 * app/gui/brush-select.[ch] 13223 * app/gui/font-select.[ch] 13224 * app/gui/gradient-select.[ch] 13225 * app/gui/palette-select.[ch] 13226 * app/gui/pattern-select.[ch]: removed... 13227 13228 * app/widgets/Makefile.am 13229 * app/widgets/widgets-types.h 13230 * app/widgets/gimppdbdialog.[ch] 13231 * app/widgets/gimpdataselect.[ch] 13232 * app/widgets/gimpbrushselect.[ch] 13233 * app/widgets/gimpgradientselect.[ch] 13234 * app/widgets/gimppaletteselect.[ch] 13235 * app/widgets/gimppatternselect.[ch] 13236 * app/widgets/gimpfontselect.[ch]: ...and added here as a 13237 hierarchy of widgets. 13238 13239 * app/widgets/gimpdatafactoryview.h: removed typdef 13240 GimpDataEditFunc, it's in widgets-types.h now. 13241 13242 * app/gui/convert-dialog.c: changed accordingly. 13243 13244 * app/core/gimp.[ch]: added vtable entries for creating, closing 13245 and setting PDB dialogs. 13246 13247 * app/gui/gui-vtable.c: implement the vtable entries using the new 13248 widgets. 13249 13250 * tools/pdbgen/pdb/brush_select.pdb 13251 * tools/pdbgen/pdb/font_select.pdb 13252 * tools/pdbgen/pdb/gradient_select.pdb 13253 * tools/pdbgen/pdb/palette_select.pdb 13254 * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of 13255 the Gimp object to create / manage the selection dialogs. The 13256 generated files don't depend on GUI stuff any longer. 13257 13258 * app/pdb/brush_select_cmds.c 13259 * app/pdb/font_select_cmds.c 13260 * app/pdb/gradient_select_cmds.c 13261 * app/pdb/palette_select_cmds.c 13262 * app/pdb/pattern_select_cmds.c: regenerated. 13263 132642004-07-09 Sven Neumann <sven@gimp.org> 13265 13266 * app/gui/file-save-dialog.c (file_save_overwrite): improved text 13267 of the dialog. 13268 132692004-07-09 Sven Neumann <sven@gimp.org> 13270 13271 * libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document 13272 that "help-func" and "help-id" properties have been added for 2.2. 13273 132742004-07-09 Sven Neumann <sven@gimp.org> 13275 13276 * app/widgets/gimphistogrameditor.c 13277 (gimp_histogram_editor_menu_update): reverted my last change. 13278 (gimp_histogram_editor_item_visible): fix the problem here instead. 13279 132802004-07-08 Michael Natterer <mitch@gimp.org> 13281 13282 * libgimpwidgets/gimpdialog.c: removed "role" property because 13283 GtkWindow has an equivalent property now. Added "help-func" and 13284 "help-id" construct properties. 13285 13286 * app/widgets/gimptexteditor.c 13287 * app/widgets/gimptooldialog.c 13288 * app/widgets/gimpviewabledialog.c: removed calls to 13289 gimp_help_connect() and pass help_func and help_id to 13290 g_object_new(). 13291 132922004-07-08 Michael Natterer <mitch@gimp.org> 13293 13294 * libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in 13295 API docs. 13296 132972004-07-08 Shlomi Fish <shlomif@iglu.org.il> 13298 13299 * plug-ins/gimpressionist/Presets: converted the newlines in the 13300 descriptions to whitespaces, so they'll simply wrap (in accordance 13301 with making the description label wrappable). 13302 133032004-07-08 Shlomi Fish <shlomif@iglu.org.il> 13304 13305 * plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most 13306 remaining non-static global variables static, and created functions 13307 that manipulate them. Created new headers. Renamed some variables and 13308 functions to make their names more menanigful. 13309 133102004-07-08 Sven Neumann <sven@gimp.org> 13311 13312 * app/widgets/gimphistogrameditor.c 13313 (gimp_histogram_editor_menu_update): set the active item of the 13314 combo-box after changing the visibility filter. 13315 133162004-07-08 Michael Natterer <mitch@gimp.org> 13317 13318 * app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify): 13319 same fix as below. 13320 133212004-07-08 Sven Neumann <sven@gimp.org> 13322 13323 * app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify): 13324 block gimp_prop_enum_combo_box_callback() before changing the 13325 combo-box. 13326 133272004-07-08 Sven Neumann <sven@gimp.org> 13328 13329 * app/widgets/gimpsessioninfo.c: only write aux-info for properties 13330 that have been changed from their default values. 13331 13332 * app/widgets/gimphistogrameditor.c: some code cleanup. 13333 133342004-07-08 Michael Natterer <mitch@gimp.org> 13335 13336 * app/widgets/gimpselectiondata.[ch]: added a "const gchar *format" 13337 parameter to gimp_selection_data_set_pixbuf() which selects the 13338 format in which to encode the pixbuf (was defaulting to "png" 13339 before). 13340 13341 * app/widgets/gimpclipboard.c: when copying, offer all formats which 13342 are savable with GdkPixbuf. Added a GimpClipboard struct which is 13343 attached to the Gimp and which stores all the persistent data 13344 needed by the clipboard. Renamed some private functions. 13345 13346 (unfortunately this change breaks pasting to AbiWord: 13347 http://bugzilla.abisource.com/show_bug.cgi?id=7068) 13348 133492004-07-08 Sven Neumann <sven@gimp.org> 13350 * app/config/gimpconfig-deserialize.c 13351 * app/config/gimpconfig-serialize.c: removed redundant casts. 13352 13353 * app/widgets/gimpsessioninfo.[ch]: added convenience functions to 13354 get and set aux-info based on object properties. 13355 13356 * app/widgets/gimphistogrameditor.c: use the new functions to save 13357 a histogram's channel and scale in the sessionrc. 13358 133592004-07-07 Sven Neumann <sven@gimp.org> 13360 13361 * app/widgets/gimpclipboard.c: sort the list of pixbuf formats so 13362 that PNG is the preferred format and GIF and JPEG come last. 13363 133642004-07-07 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13365 13366 * plug-ins/gfig/*.[ch]: Use single centralized functions to 13367 create, load, and save objects, instead of separate functions 13368 for each type of object. A few other miscellaneous fixes. 13369 133702004-07-07 Michael Natterer <mitch@gimp.org> 13371 13372 * app/widgets/gimpclipboard.[ch]: changed to allow pasting any 13373 GdkPixbuf supported format (makes pasting from OpenOffice 13374 work). Cleaned up a bit to perpare pasting of SVG data. 13375 133762004-07-07 Sven Neumann <sven@gimp.org> 13377 13378 * app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha 13379 channel if the src tile-manager doesn't have one. Warn on 13380 unsupported type conversions instead of silently doing the wrong 13381 thing. Fixes bug #145482. 13382 13383 * app/core/gimpbuffer.c: cosmetics. 13384 133852004-07-07 Michael Natterer <mitch@gimp.org> 13386 13387 * app/gui/Makefile.am 13388 * app/gui/clipboard.[ch]: removed... 13389 13390 * app/widgets/Makefile.am 13391 * app/widgets/gimpclipboard.[ch]: ...and added here. 13392 13393 * app/actions/edit-commands.c 13394 * app/gui/gui.c: changed accordingly. 13395 133962004-07-07 Michael Natterer <mitch@gimp.org> 13397 13398 Made the undo system robust against the currently pushed undo 13399 being too large according to prefs settings. Fixes bug #145379. 13400 13401 * app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo) 13402 (gimp_image_undo_group_end): emit "undo-event" *before* calling 13403 gimp_image_undo_free_space() so the undo history doesn't try to 13404 remove an item that has never been added. 13405 13406 (gimp_image_undo_push_undo): added boolean return value indicating 13407 if the undo could be pushed (FALSE means the undo was to large 13408 and was discarded right away). 13409 13410 (gimp_image_undo_push_item): return NULL if the above returned 13411 FALSE. 13412 13413 * app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer): 13414 changed accordingly. 13415 134162004-07-07 Manish Singh <yosh@gimp.org> 13417 13418 * plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings 13419 happened, cause that likely means corruption and libexif doesn't 13420 handle that very happily. Addresses bug #145212. Perhaps the error and 13421 warning messages should be propagated to the user in the GUI somehow, 13422 currently they are not. 13423 134242004-07-07 Michael Natterer <mitch@gimp.org> 13425 13426 * app/actions/edit-actions.c (edit_actions): added "..." to "Clear 13427 undo history" because it has a confirmation dialog. 13428 13429 * app/actions/edit-commands.c: cleanup: moved static functions to 13430 the end of the file and prototyped them. 13431 134322004-07-07 Sven Neumann <sven@gimp.org> 13433 13434 * app/widgets/gimphistogramview.c (gimp_histogram_view_expose): 13435 fixed a drawing bug I introduced earlier today. 13436 134372004-07-07 Michael Natterer <mitch@gimp.org> 13438 13439 * app/actions/view-actions.c 13440 * app/actions/view-commands.[ch]: added actions and callbacks for 13441 scrolling the view. Not used in menus but useful for controllers. 13442 134432004-07-07 Sven Neumann <sven@gimp.org> 13444 13445 * app/tools/gimpeditselectiontool.c 13446 (gimp_edit_selection_tool_key_press): adapt the arrow key velocity 13447 to the display scale factor. Please test and complain if you 13448 dislike this behaviour. 13449 13450 * themes/Default/images/Makefile.am 13451 * themes/Default/images/stock-color-pick-from-screen-16.png: new 13452 icon drawn by Jimmac. 13453 13454 * libgimpwidgets/gimpstock.[ch]: register the new icon. 13455 13456 * libgimpwidgets/gimppickbutton.c: use it for the screen color 13457 picker instead of reusing the color picker tool icon. 13458 134592004-07-06 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13460 13461 * plug-ins/gfig/*.[ch]: a bunch of code clean-up and 13462 debugging. Created "classes" for the objects, and 13463 attached functions to classes rather than objects. 13464 134652004-07-06 Sven Neumann <sven@gimp.org> 13466 13467 Added an RGB histogram based on a patch by Tor Lillqvist. Fixes 13468 bug #145401. 13469 13470 * app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export 13471 it to the PDB. 13472 13473 * app/base/gimphistogram.c: implemented histogram functions for 13474 the RGB mode. 13475 13476 * app/base/levels.c 13477 * app/tools/gimpcurvestool.c 13478 * app/tools/gimplevelstool.c 13479 * app/widgets/gimpcolorbar.c 13480 * app/widgets/gimphistogrameditor.c: handle the new enum value. 13481 13482 * app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode, 13483 draw a histogram that shows the RGB channels simultaneously 13484 134852004-07-06 Sven Neumann <sven@gimp.org> 13486 13487 * libgimpmodule/gimpmodule.c: comply with C99 aliasing rules. 13488 134892004-07-06 Michael Natterer <mitch@gimp.org> 13490 13491 * app/widgets/gimpwidgets-utils.c (gimp_menu_position) 13492 (gimp_button_menu_position): call gtk_menu_set_monitor() only 13493 for GTK+ < 2.4.4 and added a #warning about it. 13494 134952004-07-06 Sven Neumann <sven@gimp.org> 13496 13497 * plug-ins/gimpressionist: applied patch from Shlomi Fish that 13498 fixes confusion of filenames and user-visible object names (bug 13499 #132621). Also removed function remove_trailing_whitespace() that 13500 used to duplicate functionality from GLib and updated 13501 preset_create_filename(). 13502 135032004-07-06 Michael Natterer <mitch@gimp.org> 13504 13505 * app/widgets/gimppreviewrenderer.c 13506 (gimp_preview_renderer_set_viewable): queue an idle update when 13507 setting the viewable to NULL so the view gets cleared correctly. 13508 13509 (gimp_preview_renderer_idle_update): call 13510 gimp_preview_renderer_update() even if renderer->viewable is NULL 13511 so clearing the viewable gets propagated to the GUI. 13512 13513 Moved clearing the viewable and removing the idle from 13514 GObject::finalize() to GObject::dispose() because calling 13515 set_viewable() with a NULL viewable triggers typechecking casts 13516 and queuing idle functions, which is not nice in finalize(). 13517 135182004-07-06 Sven Neumann <sven@gimp.org> 13519 13520 * modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back 13521 $(LCMS_LIBS) that I had accidentally removed. 13522 135232004-07-06 Sven Neumann <sven@gimp.org> 13524 13525 * app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg): 13526 return the proper type. 13527 135282004-07-06 Michael Natterer <mitch@gimp.org> 13529 13530 * app/widgets/gimpcontainertreeview.c: connect to 13531 "editing-canceled" of the name cell renderer and restore the 13532 original text in the callback. Doesn't work reliably until GTK+ 13533 bug #145463 is fixed. 13534 135352004-07-05 Sven Neumann <sven@gimp.org> 13536 13537 * app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a 13538 compiler warning. 13539 13540 * plug-ins/common/dog.c: removed some redundant casts and other 13541 trivial cleanups. 13542 135432004-07-06 Michael Natterer <mitch@gimp.org> 13544 13545 * libgimpwidgets/gimpcontroller.h: removed #define 13546 GIMP_CONTROLLER_PARAM_SERIALIZE. 13547 13548 * libgimpmodule/gimpmoduletypes.h: added 13549 GIMP_MODULE_PARAM_SERIALIZE instead. 13550 13551 * modules/controller_linux_input.c 13552 * modules/controller_midi.c: changed accordingly. 13553 13554 * modules/cdisplay_colorblind.c 13555 * modules/cdisplay_gamma.c 13556 * modules/cdisplay_highcontrast.c 13557 * modules/cdisplay_proof.c: made the new properties serializable. 13558 135592004-07-05 Michael Natterer <mitch@gimp.org> 13560 13561 * tools/pdbgen/Makefile.am (enum_headers): don't scan 13562 app/paint-funcs/paint-funcs-types.h for enums. 13563 13564 * app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/ 13565 13566 * app/core/core-types.h: reordered opaque typedefs to somehow 13567 match the categories in the comments. 13568 135692004-07-05 Michael Natterer <mitch@gimp.org> 13570 13571 * app/core/core-types.h: removed enum SizeType. 13572 13573 * app/text/text-enums.h: added it as enum GimpSizeType and added 13574 comment that it's for backward compatibility only. 13575 13576 * tools/pdbgen/Makefile.am 13577 * tools/pdbgen/pdb/text_tool.pdb: changed accordingly. 13578 13579 * libgimp/gimpenums.h 13580 * plug-ins/pygimp/gimpenums.py 13581 * plug-ins/script-fu/script-fu-constants.c 13582 * tools/pdbgen/enums.pl: regenerated (pdbgen insisted on 13583 reordering the enums). 13584 135852004-07-05 Michael Natterer <mitch@gimp.org> 13586 13587 * app/core/core-types.h: #define MIN and MAX values for 13588 GimpCoords.pressure, .tilt and .wheel. 13589 13590 * app/display/gimpdisplayshell-callbacks.c 13591 (gimp_display_shell_get_event_coords) 13592 (gimp_display_shell_get_device_coords): use the #defines instead 13593 of hardcoded magic values when CLAMP()ing event or device values. 13594 135952004-07-05 Sven Neumann <sven@gimp.org> 13596 13597 * modules/Makefile.am: link all modules with libgimpmodule. 13598 135992004-07-05 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13600 13601 * plug-ins/common/dog.c: improved defaults. use gimp_invert() 13602 instead of rolling own. Use nasty hack to get previews to 13603 work with grayscale images. Accept grayscale images. 13604 136052004-07-05 Sven Neumann <sven@gimp.org> 13606 13607 * app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the 13608 basename parameter and use the object name instead. Convert it to 13609 the filesystem encoding. 13610 13611 * app/core/gimpdatafactory.c: changed accordingly. 13612 136132004-07-05 Sven Neumann <sven@gimp.org> 13614 13615 * plug-ins/gimpressionist: applied patch from Shlomi Fish that 13616 fixes a number of bugs in the gimpressionst plug-in (bug #145309). 13617 13618 Also added some const qualifiers, cleaned up includes and removed 13619 degtorad() and radtodeg() functions that used to duplicate 13620 functionality from libgimpmath. 13621 136222004-07-05 Michael Natterer <mitch@gimp.org> 13623 13624 * app/widgets/gimptemplateview.c 13625 (gimp_template_view_tree_name_edited): removed unused local variables. 13626 136272004-07-05 Sven Neumann <sven@gimp.org> 13628 13629 * plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an 13630 object. Removed trailing whitespace. 13631 13632 * plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration. 13633 136342004-07-05 Michael Natterer <mitch@gimp.org> 13635 13636 * app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize): 13637 return TRUE if initialization was successful. Makes the 13638 tool->drawable pointer being set correctly by the calling code and 13639 fixes bugs where colorize was leaving the drawable in a modified 13640 but non-undoable state when cancelling or changing images. 13641 136422004-07-05 Sven Neumann <sven@gimp.org> 13643 13644 * modules/cdisplay_proof.c: use object properties for the 13645 configurable values. 13646 136472004-07-05 Michael Natterer <mitch@gimp.org> 13648 13649 * app/core/gimpchannel.[ch]: added signal "color-changed" and emit 13650 it in gimp_channel_set_color() and gimp_channel_set_opacity(). 13651 13652 * app/core/gimpimage-qmask.[ch]: added new functions 13653 gimp_image_set,get_qmask_color(). 13654 13655 * app/core/gimpimage.[ch]: install a "color-changed" handler on 13656 gimage->channels and update gimage->qmask_color when the qmask's 13657 color changes. Fixes bug #145361. 13658 13659 * app/actions/qmask-commands.c: use the new qmask color API. 13660 136612004-07-04 Simon Budig <simon@gimp.org> 13662 13663 * app/actions/dialogs-commands.c 13664 * app/display/gimpdisplayshell-dnd.c 13665 * app/gui/preferences-dialog.c 13666 * app/tools/gimppainttool.c 13667 * app/widgets/gimpdeviceinfo.c 13668 * app/widgets/gimpitemtreeview.c 13669 * plug-ins/imagemap/imap_selection.c 13670 * tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP 13671 CVS compile with gcc 2.95 again. Mostly double semicolons and 13672 variable declarations after other stuff. Spotted by Martin 13673 Renold. 13674 13675 * app/pdb/gradients_cmds.c: regenerated. 13676 13677 (there is one issue left, see his patch at 13678 http://old.homeip.net/martin/gcc-2.95.diff, I did not 13679 copy the #define va_copy __va_copy, since I don't know 13680 what happens here.) 13681 136822004-07-04 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13683 13684 * plug-ins/gfig/gfig-dialog.[ch]: 13685 * plug-ins/gfig/gfig-style.[ch]: 13686 * plug-ins/gfig/notes.txt: New files. 13687 * plug-ins/gfig/*.[ch]: Complete reworking of the gfig plug-in. 13688 See 'notes.txt' for a summary of what has changed, and how to use 13689 it now. Plenty of bugs have been introduced, which will take a 13690 while to straighten out. 13691 136922004-07-04 Tor Lillqvist <tml@iki.fi> 13693 13694 * app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop 13695 a couple of unused variables. 13696 13697 * libgimpmodule/gimpmodule.def: Add gimp_module_register_enum. 13698 136992004-07-04 Sven Neumann <sven@gimp.org> 13700 13701 * libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(), 13702 a function to register an enum type for a GTypeModule. 13703 13704 * modules/cdisplay_colorblind.c: use an object property for the 13705 color deficiency enum. 13706 137072004-07-04 Sven Neumann <sven@gimp.org> 13708 13709 * plug-ins/common/channel_mixer.c: don't attempt to store a 13710 pointer to the last used filename in the plug-in parameter 13711 struct. Fixes bug #145380. 13712 137132004-07-04 Sven Neumann <sven@gimp.org> 13714 13715 * modules/cdisplay_gamma.c 13716 * modules/cdisplay_highcontrast.c: added object properties for 13717 configurable values. 13718 13719 * app/widgets/gimpcolordisplayeditor.c 13720 * libgimpwidgets/gimpcolordisplaystack.c 13721 * modules/cdisplay_colorblind.c 13722 * modules/cdisplay_proof.c: cosmetic changes. 13723 137242004-07-03 Michael Natterer <mitch@gimp.org> 13725 13726 * app/core/gimpcontext.[ch]: added context->serialize_props mask 13727 which enables specifying exactly which properties will be 13728 serialized. Also fixes a bug that prevented undefined properties 13729 from being serialized, breaking tool_options and device status 13730 serialization. 13731 13732 * app/core/gimptoolinfo.c (gimp_tool_info_new): make only the 13733 properties in the tool_info->context_props mask serializable, also 13734 configure/initialize tool_info->tool_options. 13735 13736 * app/tools/gimp-tools.c (gimp_tools_register): removed 13737 tool_options initialization that is now done in 13738 gimp_tool_info_new(). 13739 13740 * app/widgets/gimpdeviceinfo.c: make only the properties in 13741 GIMP_DEVICE_INFO_CONTEXT_MASK serializable. 13742 13743 * app/widgets/gimpdevicestatus.c: add the device table to its 13744 parent container again. Fixes "missing" devices. 13745 13746 * app/core/gimptooloptions.c 13747 * app/widgets/gimpdevices.c: cleanup / code review. 13748 137492004-07-03 Michael Natterer <mitch@gimp.org> 13750 13751 * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if 13752 the color tool is enabled, skip cursor hiding entirely. 13753 137542004-07-03 Sven Neumann <sven@gimp.org> 13755 13756 * plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't 13757 any longer needed. 13758 137592004-07-02 Philip Lafleur <plafleur@cvs.gnome.org> 13760 13761 * app/tools/gimptransformoptions.[ch]: 13762 * app/tools/gimptransformtool.c: 13763 * app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with 13764 a combobox with options "Outline", "Grid", "Image", and 13765 "Image + Grid". Addresses bug #108172. 13766 137672004-07-02 Sven Neumann <sven@gimp.org> 13768 13769 * app/actions/edit-actions.c: don't let the Paste menu items 13770 sensitivity depend on the availability of clipboard data because 13771 we aren't notified when the GDK clipboard changes. 13772 137732004-07-02 Sven Neumann <sven@gimp.org> 13774 13775 * app/gui/Makefile.am 13776 * app/gui/clipboard.[ch]: new files implementing a clipboard for 13777 image data based on GDK_SELECTION_CLIPBOARD (bug #133247). 13778 13779 * app/actions/edit-actions.c 13780 * app/actions/edit-commands.c: use the new clipboard API. 13781 13782 * app/gui/gui.c: initialize and shutdown the clipboard. 13783 13784 * app/core/gimpbuffer.c: cosmetics. 13785 13786 * app/actions/actions.c 13787 * app/menus/menus.c: added sanity checks to exit functions. 13788 13789 * app/display/gimpdisplayshell-dnd.[ch]: let 13790 gimp_display_shell_drop_svg() take a guchar * buffer. 13791 13792 * app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf): 13793 fixed the implementation. 13794 137952004-07-02 Michael Natterer <mitch@gimp.org> 13796 13797 * plug-ins/gimpressionist/Makefile.am 13798 * plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish 13799 that massively cleans up gimppressionist (touching all files and 13800 addding some new ones) and adds a simple PDB interface for 13801 selecting one of the previously created presets. 13802 Fixes bugs #145191, #144913 and #144922. 13803 138042004-07-01 Sven Neumann <sven@gimp.org> 13805 13806 * configure.in: bumped version number to 2.1.2. 13807 138082004-07-01 Michael Schumacher <schumaml@cvs.gnome.org> 13809 13810 * plug-ins/common/align_layers.c: there seems to be no reason why 13811 this plug-in should not work on INDEXED* images, added it to the 13812 registered image types 13813 138142004-07-01 Roman Joost <roman@bromeco.de> 13815 13816 * plug-ins/script-fu/scripts/blend-anim.scm 13817 * plug-ins/script-fu/scripts/glossy.scm 13818 * plug-ins/script-fu/scripts/test-sphere.scm: fixed typos 13819 138202004-07-01 Sven Neumann <sven@gimp.org> 13821 13822 * app/widgets/gimpselectiondata.[ch]: added (yet unused) functions 13823 gimp_selection_data_[get|set]_pixbuf(). 13824 138252004-07-01 Michael Natterer <mitch@gimp.org> 13826 13827 * app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion() 13828 and set the FG/BG depending on where the color was dropped. Also 13829 set the drag status accordingly so the cursor indicates whether 13830 dropping will have an effect or not. Fixes bug #145219. 13831 138322004-07-01 Sven Neumann <sven@gimp.org> 13833 13834 * app/core/gimptemplate.c: do like Liam taught us and use the 13835 golden ratio as default for new images. 13836 138372004-06-30 Philip Lafleur <plafleur@cvs.gnome.org> 13838 13839 * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): 13840 Chain up if the color tool is enabled. This fixes the problem of 13841 the color picker cursor not appearing when using a paint tool 13842 in color picking mode while "Show Paint Tool Cursor" is off. 13843 138442004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13845 13846 * libgimp/gimpdrawable.c: moved call to 13847 _gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to 13848 gimp_drawable_flush(), to resolve problem described in bug 13849 #145051. 13850 138512004-06-30 Michael Natterer <mitch@gimp.org> 13852 13853 * app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext 13854 parameter and use it to start plug-ins. 13855 13856 * app/core/gimp.c (gimp_real_restore): pass the user context. 13857 Restores script-fu's access to the global FG, FG, brush, ... 13858 138592004-06-30 Sven Neumann <sven@gimp.org> 13860 13861 * app/core/core-enums.c 13862 * app/display/display-enums.c 13863 * app/paint/paint-enums.c 13864 * app/text/text-enums.c 13865 * app/widgets/widgets-enums.c: regenerated. 13866 138672004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13868 13869 * app/actions/file-commands.c: revert previous change that was 13870 intended to fix bug #141971. 13871 138722004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> 13873 13874 * app/*/*-enums.h: did HIG-compliant capitalization in the right 13875 place, instead of the auto-generated *-enums.c files. 13876 138772004-06-30 Michael Natterer <mitch@gimp.org> 13878 13879 * app/widgets/gimpdnd.[ch] 13880 * app/widgets/gimpselectiondata.[ch] 13881 * app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris" 13882 to "uri_list" in all function names, parameters and typedefs. 13883 13884 * app/widgets/gimpcontainertreeview-dnd.c 13885 * app/widgets/gimpdocumentview.c 13886 * app/widgets/gimplayertreeview.c 13887 * app/widgets/gimptoolbox-dnd.c 13888 * app/display/gimpdisplayshell-dnd.[ch] 13889 * app/display/gimpdisplayshell.c: changed accordingly. 13890 138912004-06-30 Sven Neumann <sven@gimp.org> 13892 13893 * plug-ins/maze/maze_face.c: made the dialog look a little less 13894 clumsy. 13895 138962004-06-30 Sven Neumann <sven@gimp.org> 13897 13898 * tools/pdbgen/pdb/drawable.pdb 13899 * libgimp/gimppixbuf.c: raised the maximum size for thumbnails 13900 from 256 to 512 pixels. 13901 13902 * app/pdb/drawable_cmds.c 13903 * libgimp/gimpdrawable_pdb.c: regenerated. 13904 13905 * plug-ins/gfig/gfig-preview.c 13906 * plug-ins/gfig/gfig.c: redone Bill's fix using 13907 gimp_image_get_thumbnail(). A lot simpler, renders the alpha 13908 checkerboard and also works for grayscale images. 13909 139102004-06-30 Michael Natterer <mitch@gimp.org> 13911 13912 Fixed a 1.2 -> 2.0 regression that was forgotten: 13913 13914 * app/widgets/widgets-enums.[ch]: added enum GimpColorPickState 13915 which can be one of { NEW, UPDATE }. 13916 13917 * app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function 13918 gimp_palette_editor_update_color() to 13919 gimp_palette_editor_pick_color() and restored the functionality of 13920 creating/updating colors via this API 13921 13922 Changed button_press handler to only edit the color on double 13923 click if it's really a double click on the same color. 13924 Fixes bug #141381. 13925 13926 * app/tools/gimpcolorpickeroptions.[ch]: added boolean property 13927 "add-to-palette" and a GUI for it. 13928 13929 * app/core/gimpmarshal.list 13930 * app/tools/gimpcolortool.[ch]: added a GimpColorPickState 13931 parameter to the "color_picked" signal. Pass NEW on button_press 13932 and UPDATE on motion. 13933 13934 * app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked) 13935 * app/tools/gimplevelstool.c (gimp_levels_tool_color_picked) 13936 * app/tools/gimppainttool.c (gimp_paint_tool_color_picked): 13937 changed accordingly 13938 13939 * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked): 13940 If "add-to-palette" is TRUE, get the palette editor and call 13941 gimp_palette_editor_pick_color(). 13942 139432004-06-30 Sven Neumann <sven@gimp.org> 13944 13945 * app/widgets/gimpselectiondata.[ch]: renamed the SVG related 13946 functions so that they deal with an anonymous data stream that 13947 could as well be a PNG image. 13948 13949 * app/widgets/gimpdnd.[ch] 13950 * app/widgets/gimpcontainertreeview-dnd.c: changed accordingly. 13951 13952 * app/display/gimpdisplayshell-dnd.[ch] 13953 * app/vectors/gimpvectors-import.[ch] 13954 * app/widgets/gimpcontainertreeview-dnd.c 13955 * app/widgets/gimpvectorstreeview.c: use gsize for the length of 13956 the buffer. 13957 13958 * app/widgets/gimpdnd.[ch] 13959 * app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't 13960 used yet. 13961 139622004-06-30 Michael Natterer <mitch@gimp.org> 13963 13964 * app/core/gimppalette.[ch] (gimp_palette_add_entry): take 13965 const GimpRGB* instead of just GimpRGB*. 13966 Converted tabs to spaces. 13967 139682004-06-30 Michael Natterer <mitch@gimp.org> 13969 13970 * widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg): 13971 changed return value from gchar* to const gchar*. Renamed 13972 parameters to be consistent with other SVG functions. 13973 13974 * widgets/gimpcontainertreeview-dnd.c 13975 * widgets/gimpdnd.c: changed accordingly. 13976 139772004-06-30 Simon Budig <simon@gimp.org> 13978 13979 * app/vectors/gimpstroke.[ch] 13980 * tools/pdbgen/pdb/paths.pdb: Applied a modified patch from 13981 Geert Jordaens that implements the gimp-path-get-point-at-dist 13982 PDB function (fixes bug #138754). 13983 13984 * app/pdb/paths_cmds.c: regenerated. 13985 139862004-06-30 Michael Natterer <mitch@gimp.org> 13987 13988 * app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed): 13989 do like GtkAccelLabel does and turn underscores in accels into 13990 spaces so e.g. "Page_Up" becomes "Page Up". 13991 139922004-06-29 Michael Natterer <mitch@gimp.org> 13993 13994 * app/display/gimpdisplayshell.c: reordered drop destinations 13995 so vectors are preferred over SVG. 13996 13997 * app/vectors/gimpvectors-import.[ch]: added "gint position" 13998 parameter to all import functions so the imported vectors can be 13999 added at any position in the vectors stack. 14000 14001 * app/actions/vectors-commands.c 14002 * app/display/gimpdisplayshell-dnd.c 14003 * tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as 14004 position). 14005 14006 * app/pdb/paths_cmds.c: regenerated. 14007 14008 * app/widgets/gimpvectorstreeview.c: implemented SVG DND from and 14009 to the paths dialog. 14010 140112004-06-29 Michael Natterer <mitch@gimp.org> 14012 14013 * app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data 14014 after dropping, it's owned by GtkSelectionData. 14015 140162004-06-29 Michael Natterer <mitch@gimp.org> 14017 14018 * app/widgets/gimpdnd.c: use gtk_target_list_add() instead of 14019 gtk_target_list_add_table() because the latter prepends the 14020 targets to the internal list which screws the order (== priority) 14021 of DND targets. 14022 14023 * app/widgets/gimpselectiondata.c: added some more checks for 14024 failed drops (selection_data->length < 0). 14025 140262004-06-29 Philip Lafleur <plafleur@cvs.gnome.org> 14027 14028 * plug-ins/common/unsharp.c: The preview's row buffer was 14029 accidentally made way too large. 14030 140312004-06-29 Michael Natterer <mitch@gimp.org> 14032 14033 * app/widgets/gimpwidgets-utils.[ch]: added new function 14034 gimp_get_mod_string() which takes a GdkModifierType and returns 14035 correctly formated strings for all shift,control,alt combinations. 14036 14037 * app/tools/gimpbucketfilloptions.c 14038 * app/tools/gimpcolorpickeroptions.c 14039 * app/tools/gimpconvolvetool.c 14040 * app/tools/gimpcropoptions.c 14041 * app/tools/gimpdodgeburntool.c 14042 * app/tools/gimperasertool.c 14043 * app/tools/gimpflipoptions.c 14044 * app/tools/gimpmagnifyoptions.c 14045 * app/tools/gimpmoveoptions.c 14046 * app/tools/gimptransformoptions.c 14047 * app/tools/gimpvectoroptions.c 14048 * app/widgets/gimpchanneltreeview.c 14049 * app/widgets/gimpcolormapeditor.c 14050 * app/widgets/gimpdocumentview.c 14051 * app/widgets/gimperrorconsole.c 14052 * app/widgets/gimpgradienteditor.c 14053 * app/widgets/gimpitemtreeview.c 14054 * app/widgets/gimppaletteeditor.c 14055 * app/widgets/gimpselectioneditor.c 14056 * app/widgets/gimpthumbbox.c 14057 * app/widgets/gimptooloptionseditor.c 14058 * app/widgets/gimpvectorstreeview.c: use the new function instead 14059 of gimp_get_mod_name_shift(),control(),alt(),separator(). This 14060 kindof addresses the issue of configurable modifier keys but is 14061 actually indended to ease translation of format strings ("%s" is 14062 easier to get right than "%s%s%s"). 14063 140642004-06-28 Michael Natterer <mitch@gimp.org> 14065 14066 Allow all sorts of things to be dropped on or in between the 14067 items of a GimpContainerTreeView: 14068 14069 * app/widgets/gimpcontainertreeview.[ch]: added more parameters to 14070 GimpContainerTreeView::drop_possible() to specify where ecactly 14071 the drop should take place (between or into items) and to support 14072 dropping all sorts of things. 14073 14074 Renamed ::drop() to ::drop_viewable() and added ::drop_color(), 14075 ::drop_files() and ::drop_svg(), which cover all possible drop 14076 types. 14077 14078 * app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly. 14079 Dispatch all kinds of drops to the resp. virtual functions. 14080 14081 * app/widgets/gimpitemtreeview.c: changed accordingly. 14082 14083 * app/widgets/gimplayertreeview.c: allow to drop URIs, colors 14084 and patterns to the layers dialog. Fixes bugs #119506 and #139246. 14085 140862004-06-28 Michael Natterer <mitch@gimp.org> 14087 14088 * app/file/file-open.[ch] (file_open_layer): new utility function 14089 which opens an image, flattens it if needed and returns the only 14090 layer, converted for a passed destination image. 14091 14092 * app/display/gimpdisplayshell-dnd.c 14093 (gimp_display_shell_drop_files): use the new function. 14094 140952004-06-28 Michael Natterer <mitch@gimp.org> 14096 14097 * app/widgets/Makefile.am 14098 * app/widgets/gimpselectiondata.[ch]: new files containing the 14099 code which encodes/decodes all sorts of stuff to/from its 14100 GtkSelectionData representation. Used to live in gimpdnd.c 14101 14102 * app/widgets/gimpdnd.c: use the new functions (unclutters the 14103 file quite a bit), converted tabs to spaces. 14104 141052004-06-28 Michael Natterer <mitch@gimp.org> 14106 14107 * app/widgets/gimpcontainergridview.c: 14108 #include "libgimpwidgets/gimpwidgets.h" 14109 141102004-06-28 Michael Natterer <mitch@gimp.org> 14111 14112 Fixed bug #141930 while keeping bug #132322 fixed: 14113 14114 * app/base/curves.c (curves_lut_func) 14115 * app/base/levels.c (levels_lut_func): changed meaning of channel 14116 slots for GRAYA images: just as for GRAY images, expect the value 14117 channel in slot 0 and the alpha channel in slot 1, so it matches 14118 the meaning of slots of GimpHistogram (before this change, only 14119 GRAY images had their value in slot 0 and GRAYA images had it in 14120 slot 1, whereas the histogram had the value channel in slot 0, 14121 which was breaking auto levels for GRAYA images). 14122 14123 * app/tools/gimpcurvestool.c 14124 * app/tools/gimplevelstool.c 14125 * tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY 14126 and GRAYA images accordingly. 14127 14128 * app/tools/gimpcurvestool.c (curves_update) 14129 * app/tools/gimplevelstool.c (levels_update): call 14130 gimp_color_bar_set_buffers() with the right buffers. 14131 14132 * app/pdb/color_cmds.c: regenerated. 14133 141342004-06-28 Sven Neumann <sven@gimp.org> 14135 14136 * app/gui/gui.c (gui_initialize_after_callback): select the 14137 standard tool. 14138 14139 * app/tools/tool_manager.c: cosmetics. 14140 141412004-06-28 Michael Natterer <mitch@gimp.org> 14142 14143 * app/tools/gimplevelstool.c: reverted fix for bug #141930. These 14144 hacks are there because the enum used in levels doesn't match 14145 the enum used by the combo box and the histogram widget. 14146 141472004-06-28 Michael Natterer <mitch@gimp.org> 14148 14149 * app/tools/gimpclonetool.c (gimp_clone_tool_button_release): 14150 removed again (tools must not draw outside GimpDrawTool::draw()). 14151 14152 (gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active() 14153 because the draw function would not be called if the draw tool was 14154 inactive. Simplified check for whether or not to draw the src 14155 location. 14156 14157 * app/tools/gimppainttool.c (gimp_paint_tool_button_release): 14158 pause/resume the draw tool across all button_release actions so 14159 tools (clone) have a chance to draw different things depending on 14160 gimp_tool_control_is_active(tool->control). Fixes bug #145022. 14161 141622004-06-28 Sven Neumann <sven@gimp.org> 14163 14164 * app/actions/actions.c (action_select_object): added missing 14165 return value. 14166 141672004-06-28 Sven Neumann <sven@gimp.org> 14168 14169 * plug-ins/common/dog.c: applied HIG rules to the GUI and slightly 14170 rearranged it to get a more compact layout. Applied GIMP coding 14171 style. 14172 141732004-06-28 Sven Neumann <sven@gimp.org> 14174 14175 * libgimp/gimpdrawable.c: removed wrong note about using 14176 _gimp_tile_cache_flush_drawable() from the API docs. 14177 141782004-06-28 Sven Neumann <sven@gimp.org> 14179 14180 * plug-ins/common/dog.c (dog): ifdef'ed out calls to 14181 _gimp_tile_cache_flush_drawable() since it can't be used from a 14182 plug-in. Removed trailing whitespace and redundant includes. 14183 14184 * libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again. 14185 141862004-06-28 Simon Budig <simon@gimp.org> 14187 14188 * app/tools/gimpvectortool.c: fixed drawing code to properly 14189 update after deleting nodes via BackSpace/Delete. 14190 141912004-06-27 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14192 14193 * app/tools/gimplevelstool.c: removed two small chunks of code. 14194 Fixes bug #141930. Possibly unfixes bug #132322. 14195 141962004-06-27 Michael Schumacher <schumaml@cvs.gnome.org> 14197 14198 * libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because 14199 it is used in a plug-in. See bug #145051. 14200 142012004-06-26 Philip Lafleur <plafleur@cvs.gnome.org> 14202 14203 * plug-ins/common/unsharp.c: Preview now works correctly with 14204 RGBA and grayscale-alpha images. Fixes bug #144971. 14205 142062004-06-26 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14207 14208 * app/tools/gimpclonetool.c: added button_release callback 14209 to fix bug #145022. 14210 142112004-06-26 Philip Lafleur <plafleur@cvs.gnome.org> 14212 14213 * plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source 14214 is grayscale or grayscale-alpha. Partial fix for bug #144971. 14215 142162004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14217 14218 * plug-ins/common/unsharp.c: speed up preview by allocating tile 14219 cache before creating dialog. Should fix bug #144972. 14220 142212004-06-25 Philip Lafleur <plafleur@cvs.gnome.org> 14222 14223 * plug-ins/common/zealouscrop.c: Moved Zealous Crop from 14224 <Image>/Layer/Crop to <Image>/Image/Crop because it affects the 14225 entire image. 14226 142272004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14228 14229 * plug-ins/common/dog.c: added Difference of Gaussians edge 14230 detect plug-in. 14231 14232 * plug-ins/common/plugin-defs.pl: 14233 * plug-ins/common/Makefile.am: added dog and regenerated 14234 Makefile. 14235 142362004-06-25 Michael Natterer <mitch@gimp.org> 14237 14238 * app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET 14239 actions which set a generated brush's properties directly. 14240 14241 * app/actions/context-commands.c: adjust the range of possible 14242 brush radius and aspect_ratio values to be actually usable. 14243 142442004-06-25 Michael Natterer <mitch@gimp.org> 14245 14246 * app/core/gimpbrushgenerated.[ch]: reordered parameters and 14247 members to be consistent with other places where generated 14248 brushes are used. Check for errors when loading a brush and 14249 utf8-validate its name. Cleanup. 14250 14251 * app/core/gimpbrush.c 14252 * app/core/gimpbrushpipe.c: cleanup. 14253 142542004-06-25 Michael Natterer <mitch@gimp.org> 14255 14256 * app/gui/preferences-dialog.c (prefs_dialog_new): work around 14257 GTK+ bug #143270 (set the cursor on the selected model path 14258 instead of selecting the iter in the selection). Fixes random 14259 theme switching when selecting the "Theme" page. 14260 142612004-06-25 Michael Natterer <mitch@gimp.org> 14262 14263 * app/core/gimpbrushgenerated.c: added properties for all brush 14264 parameters. 14265 14266 * app/widgets/gimpbrusheditor.c: listen to property changes of the 14267 edited brush and update the scales accordingly. 14268 142692004-06-25 Michael Natterer <mitch@gimp.org> 14270 14271 * app/gui/preferences-dialog.c: more work on the controller page, 14272 made integer controller properties editable. 14273 14274 * modules/controller_midi.c: allow to specify the MIDI channel to 14275 generate events from. Default to -1 (all channels). 14276 142772004-06-24 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14278 14279 * plug-ins/gfig/gfig.[ch]: 14280 * plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the 14281 image as background for its preview, if the image is RGB and "Show 14282 image" is checked in the Options tab. (Next best thing to 14283 previewing in the image.) 14284 142852004-06-25 Michael Natterer <mitch@gimp.org> 14286 14287 * app/widgets/gimpcontrollerinfo.[ch]: added a boolean property 14288 "debug-events" and honor it when printing debugging output. 14289 Should add an event console window so the user doesn't need to 14290 have a terminal to inspect input module output. 14291 14292 * app/gui/prefereces-dialog.c: HIGified some forgotten labels. 14293 Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors". 14294 Replaced some forgotten "Dir" with "Folder". 14295 Made more GimpControllerInfo and GimpController properties 14296 editable and cleaned up the controller page. 14297 142982004-06-25 Michael Natterer <mitch@gimp.org> 14299 14300 * app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new(). 14301 14302 * app/widgets/gimpgrideditor.c: HIGified capitalization. 14303 143042004-06-25 Michael Natterer <mitch@gimp.org> 14305 14306 * modules/controller_linux_input.c 14307 * modules/controller_midi.c: remember the source ID returned by 14308 g_io_add_watch() and remove it when changing the device, so the 14309 file descritor gets actually closed. Minor cleanups. 14310 143112004-06-24 Michael Natterer <mitch@gimp.org> 14312 14313 * app/widgets/gimpcontrollerwheel.[ch]: renamed function 14314 gimp_controller_wheel_scrolled() to 14315 gimp_controller_wheel_scroll(). 14316 14317 * app/display/gimpdisplayshell-callbacks.c 14318 (gimp_display_shell_canvas_tool_events): changed accordingly. 14319 143202004-06-24 Michael Natterer <mitch@gimp.org> 14321 14322 * etc/controllerrc: fix typo in wheel controller mapping. 14323 143242004-06-24 Michael Natterer <mitch@gimp.org> 14325 14326 * app/tools/gimptool.[ch] 14327 * app/tools/tool_manager.[ch]: added boolean return value to 14328 GimpTool::key_press() which indicates if the event was handled. 14329 14330 * app/tools/gimpcroptool.c 14331 * app/tools/gimpeditselectiontool.[ch] 14332 * app/tools/gimptransformtool.c 14333 * app/tools/gimpvectortool.c: return TRUE if the key event was handled. 14334 14335 * app/tools/gimppainttool.c: removed key_press() implementation. 14336 14337 * app/widgets/Makefile.am 14338 * app/widgets/widgets-types.h 14339 * app/widgets/gimpcontrollerkeyboard.[ch]: new controller class 14340 which takes GdkEventKey and emits controller events for all 14341 combinations of modifiers and cursor keys. 14342 14343 * app/widgets/gimpcontrollers.[ch]: added new function 14344 gimp_controllers_get_keyboard(). 14345 14346 * app/display/gimpdisplayshell-callbacks.c: if a key event was not 14347 handled by the active tool, dispatch it to the keyboard controller. 14348 14349 * etc/controllerrc: add a keyboard controller which is configured 14350 to do the same as the removed gimp_paint_tool_key_press(). 14351 143522004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14353 14354 * libgimp/gimpdrawable.c: added some documentation for 14355 a few important functions with no API docs. 14356 143572004-06-24 Sven Neumann <sven@gimp.org> 14358 14359 * Made 2.1.1 release. 14360 143612004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14362 14363 * app/actions/file-commands.c: make "Revert" only ask for 14364 confirmation if image is dirty. Fixes bug #141971. 14365 143662004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14367 14368 * app/gui/*.c: 14369 * app/widgets/*.c: 14370 * etc/templaterc: HIGify capitalization. Should finish bug #123699 14371 except for everything I missed or got wrong. 14372 143732004-06-24 Sven Neumann <sven@gimp.org> 14374 14375 * etc/controllerrc: commented out the linux_input controller 14376 configuration. 14377 143782004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14379 14380 * app/tools/*.c: HIGify capitalization for dialogs. More 14381 progress on bug #123699. 14382 143832004-06-23 Michael Natterer <mitch@gimp.org> 14384 14385 * modules/controller_midi.c: added utility function midi_event() 14386 which assembles a GimpControllerEventValue and emits it. 14387 143882004-06-23 Michael Natterer <mitch@gimp.org> 14389 14390 * app/widgets/gimpenumaction.[ch] 14391 * app/widgets/gimppluginaction.[ch] 14392 * app/widgets/gimpstringaction.[ch]: added parameters to the 14393 gimp_*_action_selected() function so the "selected" signal can be 14394 emitted with value != action->value. Changed GtkAction::activate() 14395 implementations accordingly (pass action->value). 14396 14397 * app/widgets/gimpcontrollers.c: call gimp_enum_action_selected() 14398 and pass the value of the GimpControllerEventValue instead of 14399 temporarily replacing action->value and calling 14400 gtk_action_activate(). 14401 14402 * app/widgets/gimpcontrollerinfo.c: fixed debugging output. 14403 144042004-06-23 Michael Natterer <mitch@gimp.org> 14405 14406 * app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is 14407 G_SIGNAL_RUN_LAST so we can connect before and after the default 14408 implementation. Moved the brush setting and outline invalidation 14409 stuff to its default implementation. Also remember the outline's 14410 width and height. Call gimp_brush_core_set_brush() from 14411 gimp_brush_core_invalidate_cache() so "set-brush" is emitted 14412 whenever a generated brush becomes dirty. 14413 14414 * app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't 14415 pause/resume but rather stop/start the draw_tool. Fixes straight 14416 line preview aretefacts. 14417 14418 (gimp_paint_tool_oper_update): set the brush_core's brush before 14419 starting the draw_tool. 14420 14421 (gimp_paint_tool_draw): never free the brush_core's cached brush 14422 outline because the brush_core does that by itself now. 14423 14424 (gimp_paint_tool_set_brush) 14425 (gimp_paint_tool_set_brush_after): new callbacks which pause and 14426 resume the draw_tool. Fixes brush outline artefacts when modifying 14427 the current brush e.g. by using the mouse wheel. 14428 144292004-06-23 Michael Natterer <mitch@gimp.org> 14430 14431 * app/actions/context-commands.h: removed enum GimpContextSelectType. 14432 14433 * app/actions/actions-types.h: added enum GimpActionSelectType. 14434 14435 * app/actions/actions.[ch]: added utility functions 14436 action_select_value() and action_select_object(). 14437 14438 * app/actions/context-actions.c 14439 * app/actions/context-commands.c: changed accordingly. 14440 14441 * app/actions/layers-actions.c 14442 * app/actions/layers-commands.[ch]: merged the layer select 14443 callbacks into one using the GimpActionSelectType functions. Added 14444 actions and callbacks for modifying the active layer's opacity. 14445 14446 * app/menus/menus-types.h: #incude "actions/action-types.h". 14447 14448 * app/gui/gui-types.h: #incude "menus/menus-types.h". 14449 14450 * app/gui/preferences-dialog.c: allow to enable/disable input 14451 controllers. 14452 144532004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14454 14455 * app/tools/gimpcurvestool.c: try again to revert. 14456 144572004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14458 14459 * app/tools/gimpcurvestool.c: reverted. 14460 144612004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14462 14463 * plug-ins/script-fu/scripts: HIG-ified capitalization on 14464 all. Finishes this for everything in plug-ins. Bug #123699 is 14465 now mostly fixed. 14466 144672004-06-22 Sven Neumann <sven@gimp.org> 14468 14469 * app/composite/gimp-composite-regression.c: define timersub() 14470 macro in case it's undefined. Patch by Tim Mooney, fixes 'make 14471 check' on Tru64 (bug #144780). 14472 144732004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14474 14475 * app/tools/gimpcurvestool.c: added Store/Recall buttons for 14476 one-click saving and loading of curves. Should create stock 14477 labels for them. Hopefully resolves bug #75558. 14478 144792004-06-22 Michael Natterer <mitch@gimp.org> 14480 14481 * app/actions/view-actions.c 14482 * app/actions/view-commands.[ch]: added actions & callbacks to 14483 configure the canvas padding color. 14484 14485 * app/widgets/gimphelp-ids.h 14486 * menus/image-menu.xml.in: added the actions' help IDs and menu entries. 14487 14488 * app/display/display-enums.h: added /*< skip >*/'ed enum value 14489 GIMP_CANVAS_PADDING_MODE_RESET. 14490 14491 * app/display/gimpdisplayshell-appearance.c 14492 * app/display/gimpdisplayshell-callbacks.[ch] 14493 * app/display/gimpdisplayshell-handlers.c 14494 * app/display/gimpdisplayshell.[ch]: removed the canvas padding 14495 button and its popup menu (fixes bug #142996). Instead, added a 14496 toggle button which allows to zoom the image when the window is 14497 resized (as known from sodipodi, except it doesn't work as nice 14498 yet :-) improvements to the algorithm are welcome). 14499 Cleaned up the GimpDisplayShell struct a bit and renamed some 14500 of its members. 14501 14502 * libgimpwidgets/gimpstock.[ch] 14503 * themes/Default/images/Makefile.am 14504 * themes/Default/images/stock-zoom-follow-window-12.png: added new 14505 icon for the new display toggle button. 14506 145072004-06-22 Michael Natterer <mitch@gimp.org> 14508 14509 * app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up 14510 unconditionally now that we draw the brush outline while 14511 painting. Fixes brush outline artefacts on button_press and 14512 button_release. Spotted by sjburges. 14513 145142004-06-22 Sven Neumann <sven@gimp.org> 14515 14516 * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset 14517 the filename if the image is unnamed. 14518 14519 * configure.in 14520 * app/sanity.c: depend on gtk+ >= 2.4.1. 14521 14522 * app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris() 14523 to gimp_thumb_box_take_uris() since the function takes ownership 14524 of the list, 14525 14526 * app/widgets/gimpfiledialog.c: changed accordingly. Removed code 14527 that worked around a problem in gtk+ < 2.4.1. 14528 145292004-06-22 Sven Neumann <sven@gimp.org> 14530 14531 * libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use 14532 gimp_rgb_distance() for flat color areas. Fixes bug #144786. 14533 145342004-06-22 Sven Neumann <sven@gimp.org> 14535 14536 * tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a 14537 generated file, need to do the documentation change here. 14538 14539 * app/pdb/fileops_cmds.c 14540 * libgimp/gimpfileops_pdb.c: regenerated. 14541 145422004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14543 14544 * app/tools/gimptransformoptions.c: use radio buttons 14545 for constraint options. Makes all options visible, 14546 should resolve bug #68106. 14547 145482004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14549 14550 * app/gui/file-save-dialog.c: to reduce clutter, hide overwrite 14551 query dialog after user has responded. 14552 145532004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14554 14555 * plug-ins/common/noisify.c: changed handling of alpha 14556 channel in an attempt to deal with bug #72853. 14557 Changed menu entry from "Noisify" to "Scatter RGB". 14558 145592004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14560 14561 * app/pdb/fileops_cmds.c: fixed incorrect documentation for 14562 gimp_file_load, which was the root cause of bug #118811. 14563 145642004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14565 14566 * plug-ins: finish implementing HIG capitalization in dialogs. 14567 Scripts remain to be done. More progress on bug #123699. 14568 145692004-06-21 Michael Natterer <mitch@gimp.org> 14570 14571 * app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed 14572 value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job 14573 of GDK to do that (it was GDK that was broken, not some of the X 14574 servers). 14575 14576 * app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the 14577 cursor's pixels for GTK+ < 2.4.4. 14578 145792004-06-21 Sven Neumann <sven@gimp.org> 14580 14581 * app/gui/gui.c (gui_exit_callback): improved message in quit 14582 dialog just in case that we don't manage to redo this dialog 14583 before 2.2. 14584 145852004-06-21 Sven Neumann <sven@gimp.org> 14586 14587 * libgimpwidgets/gimpwidgets.[ch] 14588 * libgimpwidgets/gimpwidgets.def: added new utility function 14589 gimp_label_set_attributes(). 14590 14591 * app/display/gimpdisplayshell.c 14592 * app/gui/preferences-dialog.c 14593 * app/gui/resolution-calibrate-dialog.c 14594 * app/widgets/gimpviewabledialog.c 14595 * app/widgets/gimpwidgets-utils.c: use the new function. 14596 14597 * app/widgets/gimpcontainergridview.c 14598 * app/widgets/gimphistogrameditor.c: display the name in italic. 14599 14600 * plug-ins/common/jpeg.c: display the file size in italic. 14601 146022004-06-20 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14603 14604 * plug-ins/common/url.c: if url does not end in a recognized 14605 extension, open it as an unnamed image. Fixes bug #118811. 14606 146072004-06-20 Sven Neumann <sven@gimp.org> 14608 14609 * app/widgets/gimphistogrambox.[ch]: removed the label between the 14610 spinbuttons, it looks silly. Converted tabs to spaces, removed 14611 trailing whitespace. 14612 14613 * app/widgets/gimphistogrameditor.c 14614 * app/tools/gimpthresholdtool.c: changed accordingly. 14615 146162004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14617 14618 * plug-ins: changed dialogs to follow HIG capitalization style 14619 wherever they didn't. Scripts remain to be done. Partially 14620 fixes bug #123699. 14621 146222004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14623 14624 * app/widgets/gimphistogrambox.[ch]: 14625 * app/tools/gimpthresholdtool.c: Changed the threshold tool dialog 14626 so that it uses a two-triangle-slider scale of the sort used in the 14627 levels tool. Almost all of the changes are actually in the 14628 histogram-box widget code, which is only used by the threshold 14629 tool. Fixes bug #137521. 14630 146312004-06-20 Sven Neumann <sven@gimp.org> 14632 14633 * plug-ins/common/jpeg.c: removed redundant hboxes and other 14634 layout cleanups. 14635 146362004-06-20 Philip Lafleur <plafleur@cvs.gnome.org> 14637 14638 * app/display/gimpdisplayshell-scale.[ch]: 14639 * app/display/gimpnavigationview.[ch]: 14640 * app/actions/view-actions.c: 14641 * app/actions/view-commands.[ch]: 14642 * app/widgets/gimphelp-ids.h: 14643 * menus/image-menu.xml.in: Changed "Zoom to Fit Window" command 14644 to "Fit Image in Window" and added another command, "Fit Image 14645 to Window", that zooms according to the opposite dimension. Fixes 14646 bug #144597. 14647 146482004-06-19 Michael Schumacher <schumaml@cvs.gnome.org> 14649 14650 * libgimpwidgets/gimpwidgets.def: added missing 14651 gimp_controller_* entries 14652 146532004-06-19 Michael Schumacher <schumaml@cvs.gnome.org> 14654 14655 * modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK 14656 146572004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14658 14659 * plug-ins/common/jpeg.c: more changes to save dialog. Moved 14660 comment field to Advanced area. Don't set restart marker 14661 frequency stuff insensitive. Changed range for quality 14662 scale from 0-1 to 0-100 to follow the jpeg spec (but left 14663 allowable range for pdb at 0-1 to avoid breaking anything). 14664 146652004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14666 14667 * app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which 14668 worked incorrectly for two of the control points. 14669 146702004-06-19 Michael Natterer <mitch@gimp.org> 14671 14672 * modules/controller_midi.c (midi_read_event): simplified 14673 swallowing of SysEx messages and unwanted data bytes. Reordered 14674 and commented stuff to be more readable. 14675 146762004-06-19 Michael Natterer <mitch@gimp.org> 14677 14678 * modules/Makefile.am 14679 * modules/controller_midi.c: new controller for MIDI input. Maps 14680 all note on and note off events and all MIDI controllers to 14681 GimpContollerEvents. Should parse any MIDI stream. Code based on 14682 blinkenmedia stuff from Daniel Mack. 14683 146842004-06-19 Sven Neumann <sven@gimp.org> 14685 14686 Applied a patch from Geert Jordaens that implements the 14687 GtkStatusbar functionality in GimpStatusbar so that we can redo it 14688 in order to fix bug #120175: 14689 14690 * app/core/gimpmarshal.list: added VOID: UINT, STRING. 14691 14692 * app/display/gimpstatusbar.[ch]: copied GtkStatusbar code. 14693 14694 * app/display/gimpdisplayshell.c: changed accordingly. 14695 146962004-06-19 Sven Neumann <sven@gimp.org> 14697 14698 * plug-ins/ifscompose/ifscompose_utils.c (create_brush): use 14699 G_SQRT2; some coding style cleanups. 14700 147012004-06-19 Sven Neumann <sven@gimp.org> 14702 14703 * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved 14704 array initialization out of variable declaration (bug #144632). 14705 147062004-06-19 Sven Neumann <sven@gimp.org> 14707 14708 * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use 14709 G_SQRT2 to make circlemagic a constant value so we can initialize 14710 the array on declaration. Fixes bug #144632. 14711 147122004-06-19 Sven Neumann <sven@gimp.org> 14713 14714 * devel-docs/parasites.txt: document "exif-data" parasite. 14715 147162004-06-18 Manish Singh <yosh@gimp.org> 14717 14718 * plug-ins/common/film.c: Don't use deprecated gimp_text functions, 14719 clean up font name string handling a bit, default is now "Monospace" 14720 instead of "Courier". 14721 147222004-06-19 Michael Natterer <mitch@gimp.org> 14723 14724 * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped): 14725 start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble. 14726 Assume the double value is in a [0.0..1.0] range and temporarily 14727 change the value of the called GimpEnumAction to a range of 14728 [0..1000] when invoking it. All still very hackish... 14729 147302004-06-19 Michael Natterer <mitch@gimp.org> 14731 14732 * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event): 14733 more debugging output. 14734 147352004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14736 14737 * app/tools/gimpscaletool.c: changed algorithm for scaling when 14738 aspect ratio is constrained, to fix strange behavior described 14739 in bug # 68106. 14740 147412004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14742 14743 * plug-ins/common/jpeg.c: redid save dialog along lines suggested 14744 in bug # 138929 14745 14746 Only create an exif data parasite on loading file if the file actually 14747 contains exif data. 14748 14749 Call exif data parasite "exif-data" instead of "jpeg-exif-data", 14750 because it should be interchangeable with TIFF exif data. 14751 147522004-06-18 Michael Natterer <mitch@gimp.org> 14753 14754 * app/actions/context-actions.c 14755 * app/actions/context-commands.[ch]: added tons of new actions to 14756 modify the current FG/BG color's RGB components. 14757 14758 Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set 14759 values, not only increase/decrease them. 14760 14761 Changed context_select_value() utility function to interpret 14762 GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings 14763 in a range from 0 to 1000. Yes, that's a hack... 14764 147652004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> 14766 14767 * app/tools/gimptransformtool.c: reverted my fix to bug #144570. 14768 147692004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> 14770 14771 * app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label. 14772 147732004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> 14774 14775 * app/tools/gimptransformtool.c (gimp_transform_tool_bounds): 14776 If transforming a path, use the path bounds rather than the mask 14777 bounds. Fixes bug #144570. 14778 147792004-06-17 Michael Natterer <mitch@gimp.org> 14780 14781 * app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum(). 14782 14783 * app/core/gimp.c 14784 * app/widgets/gimpcontrollerinfo.c: use it. 14785 147862004-06-17 Michael Natterer <mitch@gimp.org> 14787 14788 * app/core/gimpcontainer.c (gimp_container_deserialize): add newly 14789 created children to the container *after* deserializing them so 14790 GimpContainer::add() callbacks get the already deserialized 14791 object. 14792 14793 * app/widgets/gimpcontrollers.c: connect to "add" and "remove" of 14794 the controller list and remember / clear the wheel controller when 14795 it appears / disappears. 14796 147972004-06-17 Sven Neumann <sven@gimp.org> 14798 14799 * autogen.sh: check for xsltproc and mention that the intltool 14800 version mismatch is harmless. 14801 148022004-06-17 Pedro Gimeno <pggimeno@wanadoo.es> 14803 14804 * tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation. 14805 Addresses bug #144267. 14806 14807 * app/pdb/paths_cmds.c 14808 * libgimp/gimppaths_pdb.c: regenerated. 14809 148102004-06-17 Michael Natterer <mitch@gimp.org> 14811 14812 * libgimpwidgets/gimpcontroller.[ch]: removed "enabled" 14813 property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name" 14814 property because it's the hardware-determined name of this 14815 controller instance. 14816 14817 * app/widgets/gimpcontrollerwheel.c 14818 * modules/controller_linux_input.c: set the name. 14819 14820 * libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h. 14821 14822 * app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here 14823 instead. Don't dispatch events if the controller is 14824 disabled. Made everything work (not crash) with info->mapping 14825 being NULL. 14826 14827 * etc/controllerrc: updated again with the changed format. 14828 14829 * app/widgets/gimpcontrollers.[ch]: added 14830 gimp_controllers_get_list() which returns the container of 14831 controllers. 14832 14833 * app/widgets/gimphelp-ids.h 14834 * app/gui/preferences-dialog.c: added controller configuration 14835 (can't change anything yet, just view the current settings). 14836 Resurrected the "Input Devices" page and removed the "Session" 14837 page by moving its widgets to other pages. Pack the various 14838 "Save now"/"Clear now" buttons vertically, not horizontally. 14839 Fixes bug #139069. 14840 14841 * themes/Default/images/preferences/Makefile.am 14842 * themes/Default/images/preferences/controllers.png 14843 * themes/Default/images/preferences/theme.png: new icons for new 14844 prefs pages. Someone needs to make them nice... 14845 148462004-06-17 Michael Natterer <mitch@gimp.org> 14847 14848 * app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar 14849 visible by default, hide it if options->show_menubar is FALSE. 14850 Fixes bug #143243. 14851 148522004-06-17 Sven Neumann <sven@gimp.org> 14853 14854 * configure.in: bumped version to 2.1.1. Allow to disable the 14855 build of the linux_input controller module. 14856 148572004-06-17 Philip Lafleur <plafleur@cvs.gnome.org> 14858 14859 * app/core/gimpdrawable-transform.c 14860 (gimp_drawable_transform_tiles_affine): Make transforms (most 14861 notably perspective transforms) conform exactly to specified 14862 edges. Includes a patch by David Gowers. Fixes bug #144352. 14863 148642004-06-16 Manish Singh <yosh@gimp.org> 14865 14866 * modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP} 14867 usage in #ifdefs, since pre-2.6 kernels do not have them. 14868 14869 * modules/controller_linux_input.c (linux_input_read_event): n_bytes 14870 should be a gsize. 14871 148722004-06-16 Michael Natterer <mitch@gimp.org> 14873 14874 * app/actions/context-actions.c 14875 * app/actions/context-commands.[ch]: added actions & callback 14876 to select the first/last/prev/next tool. 14877 148782004-06-16 Simon Budig <simon@gimp.org> 14879 14880 * modules/controller_linux_input.c: removed BTN_MISC, 14881 since it is the same as BTN_0 in the input.h header file. 14882 148832004-06-16 Michael Natterer <mitch@gimp.org> 14884 14885 * libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name) 14886 (gimp_controller_get_event_blurb): always return a non-NULL 14887 string (return "<invalid event id>" as fallback). 14888 14889 * modules/controller_linux_input.c: reenabled button event 14890 dispatching. 14891 14892 * app/widgets/gimpcontrollerinfo.c: fixed debugging output. 14893 148942004-06-16 Simon Budig <simon@gimp.org> 14895 14896 * modules/controller_linux_input.c: break out of the 14897 loop after we handled the first matching rel_event. 14898 148992004-06-16 Michael Natterer <mitch@gimp.org> 14900 14901 * libgimpwidgets/gimpcontroller.[ch]: added #define 14902 GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable. 14903 14904 * modules/controller_linux_input.c: made "device-name" 14905 serializable. 14906 14907 * app/config/gimpconfig-params.h: added macro 14908 GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled 14909 by custom (de)serialize_property() implementations. 14910 14911 * app/config/gimpconfig-deserialize.c 14912 * app/config/gimpconfig-serialize.c: made object (de)serialization 14913 work for object properties which are *not* GIMP_PARAM_AGGREGATE. 14914 Write/parse the exact type of the object to create to enable this. 14915 14916 * app/core/gimpmarshal.list: new marshaller for GimpControllerInfo. 14917 14918 * app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface 14919 and add "controller" and "mapping" properties. Add "event-mapped" 14920 signal which carries the action_name. 14921 14922 * app/widgets/gimpcontrollers.c: removed all deserialization code 14923 and simply (de)serialize the controller container. Install a 14924 container handler for "event-mapped" and do the action_name -> 14925 action mapping in the callback. 14926 14927 * etc/controllerrc: regenerated with new syntax. Delete your old one! 14928 149292004-06-16 Sven Neumann <sven@gimp.org> 14930 14931 * app/widgets/gimpcontrollerwheel.c 14932 (gimp_controller_wheel_get_event_name): don't use gettext() here. 14933 14934 * modules/controller_linux_input.c: added more button events, set 14935 the device name, some cleanup. 14936 149372004-06-16 Sven Neumann <sven@gimp.org> 14938 14939 * plug-ins/common/plugin-defs.pl: changed dependencies for blur. 14940 14941 * plug-ins/common/Makefile.am: regenerated. 14942 14943 * plug-ins/common/blur.c: no need to include libgimpui.h any longer. 14944 149452004-06-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> 14946 14947 * plug-ins/common/blur.c: removed randomize and repeat options; 14948 made to run without popping a dialog. (bug #142318) 14949 149502004-06-16 Simon Budig <simon@gimp.org> 14951 14952 * modules/controller_linux_input.c: enable dial-events for 14953 e.g. the powermate. Fixed typo. 14954 149552004-06-16 Sven Neumann <sven@gimp.org> 14956 14957 * menus/image-menu.xml.in: added missing menu entries (bug #144449). 14958 149592004-06-16 Michael Natterer <mitch@gimp.org> 14960 14961 * libgimpwidgets/gimpcontroller.[ch]: added 14962 GimpController::get_event_blurb() which returns the strings that 14963 were returned by get_event_name(). The latter returns 14964 untranslatable event identifiers now. 14965 14966 * app/widgets/gimpcontrollerwheel.c 14967 * modules/controller_linux_input.c: changed accordingly. 14968 14969 * app/widgets/gimpcontrollerinfo.c 14970 * app/widgets/gimpcontrollers.c: changed the event mapping from 14971 event-id -> action-name to event-name -> action-name. 14972 14973 * etc/controllerrc: changed accordingly (finally readable now). 14974 149752004-06-16 Michael Natterer <mitch@gimp.org> 14976 14977 * app/widgets/Makefile.am 14978 * app/widgets/widgets-types.h 14979 * app/widgets/gimpcontrollerinfo.[ch]: made an object out of 14980 the GimpControllerInfo struct. 14981 14982 * app/widgets/gimpcontrollers.c: changed accordingly. 14983 149842004-06-16 Jakub Steiner <jimmac@ximian.com> 14985 14986 * etc/controllerrc: fix typo 14987 149882004-06-16 Sven Neumann <sven@gimp.org> 14989 14990 * modules/controller_linux_input.c 14991 * etc/controllerrc: preliminary wheel event support. 14992 149932004-06-16 Michael Natterer <mitch@gimp.org> 14994 14995 * app/widgets/gimpcontrollers.c: better debugging output. 14996 149972004-06-16 Sven Neumann <sven@gimp.org> 14998 14999 * app/widgets/gimpcontrollers.c: bug fix. 15000 15001 * configure.in: check for linux/input.h. 15002 15003 * modules/Makefile.am 15004 * modules/controller_linux_input.c: added a prototype controller 15005 module using the linux input event interface. 15006 15007 * etc/controllerrc: added example config for linux input device. 15008 150092004-06-16 Michael Natterer <mitch@gimp.org> 15010 15011 * app/widgets/gimpcontrollers.c: load the controller's 15012 properties from the controllerrc file. 15013 15014 * etc/controllerrc: set the wheel's properties. 15015 150162004-06-16 Michael Natterer <mitch@gimp.org> 15017 15018 * etc/controllerrc: use the 10% actions for opacity. 15019 150202004-06-16 Michael Natterer <mitch@gimp.org> 15021 15022 * app/widgets/gimpcontrollers.c: ref the actions when putting 15023 them in the mapping table. 15024 15025 * app/actions/context-actions.c: added actions to change the 15026 opacity in 10% steps. 15027 150282004-06-16 Michael Natterer <mitch@gimp.org> 15029 15030 * libgimpwidgets/gimpcontroller.[ch]: added a "name" property. 15031 Dispatch events only if the controller is enabled. 15032 15033 * app/widgets/gimpcontrollerwheel.c: added controller events for 15034 all possible modifier combinations. 15035 15036 * etc/Makefile.am 15037 * etc/controllerrc: default controllerrc which maps all unused 15038 wheel+modifier combinations to more-or-less usefull stuff. 15039 150402004-06-16 Michael Natterer <mitch@gimp.org> 15041 15042 Started to fix bug #106920 in a more genreral way: 15043 15044 * libgimpwidgets/Makefile.am 15045 * libgimpwidgets/gimpwidgetstypes.h 15046 * libgimpwidgets/gimpwidgetsmarshal.list 15047 * libgimpwidgets/gimpcontroller.[ch]: new abstract base class 15048 which provides an API for pluggable input controller modules 15049 (mouse wheel, usb/midi stuff etc.). 15050 15051 * app/widgets/Makefile.am 15052 * app/widgets/widgets-types.h 15053 * app/widgets/gimpcontrollerwheel.[ch]: subclass of the above 15054 which maps wheel mouse scroll events to controller events. 15055 15056 * app/widgets/gimpcontrollers.[ch]: manager for controllers. 15057 reads $(gimpdir)/controllerrc and keeps a mapping of controller 15058 events to GtkActions. 15059 15060 * app/gui/gui.c: initialize and shut down the controller stuff. 15061 15062 * app/display/gimpdisplayshell-callbacks.c 15063 (gimp_display_shell_canvas_tool_events): if a wheel controller 15064 exists, dispatch GdkEventScroll to it first and return if it was 15065 handled. 15066 150672004-06-15 Sven Neumann <sven@gimp.org> 15068 15069 * tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API 15070 gimp_text() and gimp_text_get_extents(). 15071 15072 * app/pdb/text_tool_cmds.c 15073 * libgimp/gimptexttool_pdb.[ch]: regenerated. 15074 150752004-06-15 Manish Singh <yosh@gimp.org> 15076 15077 * tools/pdbgen/pdbgen.pl 15078 * tools/pdbgen/lib.pl: some simplistic code to add a $deprecated 15079 flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED 15080 guards in lib headers. 15081 150822004-06-15 Michael Natterer <mitch@gimp.org> 15083 15084 * app/actions/Makefile.am 15085 * app/actions/context-actions.[ch] 15086 * app/actions/context-commands.[ch]: added new action group to 15087 modify all GimpContext properties. So far there are actions to 15088 cycle through the lists of brushes, patterns etc., to change the 15089 opacity, to swap and default colors and to edit generated brushes. 15090 15091 * app/actions/actions.c: register the new "context" action group. 15092 15093 * app/actions/tools-actions.c 15094 * app/actions/tools-commands.[ch]: removed "tools-default-colors" 15095 and "tools-swap-colors" actions and callbacks because they are 15096 in the "context" action group now. 15097 15098 * app/menus/menus.c: add the "context" group to the <Image> and 15099 <Dock> UI managers. 15100 15101 * menus/image-menu.xml.in: changed accordingly. Added a temporary 15102 "Context" menu to test and debug the new actions. 15103 151042004-06-15 Philip Lafleur <plafleur@cvs.gnome.org> 15105 15106 * app/tools/gimpcroptool.c (crop_selection_callback): Force 15107 aspect ratio to match selection when 'From Selection' is clicked. 15108 Fixes bug #144361. Also converted tabs to spaces. 15109 151102004-06-15 Sven Neumann <sven@gimp.org> 15111 15112 * plug-ins/common/mng.c (respin_cmap): applied the fix for empty 15113 colormaps (bug #143009) here as well. 15114 151152004-06-15 Philip Lafleur <plafleur@cvs.gnome.org> 15116 15117 * app/core/gimpdrawable-transform.c 15118 (gimp_drawable_transform_tiles_affine): Don't round texture 15119 coordinates when not using interpolation. Fixes bug #144352 for 15120 the nearest neighbor case only. 15121 151222004-06-14 Sven Neumann <sven@gimp.org> 15123 15124 * app/paint/gimpinkoptions.c: replaced some arbitrary values with 15125 larger but still arbitrary values (default and limit for ink size). 15126 151272004-06-14 Michael Natterer <mitch@gimp.org> 15128 15129 * app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and 15130 POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed 15131 "gboolean traces_on_window" from GimpPaintCoreClass. 15132 15133 * app/paint/gimpclone.[ch] 15134 * app/paint/gimpink.c 15135 * app/tools/gimpclonetool.c: changed accordingly. 15136 15137 * app/tools/gimppainttool.c: ditto. Show the brush outline 15138 while painting. Fixes bug #118348. 15139 151402004-06-14 Michael Natterer <mitch@gimp.org> 15141 15142 * app/tools/gimptransformtool.c: use gimp_draw_tool_is_active() 15143 instead of GIMP_IS_DISPLAY(draw_tool->gdisp). 15144 151452004-06-14 Michael Natterer <mitch@gimp.org> 15146 15147 * app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions): 15148 do the workaround for "" accelerators only if the GTK+ version 15149 is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3. 15150 151512004-06-14 Sven Neumann <sven@gimp.org> 15152 15153 * app/core/gimpdrawable-transform.c: declared 15154 gimp_drawable_transform_cubic() as inline function. Makes 15155 sample_cubic() run about 10% faster and causes a 7% speedup on 15156 cubic transformations. 15157 15158 * app/paint-funcs/paint-funcs.c (border_region): avoid an 15159 unnecessary memory allocation. 15160 151612004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> 15162 15163 * app/tools/gimptransformtool.c: Disable preview in corrective 15164 mode, and notify preview when switching transform type and 15165 direction. 15166 151672004-06-14 Michael Natterer <mitch@gimp.org> 15168 15169 * app/paint/gimppaintcore.[ch]: added new virtual function 15170 GimpPaintCore::post_paint() and call it after calling 15171 GimpPaintCore::paint(). 15172 15173 * app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush 15174 to brush_core->main_brush and reset brush_core->brush 15175 to brush_core->main_brush in GimpPaintCore::post_paint(). 15176 15177 * app/paint/gimpbrushcore.c 15178 * app/paint/gimppaintcore-stroke.c 15179 * app/tools/gimppainttool.c: removed all code which restores 15180 the brush_core's old brush after painting since post_paint() 15181 does this automatically now. 15182 15183 * app/paint/gimpclone.[ch]: moved static variables to the 15184 GimpClone struct. 15185 151862004-06-14 Sven Neumann <sven@gimp.org> 15187 15188 * app/paint-funcs/paint-funcs-generic.h (color_pixels): some code 15189 cleanup I did while attempting to optimize this code further. 15190 151912004-06-14 Henrik Brix Andersen <brix@gimp.org> 15192 15193 * app/plug-in/plug-in-run.c: let extensions run synchronously when 15194 called via PDB. Fixes bug #140112. 15195 151962004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> 15197 15198 * app/tools/gimptransformtool.c: Preview is now only used for 15199 layer transformations. 15200 152012004-06-14 Michael Natterer <mitch@gimp.org> 15202 15203 * app/tools/gimpperspectivetool.c 15204 * app/tools/gimprotatetool.c 15205 * app/tools/gimpscaletool.c 15206 * app/tools/gimpsheartool.c: removed calls to 15207 gimp_transform_tool_expose_preview() from all 15208 GimpTransformTool::motion() implementations... 15209 15210 * app/tools/gimptransformtool.c: ...and call it after calling 15211 tr_tool_class->preview(). 15212 152132004-06-14 Michael Natterer <mitch@gimp.org> 15214 15215 * app/display/gimpdisplayshell.[ch]: remember the last used 15216 GimpCursorFormat so changing the format in prefs applies 15217 instantly, and not after the next tool change. 15218 15219 * app/display/gimpdisplayshell-cursor.[ch] 15220 * app/tools/gimptool.[ch] 15221 * app/tools/gimptoolcontrol.[ch] 15222 * app/tools/gimpclonetool.c 15223 * app/tools/gimpcolortool.c 15224 * app/tools/gimpcroptool.c 15225 * app/tools/gimpcurvestool.c 15226 * app/tools/gimpiscissorstool.c 15227 * app/tools/gimpmeasuretool.c 15228 * app/tools/gimpmovetool.c 15229 * app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g 15230 152312004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> 15232 15233 * app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview 15234 wasn't being turned off before performing a transformation. Also 15235 converted tabs to spaces. 15236 152372004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> 15238 15239 * app/display/gimpdisplayshell-preview.c: Transformation previews now 15240 use the selection mask if it is present. 15241 152422004-06-13 Manish Singh <yosh@gimp.org> 15243 15244 * configure.in: Make sure PangoFT2 is using a recent enough fontconfig 15245 since many people have broken and confused setups. 15246 152472004-06-13 Manish Singh <yosh@gimp.org> 15248 15249 * tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated 15250 output doesn't warn about uninitialize variable use, and whitespace 15251 cosmetic cleanups. 15252 15253 * app/pdb/gradient_edit_cmds.c: regenerated. 15254 152552004-06-13 Manish Singh <yosh@gimp.org> 15256 15257 * app/base/cpu-accel.c: Reorged, to address bug #142907 and 15258 bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel() 15259 keys on that. Both PPC and X86 implementations check for __GNUC__. 15260 X86 stuff is only used with USE_MMX is defined. The SSE OS check 15261 is now checked in arch_accel(), not cpu_accel(). Finally, the 15262 arch x86_64 checks now are EM64T aware (which didn't matter in 15263 practice). 15264 152652004-06-13 Philip Lafleur <plafleur@cvs.gnome.org> 15266 15267 * app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds() 15268 for texture coordinates instead of the drawable's width and height. 15269 152702004-06-13 Sven Neumann <sven@gimp.org> 15271 15272 * app/paint-funcs/paint-funcs.c (shapeburst_region): don't call 15273 tile_ewidth() three times from the inner loop. 15274 15275 * app/base/tile-manager.c (tile_manager_get): don't call 15276 tile_size() twice on the same tile. 15277 15278 * app/base/tile-private.h: added tile_size_inline(), an inline 15279 version of the tile_size() function. 15280 15281 * app/base/tile-cache.c 15282 * app/base/tile-manager.c 15283 * app/base/tile-swap.c 15284 * app/base/tile.c: use tile_size_inline() from inside the tile 15285 subsystem. 15286 152872004-06-13 Simon Budig <simon@gimp.org> 15288 15289 * app/tools/gimpiscissorstool.c: Minor tweaks to two macros. 15290 Shouldn't change anything. 15291 152922004-06-13 Jakub Steiner <jimmac@ximian.com> 15293 15294 * cursors/tool-zoom.png: 15295 * cursors/cursor-zoom.png: minor fsckup 15296 152972004-06-13 Jakub Steiner <jimmac@ximian.com> 15298 15299 * cursors/gimp-tool-cursors.xcf 15300 * cursors/tool-burn.png: the burn tool doesn't really have an 15301 inverted handle 15302 153032004-06-13 Sven Neumann <sven@gimp.org> 15304 15305 * app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added 15306 progress callback. 15307 15308 * app/core/gimpdrawable-blend.c: show a progress while calculating 15309 the Shapeburst. Not perfect but better than not showing any 15310 progress at all. 15311 153122004-06-13 Michael Natterer <mitch@gimp.org> 15313 15314 * app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat 15315 which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to 15316 work around broken X servers. 15317 15318 * app/config/gimpguiconfig.[ch] 15319 * app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format. 15320 15321 * app/gui/preferences-dialog.c: added a GUI for the new option. 15322 15323 * app/widgets/gimpcursor.[ch]: added cursor_format parameter 15324 to gimp_cursor_new() and _set(). 15325 15326 * app/display/gimpdisplayshell-cursor.c 15327 * app/tools/gimpcurvestool.c 15328 * app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode. 15329 153302004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> 15331 15332 * app/core/gimpdrawable-blend.c: added missing semicolon. 15333 153342004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> 15335 15336 * app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that 15337 caused perfect-but-slow pointer tracking to be used in tools that 15338 don't request exact mode. 15339 15340 * app/display/Makefile.am: 15341 * app/display/gimpdisplayshell-appearance.[ch]: 15342 * app/display/gimpdisplayshell-callbacks.c: 15343 * app/display/gimpdisplayshell.[ch]: 15344 * app/display/gimpdisplayshell-preview.[ch]: added 15345 * app/tools/gimpperspectivetool.c: 15346 * app/tools/gimprotatetool.c: 15347 * app/tools/gimpscaletool.c: 15348 * app/tools/gimpsheartool.c: 15349 * app/tools/gimptransformoptions.[ch]: 15350 * app/tools/gimptransformtool.[ch]: Implemented live transformation 15351 previews, available through tool options. Fixes bug #108172. 15352 153532004-06-13 Sven Neumann <sven@gimp.org> 15354 15355 * app/core/gimpdrawable-blend.c (gradient_render_pixel): inline 15356 the repeat functions. 15357 15358 * app/core/gimpgradient.c: inline the curve functions. 15359 153602004-06-13 Jakub Steiner <jimmac@ximian.com> 15361 15362 * cursors/gimp-tool-cursors.xcf 15363 * cursors/tool-zoom.png: make more transparent 15364 153652004-06-13 Jakub Steiner <jimmac@ximian.com> 15366 15367 * cursors/gimp-tool-cursors.xcf 15368 * cursors/tool-blur.png 15369 * cursors/tool-bucket-fill.png 15370 * cursors/tool-dodge.png 15371 * cursors/tool-eraser.png 15372 * cursors/tool-hand.png: fix a few problems hidden by low opacity 15373 153742004-06-13 Jakub Steiner <jimmac@ximian.com> 15375 15376 * cursor/*png: updated the cursors 15377 153782004-06-13 Michael Natterer <mitch@gimp.org> 15379 15380 * cursors/gimp-tool-cursors.xcf: added nice new antialiased 15381 cursor layers made by Jimmac. 15382 153832004-06-13 Sven Neumann <sven@gimp.org> 15384 15385 * app/core/gimppalette.c (gimp_palette_load): don't use the rather 15386 inefficient gimp_palette_add_entry() when loading a palette. 15387 153882004-06-13 Michael Natterer <mitch@gimp.org> 15389 15390 * app/core/gimpdata.[ch]: added "gint freeze_count" and 15391 gimp_data_freeze()/thaw() functions. Emit "dirty" only if 15392 freeze_count either is 0 or drops to 0. 15393 15394 * app/core/gimpbrushgenerated.[ch] 15395 * app/core/gimpgradient.[ch]: removed freeze/thaw stuff that 15396 was duplicated in these two subclasses and use the new 15397 GimpData API instead. 15398 15399 * app/widgets/gimpbrusheditor.c 15400 * app/widgets/gimpgradienteditor.c: changed accordingly. 15401 154022004-06-12 Sven Neumann <sven@gimp.org> 15403 15404 * app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy 15405 the first row onto itself. 15406 154072004-06-12 Simon Budig <simon@gimp.org> 15408 15409 * app/tools/gimptransformtool.c: Make Enter/Return apply the 15410 transformation, Backspace/Delete resets the transformation. 15411 15412 * app/tools/gimpcroptool.c: Simplify the key_press callback. 15413 154142004-06-12 Simon Budig <simon@gimp.org> 15415 15416 * app/tools/gimpcroptool.c: Make the Enter/Return key do 15417 the crop action. 15418 15419 * app/tools/gimpeditselectiontool.c 15420 * app/tools/gimpvectortool.c: Make the _key_press functions 15421 safe for non-arrow keys. 15422 154232004-06-12 Sven Neumann <sven@gimp.org> 15424 15425 * app/composite/gimp-composite.[ch]: just some cleanup. 15426 154272004-06-12 Michael Natterer <mitch@gimp.org> 15428 15429 * app/display/gimpdisplayshell-callbacks.c 15430 (gimp_display_shell_events): ported some forgotten #if 0'ed 15431 GtkItemFactory stuff to GtkUIManager. 15432 154332004-06-12 Simon Budig <simon@gimp.org> 15434 15435 * app/tools/gimptool.[ch]: renamed the "arrow_key" member 15436 to "key_press", since it is now no longer about just the arrow 15437 keys. 15438 15439 * app/tools/gimpcroptool.c 15440 * app/tools/gimpeditselectiontool.c 15441 * app/tools/gimpeditselectiontool.h 15442 * app/tools/gimpmovetool.c 15443 * app/tools/gimppainttool.c 15444 * app/tools/gimpselectiontool.c 15445 * app/tools/gimptexttool.c 15446 * app/tools/gimpvectortool.c 15447 * app/tools/tool_manager.c: Changed accordingly. 15448 154492004-06-12 Michael Natterer <mitch@gimp.org> 15450 15451 * app/display/gimpdisplayshell.c (gimp_display_shell_init): add 15452 the file DND destination before all others so the DND code will 15453 implicitly use its destination properties. Works around Konqueror 15454 offering only file MOVE, not COPY and fixes bug #144168. 15455 154562004-06-12 Sven Neumann <sven@gimp.org> 15457 15458 * plug-ins/common/sample_colorize.c: reindented, some minor cleanup. 15459 154602004-06-12 Simon Budig <simon@gimp.org> 15461 15462 * app/tools/tool_manager.[ch]: renamed 15463 tool_manager_arrow_key_active to tool_manager_key_press_active. 15464 15465 * app/display/gimpdisplayshell-callbacks.c: Also dispatch 15466 GDK_Return/KP_Enter/BackSpace/Delete to the tools, the 15467 "arrow_key" member of GimpTool probably should be renamed. 15468 15469 * app/tools/gimpvectortool.c: Use Enter/Return to convert the 15470 current path to a selection, use Backspace/Delete to delete the 15471 currently active anchors in a path. 15472 15473 Implemented on Jimmacs request - thanks to him and Iva for being 15474 a great host :) 15475 154762004-06-12 Sven Neumann <sven@gimp.org> 15477 15478 * app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init): 15479 set the initially selected channel on the histogram combobox. 15480 Fixes bug #144225. 15481 154822004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> 15483 15484 * app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure" 15485 variables to "pressure-hardness". 15486 15487 * app/paint/gimpairbrush.c: 15488 * app/tools/gimppaintoptions-gui.c: changed accordingly. 15489 154902004-06-10 Michael Natterer <mitch@gimp.org> 15491 15492 * libgimpwidgets/gimpcolorarea.c: replaced destroy() by 15493 finalize(), converted tabs to spaces, cleanup. 15494 154952004-06-10 Michael Natterer <mitch@gimp.org> 15496 15497 * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the 15498 filename label if it's too long instead of cutting it off. 15499 155002004-06-10 Michael Natterer <mitch@gimp.org> 15501 15502 * app/widgets/widgets-enums.h (enum GimpCursorModifier): 15503 s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/. 15504 15505 * app/widgets/gimpcursor.c: changed accordingly. Renamed struct 15506 GimpBitmapCursor to GimpCursor. More cleanup. 15507 155082004-06-10 Michael Natterer <mitch@gimp.org> 15509 15510 * app/actions/image-actions.c 15511 * app/actions/image-commands.[ch] 15512 * app/actions/layers-actions.c 15513 * app/actions/layers-commands.[ch]: made the 15514 "image-convert-rgb/grayscale/indexed" and the 15515 "layers-mask-apply/delete" actions GimpEnumActions and merged 15516 their callbacks. 15517 155182004-06-10 Philip Lafleur <plafleur@cvs.gnome.org> 15519 15520 * app/gui/preferences-dialog.c: restored the 'Show Paint Tool 15521 Cursor' option that was removed during clean-up. 15522 155232004-06-10 Philip Lafleur <plafleur@cvs.gnome.org> 15524 15525 * app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask): 15526 avoided some redundant calculations. 15527 155282004-06-10 Sven Neumann <sven@gimp.org> 15529 15530 * app/gui/user-install-dialog.c: removed the monitor calibration 15531 from the user installation process. It's not a vital setting and 15532 can be done from the Preferences dialog later. 15533 15534 * app/gui/resolution-calibrate-dialog.[ch]: simplified the 15535 resolution calibration dialog by removing the hacks that were 15536 needed for drawing it in the user-installation style. 15537 15538 * app/gui/preferences-dialog.c: changed accordingly. Also removed 15539 the separator from the Display page. 15540 155412004-06-10 Sven Neumann <sven@gimp.org> 15542 15543 * app/widgets/gimptemplateeditor.[ch]: added an API to 15544 expand/collapse the "Advanced Options" frame. 15545 15546 * app/gui/preferences-dialog.c 15547 * app/widgets/gimphelp-ids.h: applied a patch done by William 15548 Skaggs that cleans up and reorganizes the Preferences dialog 15549 (bug #144060). 15550 155512004-06-09 Simon Budig <simon@gimp.org> 15552 15553 * app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to 15554 gimp_coords_length_squared. 15555 15556 * app/vectors/gimpbezierstroke.c: Changed accordingly 15557 155582004-06-09 Sven Neumann <sven@gimp.org> 15559 15560 * app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to 15561 request GIMP_MOTION_MODE_EXACT here since the parent class does 15562 that already. 15563 15564 * app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the 15565 color picker feature for the ink tool. 15566 155672004-06-09 Sven Neumann <sven@gimp.org> 15568 15569 * menus/image-menu.xml.in: added "Selection Editor" to the 15570 Selection menu. Still hoping for the great menu reorganization 15571 though... 15572 15573 * app/actions/select-actions.c (select_actions_update): "Save to 15574 Channel" makes sense without a selection also, so don't set it 15575 insensitive. 15576 155772004-06-07 Sven Neumann <sven@gimp.org> 15578 15579 * plug-ins/common/glob.c: the glob(3) function is not available on 15580 Win32 and also isn't necessarily UTF-8 safe. Started to add an 15581 alternative implementation. Right now there's just some code taken 15582 from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in 15583 does nothing useful. I will add some stripped-down glob code based 15584 on the code in glibc later. 15585 155862004-06-07 Michael Natterer <mitch@gimp.org> 15587 15588 * app/core/gimplayer.c (gimp_layer_set_tiles): don't set 15589 layer->mask's offsets. It is wrong because GimpDrawable::set_tiles() 15590 is a lowlevel function which is used by stuff like scale and 15591 resize which keep the mask in sync explicitely and don't expect it 15592 to be moved in the middle of chaining up. Fixes bug #143860. 15593 155942004-06-07 Michael Natterer <mitch@gimp.org> 15595 15596 * app/actions/view-actions.c 15597 * app/actions/view-commands.[ch]: added separate callback for 15598 "view-zoom-other" and connect GtkAction::activate manually so 15599 "Other..." can be selected even if it's the active item in the 15600 zoom radio group. Fixes bug #143850. 15601 156022004-06-07 Sven Neumann <sven@gimp.org> 15603 15604 * plug-ins/common/tileit.c (tileit_dialog): fixed a typo. 15605 156062004-06-07 Sven Neumann <sven@gimp.org> 15607 15608 * app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus 15609 by the translated menu path stripped from underscores. 15610 156112004-06-06 Sven Neumann <sven@gimp.org> 15612 15613 * plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug 15614 I introduced yesterday. 15615 156162004-06-06 Sven Neumann <sven@gimp.org> 15617 15618 * plug-ins/common/gauss.c (query): register the menu entry the new 15619 way and install a mnemonic for Gaussian Blur. 15620 156212004-06-05 Sven Neumann <sven@gimp.org> 15622 15623 * plug-ins/common/curve_bend.c: applied a patch from Henrik Brix 15624 Andersen that tells the user that Curve Bend cannot operate on 15625 layers with masks instead of silently applying the mask 15626 (bug #134748). 15627 156282004-06-05 Sven Neumann <sven@gimp.org> 15629 15630 * plug-ins/common/plugin-defs.pl 15631 * plug-ins/common/Makefile.am 15632 * plug-ins/common/gauss_iir.c 15633 * plug-ins/common/gauss_rle.c: removed the two gaussian blur 15634 plug-ins... 15635 15636 * plug-ins/common/gauss.c: and added a merged version done by 15637 William Skaggs. Fixes bug #134088. 15638 156392004-06-05 Sven Neumann <sven@gimp.org> 15640 15641 * plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that 15642 makes the plug-in handle images with more than 4 channels. At the 15643 moment the extra information is discarded (bug #143673). 15644 156452004-06-05 Sven Neumann <sven@gimp.org> 15646 15647 * plug-ins/common/unsharp.c: applied a modified patch from Geert 15648 Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes 15649 bug #140974. 15650 156512004-06-05 Sven Neumann <sven@gimp.org> 15652 15653 * app/paint/gimppaintcore.c 15654 * app/paint-funcs/paint-funcs-generic.h 15655 * app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip 15656 Lafleur that changes the way that paint is applied during a paint 15657 stroke. Fixes bug #124225. 15658 156592004-06-05 Sven Neumann <sven@gimp.org> 15660 15661 * plug-ins/common/Makefile.am 15662 * plug-ins/common/plugin-defs.pl 15663 * plug-ins/common/glob.c: added a simple glob plug-in based on 15664 some old code by George Hartz. This plug-in is very useful when 15665 you need to do batch processing, especially from Script-Fu. 15666 Fixes bug #143661. 15667 156682004-06-05 Sven Neumann <sven@gimp.org> 15669 15670 * app/widgets/gimpgradienteditor.c: applied a patch from David 15671 Gowers that makes the gradient editor display the perceptual 15672 intensity of the color under the cursor (bug #135037). 15673 156742004-06-05 Sven Neumann <sven@gimp.org> 15675 15676 * plug-ins/common/snoise.c: applied a modifed patch from Yeti that 15677 adds a preview to the Solid Noise plug-in (bug #142587). 15678 156792004-06-05 Sven Neumann <sven@gimp.org> 15680 15681 * plug-ins/common/tiff.c: save the proper value for type of alpha 15682 channel. Fixes bug #143522; patch by Philip Lafleur. 15683 156842004-06-05 Manish Singh <yosh@gimp.org> 15685 15686 * app/gui/preferences-dialog.c (prefs_dialog_new): update call 15687 to prefs_spin_button_add for num-processors too. 15688 156892004-06-05 Sven Neumann <sven@gimp.org> 15690 15691 * plug-ins/script-fu/script-fu-scripts.c (script_fu_interface): 15692 left align toggle buttons. 15693 156942004-06-05 Sven Neumann <sven@gimp.org> 15695 15696 * app/text/gimptextlayer-transform.[ch]: updated the (still unused) 15697 text transformation code. 15698 15699 * app/text/gimptext-bitmap.c: removed a redundant transformation. 15700 157012004-06-05 Michael Natterer <mitch@gimp.org> 15702 15703 * cursors/Makefile.am 15704 * cursors/cursor-none.png 15705 * cursors/xbm/cursor-none.xbm: new empty cursor images. 15706 15707 * app/config/gimpdisplayconfig.[ch] 15708 * app/config/gimprc-blurbs.h 15709 * app/widgets/widgets-enums.h 15710 * app/widgets/gimpcursor.c 15711 * app/display/gimpdisplayshell-cursor.c 15712 * app/tools/gimppainttool.[ch] 15713 * app/tools/gimpinktool.c 15714 * app/gui/preferences-dialog.c: applied patches from Philip 15715 Lafleur which implement hiding the cursor completely for paint 15716 tools. Changed the name of the config option from 15717 "hide-paint-tool-cursor" to "show-paint-tool-cursor" and default 15718 to TRUE because this needs the brush outline being visible while 15719 painting to be really usable. Fixes bug #132163. 15720 15721 * app/widgets/widgets-enums.h: renamed all GimpCursorType and 15722 GimpToolCursorType enum values to GIMP_CURSOR_* and 15723 GIMP_TOOL_CURSOR_*. 15724 15725 * app/widgets/gimpcursor.c 15726 * app/display/gimpdisplayshell-callbacks.c 15727 * app/display/gimpdisplayshell-cursor.c 15728 * app/tools/gimp*tool.c; changed accordingly. 15729 157302004-06-04 Michael Natterer <mitch@gimp.org> 15731 15732 * app/widgets/gimpcursor.c: changed create_cursor_foo() utility 15733 functions to get_cursor_foo() and use them as accessors instead of 15734 using cursor->member. Use gdk_pixbuf_copy() instead of compositing 15735 the initial image onto an empty pixbuf. 15736 157372004-06-04 Sven Neumann <sven@gimp.org> 15738 15739 * app/widgets/gimptexteditor.c (gimp_text_editor_new): set the 15740 focus on the text area. 15741 157422004-06-04 Sven Neumann <sven@gimp.org> 15743 15744 * app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to 15745 move a text layer using the cursor keys. 15746 157472004-06-04 Michael Natterer <mitch@gimp.org> 15748 15749 * cursors/*.xbm: removed... 15750 15751 * cursors/xbm/*.xbm: ...and added here instead. Renamed them 15752 all to match the PNG file names. 15753 15754 * cursors/Makefile.am: changed accordingly. 15755 15756 * app/widget/gimpcursor.c: ditto. Merged the two cursor creating 15757 functions again because they duplicated too much code. 15758 157592004-06-04 Sven Neumann <sven@gimp.org> 15760 15761 * app/menus/plug-in-menus.c (plug_in_menus_setup): populate the 15762 tree with collation keys and use strcmp() instead of 15763 g_utf8_collate() as the tree's sort function. 15764 157652004-06-04 Sven Neumann <sven@gimp.org> 15766 15767 * app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE): 15768 applied a patch by Philip Lafleur that changes the default to 15769 FALSE. Fixes bug #143626. 15770 157712004-06-03 Michael Natterer <mitch@gimpmp.org> 15772 15773 * app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use 15774 gtk_widget_size_request() instead of _get_child_requisition() 15775 because we need to know the size of the toolbox' areas 15776 even if they are invisible. Fixes SIGFPE spotted by Jimmac. 15777 157782004-06-03 Michael Natterer <mitch@gimp.org> 15779 15780 * app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor 15781 and cursor_modifier components slightly transparent. 15782 15783 * cursors/cursor-mouse.png: was the wrong image. 15784 157852004-06-03 Michael Natterer <mitch@gimp.org> 15786 15787 * cursors/Makefile.am 15788 * cursors/*.png: added PNG version of all cursors. 15789 15790 * cursors/gimp-tool-cursors.xcf: reordered and renamed all layers 15791 to match the new PNG filenames. 15792 15793 * app/widgets/gimpcursor.[ch]: create cursors with alpha and color 15794 if the GdkDisplay supports it. Fall back to the old stuff 15795 otherwise. 15796 157972004-06-03 Sven Neumann <sven@gimp.org> 15798 15799 * app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is 15800 set, use that as the pattern name. 15801 158022004-06-03 Sven Neumann <sven@gimp.org> 15803 15804 * app/core/gimpdatafactory.c (gimp_data_factory_load_data): 15805 removed commented-out message. 15806 15807 * app/core/gimppattern.[ch]: fixed handling of errors and PNG 15808 comments in new pattern loader. Renamed functions for consistency 15809 with other data loaders. 15810 15811 * app/core/gimp.c: changed accordingly. 15812 158132004-06-03 Dave Neary <bolsh@gimp.org> 15814 15815 * app/core/gimp.c: 15816 * app/core/gimpdatafactory.c: 15817 * app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns, 15818 so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga, 15819 xpm and tiff can be used for patterns. 15820 158212004-06-03 Michael Natterer <mitch@gimp.org> 15822 15823 * app/actions/vectors-actions.c: added alternative actions 15824 "vectors-selection-from-vectors" and 15825 "vectors-selection-to-vectors-short" with different labels suited 15826 for the "Select" menu. 15827 15828 * app/actions/select-actions.c: removed "select-from-vectors" 15829 and "select-to-vectors" (to vectors was crashing anyway). 15830 15831 * app/actions/select-commands.[ch]: removed 15832 select_from_vectors_cmd_callback(). Fixes code dupliction. 15833 15834 * menus/image-menu.xml.in 15835 * menus/selection-editor-menu.xml: changed accordingly. 15836 158372004-06-03 Michael Natterer <mitch@gimp.org> 15838 15839 * app/widgets/gimpgradienteditor.c (control_motion): use the newly 15840 added GimpGradient API to set the segment's handles instead of 15841 setting the values directly. Dirties the gradient correctly and 15842 makes the preview update instantly again. Fixes bug #143605. 15843 158442004-06-03 Sven Neumann <sven@gimp.org> 15845 15846 * app/gui/file-open-location-dialog.c 15847 (file_open_location_completion): check for NULL pointer before 15848 passing it to g_utf8_normalize(). Just a workaround for a problem 15849 in GimpContainerView. 15850 158512004-06-02 Sven Neumann <sven@gimp.org> 15852 15853 * INSTALL: more updates. 15854 158552004-06-02 Sven Neumann <sven@gimp.org> 15856 15857 * Made 2.1.0 development release. 15858 158592004-06-02 Sven Neumann <sven@gimp.org> 15860 15861 * app/display/gimpdisplayshell-scale.c 15862 * app/gui/info-window.c 15863 * app/gui/preferences-dialog.c 15864 * app/gui/resize-dialog.c 15865 * app/tools/gimpcolorbalancetool.c 15866 * app/tools/gimpcurvestool.c 15867 * app/tools/gimphuesaturationtool.c 15868 * app/tools/gimplevelstool.c 15869 * app/tools/gimpthresholdtool.c 15870 * app/widgets/gimpdockable.c 15871 * app/widgets/gimpfiledialog.c 15872 * app/widgets/gimpgradienteditor.c 15873 * app/widgets/gimphistogrambox.c 15874 * app/widgets/gimplayertreeview.c 15875 * app/widgets/gimpstrokeeditor.c: tweaked some spacings for 15876 consistency and better HIG compliance. 15877 158782004-06-02 Michael Natterer <mitch@gimp.org> 15879 15880 * tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and 15881 set_coloring_type() work on segment ranges, renamed them 15882 accordingly. Spotted by Shlomi Fish. 15883 15884 * app/pdb/gradient_edit_cmds.c 15885 * libgimp/gimpgradientedit_pdb.[ch]: regenerated. 15886 158872004-06-02 Michael Natterer <mitch@gimp.org> 15888 15889 * app/widgets/gimpdnd.[ch]: removed utility funtion 15890 gimp_dnd_open_files(). 15891 15892 * app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files() 15893 instead. 15894 15895 * app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files): 15896 show the error message if opening a dropped file fails. 15897 158982004-06-02 Sven Neumann <sven@gimp.org> 15899 15900 * libgimpthumb/gimpthumbnail.c: plugged a small memory leak. 15901 159022004-06-02 Michael Natterer <mitch@gimp.org> 15903 15904 * app/widgets/gimpdnd.h: removed enum GimpDndType... 15905 15906 * app/widgets/widgets-enums.h: ...and added it here. 15907 15908 * app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow 15909 all gimp_dnd_foo_dest_add() functions to be called without 15910 callback (just add the target if callback is NULL). 15911 15912 (gimp_dnd_open_files): removed the checks for validity of the 15913 passed filenames/uris... 15914 15915 (gimp_dnd_set_file_data): ...and added it here so all callbacks 15916 get an already sanitized list of strings. 15917 159182004-06-02 Sven Neumann <sven@gimp.org> 15919 15920 * app/actions/Makefile.am (EXTRA_DIST) 15921 * app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until 15922 they have been added. 15923 159242004-06-02 Sven Neumann <sven@gimp.org> 15925 15926 * app/widgets/gimpcontainerview.c: create the hash table when 15927 inserting items; removes redundant create/destroy cycles and plugs 15928 a memory leak. 15929 159302004-06-02 Sven Neumann <sven@gimp.org> 15931 15932 * INSTALL: updated for gimp-2.1. Suggest to use gimp-print 15933 version 4.2.7-pre1 in case of problems (see bug #138273). 15934 159352004-06-02 Michael Natterer <mitch@gimp.org> 15936 15937 * app/display/gimpdisplayshell-dnd.c 15938 (gimp_display_shell_drop_files): copy the merged layer, not the 15939 first one. Preserve the type of the layer to make e.g. dropping an 15940 XCF with a single text layer work. 15941 159422004-06-02 Sven Neumann <sven@gimp.org> 15943 15944 * NEWS 15945 * README: updated. 15946 159472004-06-02 Michael Natterer <mitch@gimp.org> 15948 15949 * app/display/gimpdisplayshell.c (gimp_display_shell_init): accept 15950 file/uri drops. 15951 15952 * app/display/gimpdisplayshell-dnd.[ch] 15953 (gimp_display_shell_drop_files): open any kind of image and turn 15954 it into a single layer which is added to the image (suggested by 15955 Antenne Springborn). 15956 159572004-06-02 Sven Neumann <sven@gimp.org> 15958 15959 * tools/pdbgen/pdb/gradient_edit.pdb 15960 * tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since. 15961 15962 * libgimp/gimpgradientedit_pdb.c 15963 * libgimp/gimpgradients_pdb.c: regenerated. 15964 159652004-06-02 Michael Natterer <mitch@gimp.org> 15966 15967 * tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/. 15968 15969 * app/pdb/gradient_edit_cmds.c 15970 * libgimp/gimpgradientedit_pdb.[ch]: regenerated. 15971 159722004-06-01 Sven Neumann <sven@gimp.org> 15973 15974 * tools/pdbgen/pdb/image.pdb 15975 * app/pdb/image_cmds.c 15976 * app/core/gimpimage.[ch]: reverted changes I did to the image 15977 unit earlier. As in 2.0, it will continue to not accept pixels. 15978 This makes the PDB API and the XCF format compatible again and 15979 fixes bug #142961 (and to some extent bug #137704). 15980 15981 * app/core/Makefile.am 15982 * app/core/gimpimage-unit.[ch]: removed these files. The 15983 convenience accessors defined here aren't commonly used any 15984 longer. 15985 15986 * app/display/gimpdisplay.[ch] 15987 * app/display/gimpdisplayshell.[ch]: added a unit parameter to 15988 gimp_display_new(). Made "unit" and "scale" properties of 15989 GimpDisplayShell. 15990 15991 * app/actions/image-commands.c 15992 * app/actions/images-commands.c 15993 * app/actions/layers-commands.c 15994 * app/actions/select-commands.c 15995 * app/actions/view-commands.c 15996 * app/core/gimp-edit.c 15997 * app/core/gimp.[ch] 15998 * app/core/gimptemplate.c 15999 * app/display/gimpdisplayshell-handlers.c 16000 * app/display/gimpdisplayshell-scale.c 16001 * app/display/gimpdisplayshell-title.c 16002 * app/display/gimpstatusbar.c 16003 * app/file/file-open.c 16004 * app/gui/gui-vtable.c 16005 * app/gui/info-window.c 16006 * app/gui/offset-dialog.c 16007 * app/gui/resize-dialog.[ch] 16008 * app/pdb/display_cmds.c 16009 * app/tools/gimpcroptool.c 16010 * app/tools/gimpmeasuretool.c 16011 * app/tools/gimppainttool.c 16012 * app/tools/gimprectselecttool.c 16013 * app/tools/gimprotatetool.c 16014 * app/tools/gimpscaletool.c 16015 * app/vectors/gimpvectors-export.c 16016 * app/widgets/gimptoolbox-dnd.c 16017 * tools/pdbgen/pdb/display.pdb: changed accordingly. Use the 16018 display unit where the image unit was used before. 16019 160202004-06-01 Michael Natterer <mitch@gimp.org> 16021 16022 * tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of 16023 integers, cleanup. 16024 16025 * app/pdb/gradient_edit_cmds.c 16026 * libgimp/gimpgradientedit_pdb.[ch]: regenerated. 16027 160282004-06-01 Michael Natterer <mitch@gimp.org> 16029 16030 * app/core/gimpdatafactory.[ch]: added new function 16031 gimp_data_factory_data_delete(). 16032 16033 * app/actions/data-commands.c (data_delete_callback): use it. 16034 16035 * tools/pdbgen/pdb/gradients.pdb: applied (slightly modified) 16036 patch from Shlomi Fish which adds PDB wrappers to create, delete, 16037 duplicate and rename gradients. Fixes bug #143528. 16038 16039 * app/pdb/gradients_cmds.c 16040 * app/pdb/internal_procs.c 16041 * libgimp/gimpgradients_pdb.[ch]: regenerated. 16042 160432004-06-01 Michael Natterer <mitch@gimp.org> 16044 16045 * app/core/core-enums.h: renamed the values of the 16046 GimpGradientSegment* enums from GIMP_GRAD_* to 16047 GIMP_GRADIENT_SEGMENT_* because they are exported now. 16048 16049 * app/core/gimp-gradients.c 16050 * app/core/gimpgradient.c 16051 * app/actions/gradient-editor-actions.c: changed accordingly. 16052 16053 * libgimp/gimpenums.h 16054 * plug-ins/pygimp/gimpenums.py 16055 * plug-ins/script-fu/script-fu-constants.c 16056 * tools/pdbgen/enums.pl: regenerated. 16057 160582004-06-01 Sven Neumann <sven@gimp.org> 16059 16060 * plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a 16061 NULL text. 16062 160632004-06-01 Michael Natterer <mitch@gimp.org> 16064 16065 * app/widgets/gimpcontainertreeview-dnd.c 16066 * app/widgets/gimpitemtreeview.c: some cleanup in the tree view 16067 DND code. 16068 160692004-06-01 Michael Natterer <mitch@gimp.org> 16070 16071 * app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added 16072 a horrible hack that sets the paned's position after the first 16073 "size-allocate" after "map". Makes position remembering work for 16074 the toolbox and fixes bug #142697. 16075 16076 * app/widgets/gimpdockable.[ch]: added new function 16077 gimp_dockable_set_tab_style() 16078 16079 * app/actions/dockable-commands.c (dockable_tab_style_cmd_callback) 16080 * app/widgets/gimpsessioninfo.c (gimp_session_info_restore): 16081 use gimp_dockable_set_tab_style(). 16082 160832004-06-01 Michael Natterer <mitch@gimp.org> 16084 16085 * app/widgets/gimptoolbox.c (toolbox_area_notify): removed 16086 unused variable. 16087 160882004-06-01 Sven Neumann <sven@gimp.org> 16089 16090 * plug-ins/common/autocrop.c (query): register as "Autocrop Image" 16091 and "Autocrop Layer". 16092 160932004-06-01 Sven Neumann <sven@gimp.org> 16094 16095 * app/actions/image-commands.c (image_new_cmd_callback): 16096 initialize the dialog by calling file_new_dialog_set(). Fixes bug 16097 #143477. 16098 160992004-05-31 Sven Neumann <sven@gimp.org> 16100 16101 * app/widgets/gimpcontainerentry.[ch]: export the column enum. 16102 16103 * app/gui/file-open-location-dialog.c: use a GimpContainerEntry 16104 on the documents list. Use a custom match function that matches 16105 without the leading protocol part. 16106 161072004-05-31 Michael Natterer <mitch@gimp.org> 16108 16109 * app/widgets/Makefile.am 16110 * app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which 16111 shows the active image. 16112 16113 * app/config/gimpguiconfig.[ch] 16114 * app/config/gimprc-blurbs.h: added config options to control the 16115 visibility of the toolbox' color, indicator and image areas. 16116 16117 * app/widgets/gimptoolbox.[ch]: added the image area and honor the 16118 new config options. Put the various areas into their own wrap box. 16119 16120 * app/widgets/gimptoolbox-dnd.c: changed accordingly. 16121 16122 * app/widgets/gimphelp-ids.h: added a help ID for the image area. 16123 16124 * app/widgets/gimptoolbox-indicator-area.c: made the previews 16125 a bit larger, cleanup. 16126 16127 * app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for 16128 the new config options. 16129 16130 * themes/Default/images/preferences/Makefile.am 16131 * themes/Default/images/preferences/toolbox.png: a (wrong) icon 16132 for the "Toolbox" prefs page. Needs to be replaced. 16133 161342004-05-31 Sven Neumann <sven@gimp.org> 16135 16136 * app/widgets/Makefile.am 16137 * app/widgets/widgets-types.h 16138 * app/widgets/gimpcontainerentry.[ch]: added new widget 16139 GimpContainerEntry, a GtkEntry with completion that implements the 16140 GimpContainerView interface. 16141 16142 * app/tools/gimptextoptions.c (gimp_text_options_gui): added a 16143 GimpContainerEntry to select the font. 16144 161452004-05-31 Sven Neumann <sven@gimp.org> 16146 16147 * app/Makefile.am 16148 * app/actions/file-actions.c 16149 * app/actions/file-commands.[ch] 16150 * app/gui/Makefile.am 16151 * app/gui/file-open-location-dialog.[ch] 16152 * app/widgets/gimphelp-ids.h 16153 * menus/image-menu.xml.in 16154 * menus/toolbox-menu.xml.in: added a rudimentary "Open Location" 16155 dialog. 16156 161572004-05-31 Sven Neumann <sven@gimp.org> 16158 16159 * plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not 16160 to the center as suggested by Chad Daelhousen (bug #142968). 16161 161622004-05-31 Sven Neumann <sven@gimp.org> 16163 16164 * plug-ins/common/mblur.c: applied patch from William Skaggs that 16165 adds the possibility to choose the center of radial and zoom 16166 motion blurs (bug #113711). 16167 161682004-05-31 Sven Neumann <sven@gimp.org> 16169 16170 * app/paint/gimpconvolve.c 16171 * app/paint-funcs/paint-funcs.[ch] 16172 * app/tools/gimpiscissorstool.c: reverted last change and applied 16173 new patch instead (bug #72878). 16174 161752004-05-31 Sven Neumann <sven@gimp.org> 16176 16177 * app/paint/gimpconvolve.c 16178 * app/paint-funcs/paint-funcs.[ch] 16179 * app/tools/gimpiscissorstool.c: applied a patch from Philip 16180 Lafleur that fixes RGBA resampling in Convolve tool (bug #72878). 16181 161822004-05-31 Sven Neumann <sven@gimp.org> 16183 16184 * plug-ins/imagemap/imap_cmd_gimp_guides.c 16185 * plug-ins/imagemap/imap_edit_area_info.c 16186 * plug-ins/imagemap/imap_preferences.c 16187 * plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h. 16188 161892004-05-31 Michael Natterer <mitch@gimp.org> 16190 16191 * app/core/core-enums.h 16192 * app/core/gimpgradient.[ch] 16193 * app/pdb/Makefile.am 16194 * app/widgets/gimpgradienteditor.c 16195 * tools/pdbgen/Makefile.am 16196 * tools/pdbgen/groups.pl 16197 * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi 16198 Fish that adds lots of gradient edit functions to 16199 gimpgradient.[ch] and makes them available through the PDB. 16200 Fixes bug #129675 and bug #129678. 16201 16202 Did some cleanups / enhancments to the patch: 16203 16204 * app/core/gimpgradient.[ch]: changed the naming scheme of the new 16205 functions and changed old functions to match the new scheme. 16206 Introduce a "freeze_count" and public freeze()/thaw() API which 16207 enables subsequent gradient changes without "dirty" being emitted 16208 all the time. Added GimpGradient parameters to all functions 16209 which modify the gradient. 16210 16211 * app/widgets/gimpgradienteditor.c: use the new freeze/thaw 16212 stuff to keep the gradient from updating when not in 16213 "Instant Update" mode. 16214 16215 * app/actions/gradient-editor-commands.c: removed all gradient 16216 editing code and call the new core functions. 16217 16218 * libgimp/Makefile.am 16219 * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all 16220 added functions. Generate libgimp wrappers for them.. 16221 16222 * app/pdb/gradient_edit_cmds.c 16223 * app/pdb/internal_procs.c 16224 * libgimp/gimp_pdb.h 16225 * libgimp/gimpenums.h 16226 * libgimp/gimpgradientedit_pdb.[ch] 16227 * plug-ins/pygimp/gimpenums.py 16228 * plug-ins/script-fu/script-fu-constants.c 16229 * tools/pdbgen/enums.pl: (re)generated. 16230 162312004-05-29 Sven Neumann <sven@gimp.org> 16232 16233 * plug-ins/common/autocrop.c: applied patch from Philip Lafleur 16234 that makes Autocrop register a new procedure that autocrops a 16235 single layer as requested in bug #142618. 16236 16237 * tools/pdbgen/pdb/layer.pdb 16238 * app/pdb/layer_cmds.c 16239 * libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer. 16240 Patch provided by Philip Lafleur (bug #142618). 16241 162422004-05-29 Sven Neumann <sven@gimp.org> 16243 16244 * app/widgets/gimptemplateeditor.c 16245 (gimp_template_editor_constructor): add the spinbuttons to the 16246 size entry in the correct order. Fixes bug #143347. 16247 162482004-05-28 Michael Natterer <mitch@gimp.org> 16249 16250 * app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped 16251 stuff is a local filename (no file URI), convert it to an 16252 URI instead of forwarding it unmodified. 16253 162542004-05-28 Michael Natterer <mitch@gimp.org> 16255 16256 * app/widgets/gimppreview.c (gimp_preview_button_press_event): 16257 don't invoke the popup preview if there is no viewable. 16258 162592004-05-28 Sven Neumann <sven@gimp.org> 16260 16261 * app/widgets/gimppropwidgets.c: same workaround for tooltips on 16262 combo boxes. 16263 162642004-05-28 Sven Neumann <sven@gimp.org> 16265 16266 * plug-ins/Lighting/lighting_ui.c 16267 * plug-ins/MapObject/mapobject_ui.c 16268 * plug-ins/common/warp.c 16269 * plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so 16270 we need to pack it into a GtkEventBox when a tooltip is needed. 16271 162722004-05-28 Michael Natterer <mitch@gimp.org> 16273 16274 * app/text/gimpfont.c (gimp_font_get_popup_size) 16275 (gimp_font_get_new_preview): take both logical and ink rectangle 16276 into account to avoid clipping away parts of the font preview. 16277 Fixes bug #142277. 16278 162792004-05-28 Michael Natterer <mitch@gimp.org> 16280 16281 * app/widgets/gimpcontainerview.[ch]: added "preview-size" and 16282 "preview-border-width" properties. Cleanup. 16283 16284 * app/widgets/gimpcontainerbox.c 16285 * app/widgets/gimpcontainercombobox.c: implement them. 16286 162872004-05-28 Michael Natterer <mitch@gimp.org> 16288 16289 * app/widgets/gimpcontainergridview.[ch] 16290 * app/widgets/gimpcontainertreeview.[ch]: removed "reorderable" 16291 from gimp_container_foo_view_new(). 16292 16293 * app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from 16294 gimp_container_editor_construct(). Automatically set the view to 16295 reorderable if the viewed container has no sort_func. 16296 16297 * app/widgets/gimpbufferview.c 16298 * app/widgets/gimpdatafactoryview.c 16299 * app/widgets/gimpdocumentview.c 16300 * app/widgets/gimpimageview.c 16301 * app/widgets/gimptemplateview.c 16302 * app/widgets/gimptoolview.c 16303 * app/widgets/gimpundoeditor.c: removed reoderable stuff because 16304 GimpContainerEditor does this generically now. 16305 16306 * app/widgets/gimpcontainerpopup.c 16307 * app/widgets/gimpfontview.c: set reorderable to FALSE because 16308 they should not be reodered even if they don't have a sort_func. 16309 16310 * app/gui/font-select.c: removed reorderable stuff. Some cleanup. 16311 16312 * app/gui/brush-select.c 16313 * app/gui/gradient-select.c 16314 * app/gui/palette-select.c 16315 * app/gui/pattern-select.c: same cleanups as in font-select.c 16316 163172004-05-28 Michael Natterer <mitch@gimp.org> 16318 16319 * app/paint/gimpbrushcore.c 16320 * app/paint/gimpdodgeburn.c 16321 * app/paint/gimppaintcore.[ch] 16322 * app/tools/gimpairbrushtool.c 16323 * app/tools/gimpclonetool.c 16324 * app/tools/gimpconvolvetool.c 16325 * app/tools/gimpdodgeburntool.c 16326 * app/tools/gimpinktool.c 16327 * app/tools/gimppaintbrushtool.c 16328 * app/tools/gimppenciltool.c 16329 * app/tools/gimpsmudgetool.c: code review / cleanup. 16330 163312004-05-28 Sven Neumann <sven@gimp.org> 16332 16333 * plug-ins/common/CML_explorer.c 16334 * plug-ins/maze/maze_face.c: added size groups. 16335 16336 * plug-ins/common/sinus.c: HIG-ified. 16337 163382004-05-28 Sven Neumann <sven@gimp.org> 16339 16340 * plug-ins/Lighting/lighting_ui.c: tuned dialog layout for 16341 consistency. 16342 16343 * plug-ins/common/warp.c: added size groups to nicely align the 16344 widgets. 16345 163462004-05-27 Michael Natterer <mitch@gimp.org> 16347 16348 * app/paint/gimp-paint.c (gimp_paint_init): register ink between 16349 airbrush and clone so the stroke dialog's menu of paint functions 16350 has the same order as the default toolbox order. 16351 163522004-05-27 Michael Natterer <mitch@gimp.org> 16353 16354 * app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags 16355 and member GimpPaintCore::flags. Added "gboolean traces_on_window" 16356 to GimpPaintCoreClass (defaults to FALSE). 16357 16358 * app/paint/gimpclone.c: set traces_on_window = TRUE. 16359 16360 * app/paint/gimpbrushcore.[ch]: added 16361 "gboolean handles_changing_brush" to GimpBrushCoreClass (defaults 16362 to FALSE). 16363 16364 * app/paint/gimpclone.c 16365 * app/paint/gimpdodgeburn.c 16366 * app/paint/gimperaser.c 16367 * app/paint/gimppaintbrush.c 16368 * app/paint/gimppaintcore.c: set handles_changing_brush = TRUE. 16369 16370 * app/tools/gimppainttool.c: changed accordingly. 16371 163722004-05-27 Maurits Rijk <m.rijk@chello.nl> 16373 16374 * plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot 16375 (500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm 16376 with O(n) version. 16377 16378 * plug-ins/common/gif.c 16379 * plug-ins/common/gih.c 16380 * plug-ins/common/glasstile.c 16381 * plug-ins/common/gqbist.c 16382 * plug-ins/common/gradmap.c 16383 * plug-ins/common/gtm.c 16384 * plug-ins/common/guillotine.c: Use HIG capitalization style plus 16385 minor code clean-up. 16386 163872004-05-27 Sven Neumann <sven@gimp.org> 16388 16389 * plug-ins/common/png.c (respin_cmap): handle an empty colormap. 16390 Fixes bug #143009. 16391 163922004-05-27 Sven Neumann <sven@gimp.org> 16393 16394 * libgimpwidgets/gimppickbutton.c: applied patch from Philip 16395 Lafleur that fixes color picking for XInput devices (bug #143166). 16396 163972004-05-27 Sven Neumann <sven@gimp.org> 16398 16399 * app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid): 16400 fixed handling of grid offsets in the grid drawing routine. 16401 164022004-05-27 Michael Natterer <mitch@gimp.org> 16403 16404 * app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which 16405 can be one of { FOREGROUND, BACKGROUND }. 16406 16407 * app/widgets/Makefile.am 16408 * app/widgets/gimpfgbgeditor.[ch]: new widget implementing the 16409 FG/BG/Swap/Default color area known from the toolbox. 16410 16411 * app/widgets/gimptoolbox-color-area.c: use the new widget. 16412 16413 * app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and 16414 the color area by a GimpFgBgEditor. 16415 164162004-05-27 Michael Natterer <mitch@gimp.org> 16417 16418 * app/widgets/gimpdocumentview.c (gimp_document_view_new): 16419 gimp_editor_add_action_button() takes a va_list, terminate 16420 it with NULL. Fixes bug #143258. 16421 164222004-05-26 Michael Natterer <mitch@gimp.org> 16423 16424 * app/paint/gimpink.c: restored old time/speed sensitivity 16425 behaviour by doing nothing except figuring if we draw a straight 16426 line in INIT_PAINT. Instead, do all the Blob creating in 16427 MOTION_PAINT and special case the initial (null) "motion" 16428 accordingly. 16429 164302004-05-26 Maurits Rijk <m.rijk@chello.nl> 16431 16432 * plug-ins/common/video.c: code clean-up. Twice as fast now. 16433 16434 * plug-ins/common/flarefx.c: removed timing stuff. 16435 164362004-05-26 Sven Neumann <sven@gimp.org> 16437 16438 * app/core/core-enums.[ch]: shorter names for the gradient types 16439 to reduce the width of the blend tool options. 16440 164412004-05-26 Maurits Rijk <m.rijk@chello.nl> 16442 16443 * plug-ins/common/decompose.c 16444 * plug-ins/common/deinterlace.c 16445 * plug-ins/common/depthmerge.c 16446 * plug-ins/common/despeckle.c 16447 * plug-ins/common/destripe.c 16448 * plug-ins/common/diffraction.c 16449 * plug-ins/common/displace.c 16450 * plug-ins/common/edge.c 16451 * plug-ins/common/emboss.c 16452 * plug-ins/common/engrave.c 16453 * plug-ins/common/exchange.c 16454 * plug-ins/common/film.c 16455 * plug-ins/common/flarefx.c: Use HIG capitalization style. 16456 Added GPL license in a few places. Minor code clean-up. 16457 164582004-05-26 Sven Neumann <sven@gimp.org> 16459 16460 * app/widgets/gimpcolordisplayeditor.c 16461 * modules/cdisplay_colorblind.c 16462 * modules/cdisplay_gamma.c 16463 * modules/cdisplay_highcontrast.c 16464 * modules/cdisplay_proof.c: HIG-ified color display filters. 16465 164662004-05-26 Michael Natterer <mitch@gimp.org> 16467 16468 * app/paint/gimppaintcore.[ch]: added "guint32 time" parameters 16469 to GimpPaintCore::paint() and ::interpolate(). 16470 16471 * app/paint/gimpairbrush.c 16472 * app/paint/gimpbrushcore.c 16473 * app/paint/gimpclone.c 16474 * app/paint/gimpconvolve.c 16475 * app/paint/gimpdodgeburn.c 16476 * app/paint/gimperaser.c 16477 * app/paint/gimppaintbrush.c 16478 * app/paint/gimpsmudge.c: changed accordingly. 16479 16480 * app/paint/gimpink.c: ditto and use the passed time instead of 16481 hardcoded dummy values. 16482 16483 * app/paint/gimppaintcore-stroke.c: pass '0' as time. 16484 16485 * app/tools/gimppainttool.c: pass the GdkEvent time. 16486 164872004-05-26 Michael Natterer <mitch@gimp.org> 16488 16489 * app/paint/Makefile.am 16490 * app/paint/gimpink-blob.[ch] 16491 * app/paint/gimpink.[ch] 16492 * app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool 16493 to be a direct GimpPaintCore subclass without any GUI. 16494 16495 * app/paint/gimp-paint.c: register GimpInk with the list of paint 16496 cores. 16497 16498 * app/tools/Makefile.am 16499 * app/tools/gimpinkoptions.[ch] 16500 * app/tools/gimpinktool-blob.[ch]: removed these files. 16501 16502 * app/tools/gimpinkoptions-gui.[ch]: new files containing only 16503 the GUI for GimpInkOptions. 16504 16505 * app/tools/gimpinktool.[ch]: reduced to some few lines which 16506 implement a simple GimpPaintTool subclass. 16507 16508 * app/tools/gimp-tools.c: associate the GimpInk paint_core with 16509 the GimpInkTool. 16510 165112004-05-26 Michael Natterer <mitch@gimp.org> 16512 16513 * app/paint/gimppaintcore-stroke.c: check if we really have 16514 a GimpBrushCore before casting and accessing its members. 16515 165162004-05-26 Michael Natterer <mitch@gimp.org> 16517 16518 * app/paint/gimpbrushcore.h 16519 * app/paint/gimppaintcore.h: some cleanup. 16520 165212004-05-26 Sven Neumann <sven@gimp.org> 16522 16523 * app/display/gimpdisplayshell-layer-select.c 16524 * app/display/gimpprogress.c 16525 * app/gui/brush-select.c 16526 * app/gui/color-notebook.c 16527 * app/gui/convert-dialog.c 16528 * app/gui/font-select.c 16529 * app/gui/gradient-select.c 16530 * app/gui/info-dialog.c 16531 * app/gui/offset-dialog.c 16532 * app/gui/palette-select.c 16533 * app/gui/pattern-select.c 16534 * app/gui/stroke-dialog.c 16535 * app/gui/tips-dialog.c 16536 * app/tools/gimpmeasuretool.c 16537 * app/tools/gimptexttool.c 16538 * app/widgets/gimpcolordisplayeditor.c 16539 * app/widgets/gimpcolorframe.c 16540 * app/widgets/gimpdevicestatus.c 16541 * app/widgets/gimpviewabledialog.c: adjusted dialog spacings. 16542 165432004-05-26 Michael Natterer <mitch@gimp.org> 16544 16545 * app/paint/gimppaintcore.c: don't do special stuff if a virtual 16546 function doesn't exist. Instead, added default implementations 16547 which do the special stuff and call the virtual functions 16548 unconditionally. 16549 16550 * app/tools/gimppainttool.c: some stylistic cleanup. 16551 165522004-05-26 Michael Natterer <mitch@gimp.org> 16553 16554 * app/paint/gimppaintcore.[ch] (gimp_paint_core_paste) 16555 (gimp_paint_core_replace): replaced the "MaskBuf *paint_mask" 16556 parameters by "PixelRegion *mask_bufPR", so subclasses can pass in 16557 any kind of paint_mask buffer and are not restricted to MaskBufs. 16558 16559 Also removes implicit knowledge about the MaskBuf originating from 16560 a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which 16561 don't need to offset the mask by width/2 height/2 any more. 16562 16563 Made gimp_paint_core_validate_undo_tiles() and 16564 gimp_paint_core_validate_canvas_tiles() protected functions. 16565 16566 * app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas) 16567 (gimp_brush_core_replace_canvas): create correctly positioned 16568 PixelRegions from the MaskBufs before passing them to the 16569 paint_core. 16570 165712004-05-26 Michael Natterer <mitch@gimp.org> 16572 16573 * app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter 16574 and added "GimpPaintOptions" in GimpPaintCore::get_paint_area(). 16575 Check if virtual functions exist befoe calling them. 16576 16577 * app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore 16578 and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE). 16579 Set scale from paint_options in GimpPaintCore::get_paint_area(). 16580 Removed "scale" parameter from gimp_brush_core_paste_canvas() 16581 and _replace_canvas(). 16582 16583 * app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale 16584 to FALSE. 16585 16586 * app/paint/gimpclone.c 16587 * app/paint/gimpconvolve.c 16588 * app/paint/gimpdodgeburn.c 16589 * app/paint/gimperaser.c 16590 * app/paint/gimppaintbrush.c: removed all scale calculations and 16591 simply pass paint_options to GimpPaintCore::get_paint_area(). 16592 165932004-05-26 Michael Natterer <mitch@gimp.org> 16594 16595 * app/tools/gimppainttool.c (gimp_paint_tool_button_press): check 16596 if the GimpPaintCore really is a GimpBrushCore before casting and 16597 fiddling with internaly. 16598 165992004-05-25 Michael Natterer <mitch@gimp.org> 16600 16601 * app/paint/Makefile.am 16602 * app/paint/gimpbrushcore-kernels.h 16603 * app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass 16604 containing all the brush painting specific stuff. 16605 16606 * app/paint/gimppaintcore-kernels.h: removed this file. 16607 16608 * app/paint/gimppaintcore.[ch]: removed all brush stuff. 16609 16610 * app/paint/gimpairbrush.c 16611 * app/paint/gimpclone.[ch] 16612 * app/paint/gimpconvolve.[ch] 16613 * app/paint/gimpdodgeburn.[ch] 16614 * app/paint/gimperaser.[ch] 16615 * app/paint/gimppaintbrush.[ch] 16616 * app/paint/gimppencil.c 16617 * app/paint/gimpsmudge.[ch]: changed accordingly. Derive all 16618 classes which used to derive directly from GimpPaintCore from 16619 GimpBrushCore now. Lots of cleanup. 16620 16621 * app/paint/paint-types.h 16622 * app/paint/gimp-paint.c 16623 * app/paint/gimppaintcore-stroke.c 16624 * app/tools/gimppainttool.c 16625 * tools/kernelgen.c: changed accordingly. 16626 166272004-05-25 Maurits Rijk <m.rijk@chello.nl> 16628 16629 * plug-ins/common/align_layers.c 16630 * plug-ins/common/animoptimize.c 16631 * plug-ins/common/animationplay.c 16632 * plug-ins/common/apply_lens.c 16633 * plug-ins/common/autocrop.c 16634 * plug-ins/common/autostretch_hsv.c 16635 * plug-ins/common/blinds.c 16636 * plug-ins/common/blur.c 16637 * plug-ins/common/borderaverage.c 16638 * plug-ins/common/bz2.c 16639 * plug-ins/common/c_astretch.c 16640 * plug-ins/common/ccanalyze.c 16641 * plug-ins/common/channel_mixer.c 16642 * plug-ins/common/color_enhance.c 16643 * plug-ins/common/colorify.c 16644 * plug-ins/common/colortoalpha.c 16645 * plug-ins/common/csource.c 16646 * plug-ins/common/cubism.c 16647 * plug-ins/common/curve_bend.c: Use HIG capitalization style. 16648 Added GPL license in a few places. Minor code clean-up. 16649 166502004-05-25 Sven Neumann <sven@gimp.org> 16651 16652 Sorry, couldn't resist to finish this task... 16653 16654 * plug-ins/script-fu/script-fu-console.c 16655 * plug-ins/script-fu/script-fu-scripts.c 16656 * plug-ins/script-fu/script-fu-server.c: HIG-ified. 16657 166582004-05-25 Sven Neumann <sven@gimp.org> 16659 16660 * plug-ins/gimpressionist/brush.c 16661 * plug-ins/gimpressionist/color.c 16662 * plug-ins/gimpressionist/general.c 16663 * plug-ins/gimpressionist/gimpressionist.[ch] 16664 * plug-ins/gimpressionist/orientation.c 16665 * plug-ins/gimpressionist/orientmap.c 16666 * plug-ins/gimpressionist/paper.c 16667 * plug-ins/gimpressionist/placement.c 16668 * plug-ins/gimpressionist/presets.c 16669 * plug-ins/gimpressionist/preview.c 16670 * plug-ins/gimpressionist/size.c 16671 * plug-ins/gimpressionist/sizemap.c: HIG-ified. 16672 166732004-05-25 Michael Natterer <mitch@gimp.org> 16674 16675 * app/widgets/gimpitemtreeview.h: added GimpContext parameters 16676 to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc. 16677 16678 * app/widgets/gimpdrawabletreeview.c 16679 * app/widgets/gimpitemtreeview.c: pass the view's context to 16680 the functions. 16681 16682 * app/actions/actions.c (action_data_get_context): return 16683 gimp_get_user_context() if "data" is a Gimp. 16684 16685 * app/actions/channels-commands.[ch] 16686 * app/actions/layers-commands.[ch] 16687 * app/actions/vectors-commands.[ch]: added GimpContext parameters 16688 to the resp. activate, new and edit functions and use the passed 16689 context instead of gimp_get_user_context(). 16690 16691 * app/actions/layers-commands.[ch]: removed the merge and flatten 16692 callbacks. 16693 16694 * app/actions/image-commands.[ch]: made public layer merge utility 16695 function private and cleaned the whole file up a lot. 16696 16697 * app/actions/layers-actions.c: use the callbacks from 16698 image-commands.c for merge and flatten. 16699 16700 * app/actions/edit-commands.c 16701 * app/actions/file-commands.c 16702 * app/actions/select-commands.c: use action_data_get_context() 16703 instead of gimp_get_user_context(). 16704 16705 * app/actions/edit-actions.c: some cleanup. 16706 167072004-05-25 Sven Neumann <sven@gimp.org> 16708 16709 * plug-ins/common/plugindetails.c 16710 * plug-ins/dbbrowser/dbbrowser_utils.c 16711 * plug-ins/pagecurl/pagecurl.c: HIG-ified. 16712 167132004-05-25 Sven Neumann <sven@gimp.org> 16714 16715 * plug-ins/print/gimp_color_window.c 16716 * plug-ins/print/gimp_main_window.c: HIG-ified and ported to 16717 GtkFileChooser. 16718 16719 * plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported 16720 forgotten callback to GtkFileChooser. 16721 16722 * plug-ins/imagemap/imap_browse.c 16723 * plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser. 16724 167252004-05-25 Michael Natterer <mitch@gimp.org> 16726 16727 * app/actions/file-actions.c 16728 * app/actions/file-commands.[ch]: removed action "file-new", added 16729 action "file-open-from-image". 16730 16731 * app/actions/image-actions.c 16732 * app/actions/image-commands.[ch]: added actions "image-new" and 16733 "image-new-from-image". 16734 16735 * menus/image-menu.xml.in: use the "-from-image" variants of 16736 the "new" and "open" actions so the dialogs are preconfigured 16737 from the image they were invoked from (regression fix). 16738 16739 * menus/toolbox-menu.xml.in: s/file-new/image-new/. 16740 167412004-05-24 Sven Neumann <sven@gimp.org> 16742 16743 * plug-ins/rcm/rcm.h 16744 * plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog. 16745 167462004-05-24 Michael Natterer <mitch@gimp.org> 16747 16748 * app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil 16749 hack as workaround for the missing gtk_action_get_accel_closure(). 16750 Re-enables accelerator display in the tool button tooltips. 16751 167522004-05-24 Michael Natterer <mitch@gimp.org> 16753 16754 * app/vectors/Makefile.am 16755 * app/vectors/gimpcoordmath.[ch]: removed... 16756 16757 * app/core/Makefile.am 16758 * app/core/gimpcoords.[ch]: ...and added without the "bezier" 16759 namespace. 16760 16761 * app/vectors/gimpbezierstroke.c: changed accordingly. 16762 16763 * app/Makefile.am: force it to link gimpcoords.o 16764 167652004-05-24 Michael Natterer <mitch@gimp.org> 16766 16767 * app/config/gimpconfigwriter.c 16768 * app/core/gimpstrokeoptions.c 16769 * app/widgets/gimpactiongroup.c 16770 * app/widgets/gimpcolorframe.h 16771 * app/widgets/gimpcolorpanel.h 16772 * app/widgets/gimpcontainerview.[ch] 16773 * app/widgets/gimptooldialog.h 16774 * app/widgets/gimpuimanager.c 16775 * app/widgets/widgets-types.h: fixed various small issues I 16776 stumbled across when updating the API reference for app/. 16777 167782004-05-24 Sven Neumann <sven@gimp.org> 16779 16780 * app/display/gimpscalecombobox.c 16781 (gimp_scale_combo_box_mru_remove_last): removed debugging output. 16782 167832004-05-24 Sven Neumann <sven@gimp.org> 16784 16785 * app/core/gimptoolinfo.[ch]: derive GimpToolInfo from 16786 GimpViewable, it doesn't make sense for it to be a GimpData. 16787 16788 * app/widgets/gimptooloptionseditor.c 16789 (gimp_tool_options_editor_get_title): do not append " Options" to 16790 the tool name. Fixes bug #142280. 16791 167922004-05-24 Sven Neumann <sven@gimp.org> 16793 16794 * plug-ins/common/mblur.c: fixed range check of blur type 16795 parameter (bug #142965). 16796 167972004-05-24 Sven Neumann <sven@gimp.org> 16798 16799 * plug-ins/maze/maze_face.c: fixed a compiler warning. 16800 168012004-05-24 Sven Neumann <sven@gimp.org> 16802 16803 Applied a patch from Philip Lafleur (bug #142808): 16804 16805 * app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5 16806 16807 * app/paint/gimpairbrush.c 16808 * app/paint/gimpclone.c 16809 * app/paint/gimpconvolve.c 16810 * app/paint/gimpdodgeburn.c 16811 * app/paint/gimperaser.c 16812 * app/paint/gimppaintbrush.c 16813 * app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant. 16814 168152004-05-24 Michael Natterer <mitch@gimp.org> 16816 16817 Long overdue core container cleanup: 16818 16819 * app/core/gimplist.[ch]: added "unique-names" and "sort-func" 16820 properties and merged the resp. code from GimpDataList into 16821 GimpList. Removed "policy" parameters from gimp_list_new() and 16822 added "unique_names". Added new constructor gimp_list_new_weak(). 16823 Made public function gimp_list_uniquefy_name() private. 16824 16825 * app/core/Makefile.am 16826 * app/core/core-types.h 16827 * app/core/gimpdatalist.[ch]: removed. Its functionality is 16828 entirely in GimpList now. 16829 16830 * app/core/gimpdata.[ch]: added gimp_data_name_compare() which 16831 used to live in GimpDataList. 16832 16833 * app/core/gimp.c 16834 * app/core/gimpdatafactory.c 16835 * app/core/gimpimage.c 16836 * app/core/gimptoolinfo.c 16837 * app/core/gimpundostack.c 16838 * app/paint/gimp-paint.c 16839 * app/tools/gimp-tools.c 16840 * app/widgets/gimpdevices.c 16841 * app/widgets/gimptemplateeditor.c 16842 * app/widgets/gimpundoeditor.c: changed list creation accordingly. 16843 16844 Made gimp->templates, gimp->named_buffers, tool_info->presets and 16845 the image's lists of layers, channels and vectors automatically 16846 ensure unique names. 16847 16848 * app/widgets/gimptemplateview.c 16849 * app/actions/file-commands.c 16850 * app/actions/templates-commands.c 16851 * app/actions/tool-options-commands.c: removed calls to 16852 gimp_list_uniquefy_name(). 16853 16854 * app/core/gimpitem.c: removed major insanity where the items 16855 themselves where ensuring their unique names. Bah! 16856 16857 * app/core/gimplayer.c (gimp_layer_name_changed): chain up 16858 conditionally. 16859 16860 * app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed 16861 because there is no need any more to keep the parent 16862 implementation from being invoked. 16863 168642004-05-23 Sven Neumann <sven@gimp.org> 16865 16866 More fixes for bug #142996: 16867 16868 * plug-ins/common/postscript.c 16869 * plug-ins/common/sparkle.c 16870 * plug-ins/common/sunras.c 16871 * plug-ins/common/uniteditor.c 16872 * plug-ins/fits/fits.c: fixed typos. 16873 168742004-05-23 Sven Neumann <sven@gimp.org> 16875 16876 Fixes for bug #142996: 16877 16878 * app/gui/preferences-dialog.c: added missing gettext call. 16879 16880 * app/config/gimprc-blurbs.h 16881 * app/core/gimptemplate.c 16882 * app/gui/gradient-editor-menu.c: fixed typos. 16883 168842004-05-23 Michael Natterer <mitch@gimp.org> 16885 16886 * app/core/gimpdatalist.c: code cleanup, no logic changed. 16887 168882004-05-23 Henrik Brix Andersen <brix@gimp.org> 16889 16890 * app/config/gimprc-blurbs.h 16891 * plug-ins/gfig/gfig-spiral.c (spiral_button_press) 16892 * plug-ins/gimpressionist/orientation.c (create_orientationpage) 16893 * plug-ins/common/diffraction.c (diffraction_dialog) 16894 * plug-ins/common/bumpmap.c (bumpmap_dialog) 16895 * plug-ins/maze/maze.h 16896 * plug-ins/MapObject/mapobject_apply.c (compute_image) 16897 * app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update) 16898 * plug-ins/print/gimp_main_window.c (create_scaling_frame): marked 16899 strings for translation, corrected small typos. Fixes part of bug 16900 #142996 16901 169022004-05-23 Žygimantas Beručka <uid0@akl.lt> 16903 16904 * configure.in: Added "lt" to ALL_LINGUAS. 16905 169062004-05-23 Michael Schumacher <schumaml@cvs.gnome.org> 16907 16908 * libgimp/gimp.def: gimp_register_file_handler_mime added 16909 169102004-05-23 Michael Natterer <mitch@gimp.org> 16911 16912 * app/widgets/widgets-types.h: reoedered to somehow reflect the 16913 class hierarchy. 16914 16915 Some dockable context handling cleanup: 16916 16917 * app/widgets/gimpdocked.[ch]: removed "prev_context" parameter 16918 from GimpDocked::set_context(). Widgets which need the old context 16919 to disconnect from should remember it themselves. 16920 16921 * app/widgets/gimpdockable.c (gimp_dockable_set_context): don't 16922 pass the old context to gimp_docked_set_context(). 16923 Some cleanup. 16924 16925 * app/widgets/gimpcontainerbox.c 16926 * app/widgets/gimpcontainereditor.c: changed accordingly. 16927 16928 * app/display/gimpnavigationview.[ch] 16929 * app/widgets/gimpimageeditor.[ch] 16930 * app/widgets/gimpitemtreeview.[ch]: added a "context" member 16931 which holds the context set by GimpDocked::set_context(). 16932 16933 * app/widgets/gimpdrawabletreeview.c: use the view's context 16934 instead of gimp_get_user_context(). 16935 16936 * app/widgets/gimpcoloreditor.[ch]: removed separate API to 16937 set the context because it implements the GimpDockedInterface. 16938 16939 * app/widgets/gimpcomponenteditor.c 16940 * app/widgets/gimperrorconsole.c: pass "menu-factory", 16941 "menu-identifier" and "ui-path" to g_object_new() instead of 16942 calling gimp_editor_create_menu() later. 16943 16944 Action cleanup partly related to the context stuff above: 16945 16946 * app/actions/actions.c (action_data_get_gimp): get the Gimp from 16947 context->gimp, not gimage->gimp because gimage may be NULL. 16948 16949 (action_data_get_context): changed to use the new context members 16950 added above. 16951 16952 * app/actions/channels-actions.c (channels_actions_update): cleanup. 16953 16954 * app/actions/edit-actions.c (edit_actions_update): fixed 16955 sensitivity of "edit-undo-clear". 16956 16957 * app/actions/vectors-actions.c (vectors_actions_update): make 16958 "vectors-merge-visible" sensitive only if there is more than one 16959 GimpVectors in the image. 16960 16961 * app/actions/colormap-editor-actions.c 16962 * app/actions/gradient-editor-actions.c 16963 * app/actions/palette-editor-actions.c: added FG/BG color previews 16964 to actions which take colors from them. Changed code to be safe 16965 against "context" being NULL. 16966 16967 * app/actions/drawable-commands.c: 16968 s/active_drawable/drawable/g. Makes the code more readable. 16969 16970 * app/actions/select-commands.[ch] 16971 * app/actions/vectors-commands.[ch]: removed public stroke utility 16972 functions and other stuff which is not needed any more because 16973 dialog buttons invoke the correct actions now. Moved the 16974 functions' code to the resp. action callbacks. 16975 169762004-05-21 Nathan Summers <rock@gimp.org> 16977 16978 Somehow some of the changes from my commit on 2004-05-18 seem to have 16979 gotten lost, including the addition to the ChangeLog. Sorry about that. 16980 Recommitted. 16981 16982 * NEWS: Clarified end-user visible features. 16983 Made sundry small grammar and consistancy fixes. 16984 Reorganized list of changes slightly. 16985 169862004-05-21 Sven Neumann <sven@gimp.org> 16987 16988 * app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better 16989 fix for bug #123811; patch provided by Philip Lafleur. 16990 169912004-05-21 Sven Neumann <sven@gimp.org> 16992 16993 * app/gui/preferences-dialog.c: added some GtkSizeGroups and 16994 changed spacings to improve the dialog layout. 16995 16996 * app/gui/file-new-dialog.c 16997 * app/widgets/gimpgrideditor.c 16998 * app/widgets/gimptemplateeditor.c: minor changes for consistency. 16999 170002004-05-21 Sven Neumann <sven@gimp.org> 17001 17002 * plug-ins/gflare/gflare.c 17003 * plug-ins/gfli/gfli.c 17004 * plug-ins/ifscompose/ifscompose.c 17005 * plug-ins/sel2path/sel2path.c 17006 * plug-ins/sel2path/sel2path_adv_dialog.c 17007 * plug-ins/sgi/sgi.c 17008 * plug-ins/winicon/icodialog.c: HIG-ification. 17009 170102004-05-21 Michael Natterer <mitch@gimp.org> 17011 17012 * app/actions/data-commands.c (data_delete_callback): eek, delete 17013 the data only if "OK" was pressed. 17014 170152004-05-21 Michael Natterer <mitch@gimp.org> 17016 17017 * app/widgets/gimperrorconsole.c 17018 (gimp_error_console_save_ext_clicked): use 17019 gtk_widget_get_screen(), not window_get_screen() on a button. 17020 170212004-05-20 Maurits Rijk <m.rijk@chello.nl> 17022 17023 * plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced 17024 deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893), 17025 use file choosers instead of file selectors, minor clean-up. 17026 170272004-05-20 Sven Neumann <sven@gimp.org> 17028 17029 * plug-ins/Lighting/lighting_ui.c 17030 * plug-ins/MapObject/mapobject_ui.c 17031 * plug-ins/bmp/bmpwrite.c 17032 * plug-ins/fits/fits.c 17033 * plug-ins/flame/flame.c 17034 * plug-ins/fp/fp.c 17035 * plug-ins/gfig/gfig-preview.c 17036 * plug-ins/gfig/gfig.c: HIG-ified. 17037 170382004-05-20 Sven Neumann <sven@gimp.org> 17039 17040 * plug-ins/FractalExplorer/Dialogs.c 17041 * plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and 17042 some code cleanup. 17043 170442004-05-19 Manish Singh <yosh@gimp.org> 17045 17046 * plug-ins/pygimp/gimpfu.py: Actually return values from the run 17047 function. Fixes #141338. 17048 170492004-05-20 Sven Neumann <sven@gimp.org> 17050 17051 * plug-ins/maze/maze_face.c 17052 * plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings". 17053 170542004-05-20 Sven Neumann <sven@gimp.org> 17055 17056 * plug-ins/common/warp.c 17057 * plug-ins/common/whirlpinch.c 17058 * plug-ins/common/wmf.c 17059 * plug-ins/common/xbm.c 17060 * plug-ins/common/xpm.c: HIG-ified. 17061 170622004-05-19 Manish Singh <yosh@gimp.org> 17063 17064 * app/actions/file-actions.c: remove unnecessary G_OBJECT() casts. 17065 17066 * tools/pdbgen/pdb/help.pdb 17067 * tools/pdbgen/pdb/image.pdb 17068 * tools/pdbgen/pdb/paths.pdb 17069 * tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up. 17070 17071 * tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly. 17072 17073 * app/pdb/plug_in_cmds.c: regenerated. 17074 170752004-05-20 Sven Neumann <sven@gimp.org> 17076 17077 * plug-ins/common/tga.c 17078 * plug-ins/common/threshold_alpha.c 17079 * plug-ins/common/tiff.c 17080 * plug-ins/common/tile.c 17081 * plug-ins/common/tileit.c 17082 * plug-ins/common/uniteditor.c 17083 * plug-ins/common/unsharp.c 17084 * plug-ins/common/video.c 17085 * plug-ins/common/vpropagate.c: HIG-ified. 17086 170872004-05-20 Sven Neumann <sven@gimp.org> 17088 17089 * plug-ins/common/randomize.c 17090 * plug-ins/common/ripple.c 17091 * plug-ins/common/sample_colorize.c 17092 * plug-ins/common/scatter_hsv.c 17093 * plug-ins/common/sel_gauss.c 17094 * plug-ins/common/sharpen.c 17095 * plug-ins/common/shift.c 17096 * plug-ins/common/smooth_palette.c 17097 * plug-ins/common/snoise.c 17098 * plug-ins/common/sobel.c 17099 * plug-ins/common/sparkle.c 17100 * plug-ins/common/spread.c 17101 * plug-ins/common/struc.c 17102 * plug-ins/common/sunras.c 17103 * plug-ins/common/svg.c: HIG-ified. 17104 171052004-05-19 Michael Natterer <mitch@gimp.org> 17106 17107 * app/widgets/Makefile.am 17108 * app/widgets/widgets-types.h 17109 * app/widgets/gimpaction.[ch]: new GtkAction subclass which can 17110 show either a color or viewable preview in GtkImageMenuItem 17111 proxies. 17112 17113 * app/widgets/gimpenumaction.[ch] 17114 * app/widgets/gimppluginaction.[ch] 17115 * app/widgets/gimpstringaction.[ch]: derive them from GimpAction. 17116 17117 * app/widgets/gimpactiongroup.c (gimp_action_group_add_actions): 17118 add GimpActions, not GtkActions. 17119 17120 (gimp_action_group_set_action_color) 17121 (gimp_action_group_set_action_viewable): removed all hacks and 17122 simply set the "color" or "viewable" properties of the GimpAction 17123 to change. Fixes color/viewable previews in menus. 17124 17125 * app/actions/file-actions.c: show previews in the "Open Recent" 17126 menu items. 17127 17128 Unrelated: 17129 17130 * app/widgets/widgets-types.h: removed GimpDockedInterface typedef... 17131 17132 * app/widgets/gimpdocked.h: ...and added it here. We don't have 17133 class struct typedefs in the types header either. 17134 17135 * app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut 17136 for "edit-fill-pattern". 17137 17138 * app/actions/gradient-editor-actions.c: added some stock IDs. 17139 Please comment. 17140 171412004-05-19 Sven Neumann <sven@gimp.org> 17142 17143 * plug-ins/common/papertile.c 17144 * plug-ins/common/pat.c 17145 * plug-ins/common/pixelize.c 17146 * plug-ins/common/png.c 17147 * plug-ins/common/postscript.c 17148 * plug-ins/common/psp.c: HIG-ified. 17149 171502004-05-19 Sven Neumann <sven@gimp.org> 17151 17152 * plug-ins/common/mapcolor.c 17153 * plug-ins/common/mblur.c 17154 * plug-ins/common/mng.c 17155 * plug-ins/common/mosaic.c 17156 * plug-ins/common/newsprint.c 17157 * plug-ins/common/oilify.c: HIG-ified. 17158 171592004-05-19 Sven Neumann <sven@gimp.org> 17160 17161 * plug-ins/common/hot.c 17162 * plug-ins/common/iwarp.c 17163 * plug-ins/common/jpeg.c 17164 * plug-ins/common/lic.c 17165 * plug-ins/common/mail.c: HIG-ified. 17166 171672004-05-19 Sven Neumann <sven@gimp.org> 17168 17169 * plug-ins/common/gauss_iir.c 17170 * plug-ins/common/gauss_rle.c 17171 * plug-ins/common/gbr.c 17172 * plug-ins/common/gee.c 17173 * plug-ins/common/gee_zoom.c 17174 * plug-ins/common/gif.c 17175 * plug-ins/common/gih.c 17176 * plug-ins/common/glasstile.c 17177 * plug-ins/common/gtm.c: HIG-ified. 17178 171792004-05-19 Sven Neumann <sven@gimp.org> 17180 17181 * plug-ins/common/exchange.c: fixed minor dialog layout issues. 17182 17183 * plug-ins/common/screenshot.c: added the camera icon to the dialog. 17184 17185 * plug-ins/common/film.c 17186 * plug-ins/common/fractaltrace.c: HIG-ified. 17187 171882004-05-19 Sven Neumann <sven@gimp.org> 17189 17190 * app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make 17191 sure that pressure never becomes negative. Fixes bug #123811; 17192 thanks to Philip Lafleur for investigating this problem. 17193 171942004-05-19 Sven Neumann <sven@gimp.org> 17195 17196 * plug-ins/common/channel_mixer.c: added some stock icons. 17197 17198 * plug-ins/common/edge.c 17199 * plug-ins/common/emboss.c 17200 * plug-ins/common/engrave.c 17201 * plug-ins/common/exchange.c: HIG-ified. 17202 17203 * plug-ins/common/sel_gauss.c: tiny changes for a more consistent 17204 HIG-ification. 17205 172062004-05-19 Michael Natterer <mitch@gimp.org> 17207 17208 * tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an 17209 underscore-prefixed function which needs to be wrapped. 17210 17211 * libgimp/gimpplugin_pdb.[ch]: regenerated. 17212 17213 * libgimp/Makefile.am 17214 * libgimp/gimp.h 17215 * libgimp/gimpplugin.[ch]: new files containing 17216 gimp_plugin_icon_register() which has no "icon_data_length" 17217 parameter and determines it from the passed icon data. 17218 17219 * libgimp/gimp.def: added gimp_plugin_icon_register. 17220 17221 * plug-ins/common/plugindetails.c 17222 * plug-ins/common/screenshot.c 17223 * plug-ins/common/uniteditor.c 17224 * plug-ins/print/print.c: don't pass the icon_data_length. 17225 172262004-05-18 Sven Neumann <sven@gimp.org> 17227 17228 * plug-ins/common/checkerboard.c 17229 * plug-ins/common/colorify.c 17230 * plug-ins/common/colortoalpha.c 17231 * plug-ins/common/compose.c 17232 * plug-ins/common/convmatrix.c 17233 * plug-ins/common/csource.c 17234 * plug-ins/common/cubism.c 17235 * plug-ins/common/decompose.c 17236 * plug-ins/common/deinterlace.c 17237 * plug-ins/common/depthmerge.c 17238 * plug-ins/common/despeckle.c 17239 * plug-ins/common/destripe.c 17240 * plug-ins/common/diffraction.c 17241 * plug-ins/common/displace.c: HIG-ified. 17242 172432004-05-18 Michael Natterer <mitch@gimp.org> 17244 17245 Allow plug-ins to register menu icons. Fixes bug #120500. 17246 17247 * app/core/core-enums.[ch]: added enum GimpIconType which can 17248 be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }. 17249 17250 * app/config/gimpconfigwriter.[ch] (gimp_config_writer_data) 17251 * app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new 17252 functions which write/parse raw binary data. Needed for storing 17253 inline pixbufs in pluginrc. 17254 17255 * app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier): 17256 new function which writes out an unquoted and unescaped string. 17257 17258 * app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added 17259 new members "icon_type", "icon_data_length" and "icon_data". 17260 Reordered members so file_proc specific stuff is at the end. 17261 17262 (plug_in_proc_def_get_stock_id) 17263 (plug_in_proc_def_get_pixbuf): new functions to access the 17264 procedure's icon. 17265 17266 * app/plug-in/plug-in-rc.c: save/restore the registered icons. 17267 17268 * app/actions/file-dialog-actions.c 17269 * app/actions/plug-in-actions.c: set the action's stock ID from 17270 the procedure's stock ID. 17271 17272 * app/widgets/gimppluginaction.c 17273 (gimp_plug_in_action_connect_proxy): if the procedure provides a 17274 pixbuf, set it as icon for the menu item. 17275 17276 * app/menus/file-dialog-menu.[ch] 17277 * app/menus/file-open-menu.c 17278 * app/menus/file-save-menu.c 17279 * app/xcf/xcf.c: changed accordingly. 17280 17281 * tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB 17282 function which can be called during query(). 17283 17284 * tools/pdbgen/enums.pl 17285 * app/pdb/internal_procs.c 17286 * app/pdb/plug_in_cmds.c 17287 * libgimp/gimpenums.h 17288 * libgimp/gimpplugin_pdb.c 17289 * libgimp/gimpplugin_pdb.h 17290 * plug-ins/pygimp/gimpenums.py 17291 * plug-ins/script-fu/script-fu-constants.c: regenerated. 17292 17293 * plug-ins/common/plugindetails.c 17294 * plug-ins/common/uniteditor.c 17295 * plug-ins/print/print.c: register stock_id icons. 17296 17297 * plug-ins/common/screenshot.c: register an inline_pixbuf icon for 17298 testing purposes (used emblem-camera.png from gnome-icon-theme). 17299 17300 * app/actions/dialogs-actions.c 17301 * app/actions/file-actions.c: unrelated: added some more icons 17302 to menu items. 17303 173042004-05-18 Maurits Rijk <m.rijk@chello.nl> 17305 17306 * plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed 17307 improvement (around 70 %). 17308 173092004-05-18 Sven Neumann <sven@gimp.org> 17310 17311 * plug-ins/common/blur.c 17312 * plug-ins/common/borderaverage.c 17313 * plug-ins/common/bumpmap.c 17314 * plug-ins/common/ccanalyze.c: HIG-ified. 17315 173162004-05-18 Sven Neumann <sven@gimp.org> 17317 17318 * libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label): 17319 return the created label widget so that it can for example be put 17320 into a GtkSizeGroup. 17321 17322 * plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the 17323 optional "Preview" frame. Always put the preview into a sunken 17324 frame. 17325 17326 * plug-ins/common/AlienMap2.c 17327 * plug-ins/common/blinds.c 17328 * plug-ins/common/flarefx.c 17329 * plug-ins/common/glasstile.c 17330 * plug-ins/common/grid.c 17331 * plug-ins/common/illusion.c 17332 * plug-ins/common/jigsaw.c 17333 * plug-ins/common/max_rgb.c 17334 * plug-ins/common/nlfilt.c 17335 * plug-ins/common/noisify.c 17336 * plug-ins/common/nova.c 17337 * plug-ins/common/plasma.c 17338 * plug-ins/common/polar.c 17339 * plug-ins/common/waves.c 17340 * plug-ins/common/wind.c: changed accordingly, HIG-ified. 17341 173422004-05-18 Sven Neumann <sven@gimp.org> 17343 17344 * plug-ins/common/aa.c 17345 * plug-ins/common/align_layers.c 17346 * plug-ins/common/animationplay.c 17347 * plug-ins/common/apply_lens.c: HIG-ified. 17348 173492004-05-18 Michael Natterer <mitch@gimp.org> 17350 17351 * app/core/gimptoolinfo.c: made the "visible" property serializable. 17352 17353 * app/tools/gimp-tools.c: store the tools' order and visibility 17354 in a new config file called "toolrc". 17355 173562004-05-18 Sven Neumann <sven@gimp.org> 17357 17358 * plug-ins/gimpressionist/brush.c: ported to GtkFileChooser. 17359 17360 * plug-ins/gimpressionist/gimpressionist.h 17361 * plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const 17362 qualifiers. 17363 173642004-05-18 Sven Neumann <sven@gimp.org> 17365 17366 * plug-ins/common/curve_bend.c 17367 * plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and 17368 HIG-ified. 17369 173702004-05-18 Sven Neumann <sven@gimp.org> 17371 17372 * plug-ins/common/channel_mixer.c 17373 * plug-ins/common/gqbist.c: ported to GtkFileChooser and 17374 HIG-ified. 17375 17376 * plug-ins/common/spheredesigner.c: ditto, but needs more love. 17377 173782004-05-18 Michael Natterer <mitch@gimp.org> 17379 17380 * app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new 17381 function which returns a newly allocated string which is the menu 17382 item's name stripped of mnemonics an ellipses. 17383 17384 * app/actions/plug-in-actions.c (plug_in_actions_update) 17385 * app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function 17386 instead of implementing the same twice slightly different. 17387 173882004-05-17 Sven Neumann <sven@gimp.org> 17389 17390 * plug-ins/common/CEL.c 17391 * plug-ins/common/CML_explorer.c: ported to GtkFileChooser and 17392 HIG-ified. 17393 173942004-05-17 Sven Neumann <sven@gimp.org> 17395 17396 * plug-ins/common/AlienMap2.c: HIG-ified (more or less). 17397 173982004-05-17 Michael Natterer <mitch@gimp.org> 17399 17400 * menus/menus.xsl: put the image popup menu into a dummy menubar 17401 to work around the silly GtkUIManager restriction that popup menus 17402 can't have tearoff items. 17403 17404 * app/menus/menus.c 17405 * app/menus/image-menu.c 17406 * app/display/gimpdisplayshell-callbacks.c 17407 * app/gui/gui-vtable.c 17408 * app/menus/plug-in-menus.c: changed accordingly. 17409 17410 * app/gui/gui.c (gui_restore_after_callback): connect to 17411 "notify::tearoff-menus" of GimpGuiConfig and reconfigure the 17412 global image UI manager accordingly. 17413 17414 * app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the 17415 "tearoff-menus" property because GtkUIManager can change this on 17416 the fly. 17417 17418 * app/display/gimpdisplayshell.[ch]: added the menubar to the 17419 GimpDisplayShell struct. Some cleanup in gimp_display_shell_new(). 17420 17421 * app/display/gimpdisplayshell-appearance.c 17422 (gimp_display_shell_set_show_menubar): use shell->menubar instead 17423 of asking the UI manager. 17424 17425 * app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get() 17426 to transparently load the XML files even if a sub-widget was 17427 requested. Reordered parameters of gimp_ui_manager_ui_popup(). 17428 Lots of internal cleanups. 17429 17430 * app/widgets/gimpdockable.c 17431 * app/widgets/gimptooloptionseditor.c: simplified accordingly. 17432 17433 * app/widgets/gimpeditor.[ch]: added new function 17434 gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and 17435 updates/shows the editor's menu. 17436 17437 * app/widgets/gimpcolormapeditor.c 17438 * app/widgets/gimpcomponenteditor.c 17439 * app/widgets/gimpcontainereditor.c 17440 * app/widgets/gimpcontainergridview.c 17441 * app/widgets/gimpcontainertreeview.c 17442 * app/widgets/gimperrorconsole.c 17443 * app/widgets/gimpgradienteditor.c 17444 * app/widgets/gimpitemtreeview.c 17445 * app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu(). 17446 17447 * app/widgets/gimptoolbox.c: moved all code from 17448 gimp_toolbox_new() to GObject::constructor(). 17449 174502004-05-17 Michael Natterer <mitch@gimp.org> 17451 17452 * app/actions/tool-options-actions.c: added icons to the Save, 17453 Load, Rename and Delete submenus. 17454 174552004-05-17 Michael Natterer <mitch@gimp.org> 17456 17457 * app/actions/edit-actions.c (edit_actions_update): don't forget 17458 to set the sensitivity of "edit-named-copy". 17459 174602004-05-17 Sven Neumann <sven@gimp.org> 17461 17462 * app/core/gimpimage.c (gimp_image_init): initialize the image 17463 unit to GIMP_UNIT_PIXEL. 17464 17465 * app/pdb/image_cmds.c 17466 * tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used 17467 in the gimp_image_set_unit() PDB call. 17468 174692004-05-16 Sven Neumann <sven@gimp.org> 17470 17471 * plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of 17472 layer ID; bug #142326. 17473 174742004-05-15 Sven Neumann <sven@gimp.org> 17475 17476 * app/tools/gimpcurvestool.c: fixed position of vertical line 17477 indicating the picked color. Patch from William Skaggs and 17478 Søren Wedel Nielsen; fixes bug #142506. 17479 174802004-05-15 Michael Natterer <mitch@gimp.org> 17481 17482 * app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed 17483 warnings to include the invalid menu path. Added check that makes 17484 sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not* 17485 "<Prefix>foo". 17486 17487 * app/actions/plug-in-actions.c: added function 17488 plug_in_actions_check_translation() which validates both the 17489 original and translated menu paths and spits detailed error 17490 messages if any of them is broken. Made action creation simpler 17491 (?) and more robust. 17492 17493 * app/menus/plug-in-menus.c: argh, the translated menu path must 17494 be a sorting criteria *only*. Fixed the whole stuff to always use 17495 the original menu path because translation is done entirely by 17496 plug-in-actions.c. Fixes bad crashes for all locales. Added 17497 boolean return value to plug_in_menus_build_path() and don't try 17498 to create the menu item in an invalid location if creating the 17499 submenus failed. 17500 175012004-05-14 Sven Neumann <sven@gimp.org> 17502 17503 * app/menus/file-dialog-menu.c: check if the file procedure 17504 registered a menu path at all. The menu should probably be created 17505 from the registered menu path, not from gimp->[load|save]_procs. 17506 17507 * app/plug-in/plug-in-proc.[ch] 17508 * app/plug-in/plug-ins.c: removed broken code that used to sort 17509 the file procedures. 17510 17511 * plug-ins/common/CEL.c 17512 * plug-ins/common/bz2.c 17513 * plug-ins/common/gz.c 17514 * plug-ins/common/pcx.c 17515 * plug-ins/common/pix.c 17516 * plug-ins/common/sunras.c 17517 * plug-ins/sgi/sgi.c 17518 * plug-ins/xjt/xjt.c: register a mimetype, set a translatable 17519 action name (mostly taken from shared-mime-info) and register to 17520 the <Load> and <Save> menus using gimp_plugin_menu_register(). 17521 175222004-05-14 Michael Natterer <mitch@gimp.org> 17523 17524 * app/pdb/fileops_cmds.c 17525 * libgimp/gimpfileops_pdb.c: regenerated. 17526 175272004-05-14 Michael Natterer <mitch@gimp.org> 17528 17529 * app/actions/select-actions.c (select_actions_update): don't 17530 make "select-invert" insensitive if there is no selection. 17531 175322004-05-14 Sven Neumann <sven@gimp.org> 17533 17534 * plug-ins/common/aa.c 17535 * plug-ins/common/gbr.c 17536 * plug-ins/common/gih.c 17537 * plug-ins/common/gtm.c 17538 * plug-ins/common/header.c 17539 * plug-ins/common/pat.c 17540 * plug-ins/common/pnm.c 17541 * plug-ins/common/psp.c 17542 * plug-ins/fits/fits.c 17543 * plug-ins/gfli/gfli.c: register a mimetype, set a translatable 17544 action name (mostly taken from shared-mime-info) and register to 17545 the <Load> and <Save> menus using gimp_plugin_menu_register(). 17546 175472004-05-14 Sven Neumann <sven@gimp.org> 17548 17549 * tools/pdbgen/pdb/fileops.pdb: added new PDB function 17550 gimp_register_file_handler_mime() that allows to associate a MIME 17551 type with a file procecdurre. 17552 17553 * app/pdb/fileops_cmds.c 17554 * app/pdb/internal_procs.c 17555 * libgimp/gimpfileops_pdb.[ch]: regenerated. 17556 17557 * app/plug-in/plug-in-proc.[ch] 17558 * app/plug-in/plug-in-rc.c 17559 * app/plug-in/plug-ins.[ch]: store a mimetype with file procedures. 17560 17561 * app/actions/file-commands.c 17562 * app/core/gimpdocumentlist.[ch] 17563 * app/core/gimpimagefile.[ch] 17564 * app/file/file-open.[ch] 17565 * app/file/file-save.c: set the thumbnail's mimetype from the file 17566 procedure used to load/save the image. 17567 17568 * app/xcf/xcf.c 17569 * plug-ins/bmp/bmp.c 17570 * plug-ins/common/csource.c 17571 * plug-ins/common/dicom.c 17572 * plug-ins/common/gif.c 17573 * plug-ins/common/gifload.c 17574 * plug-ins/common/jpeg.c 17575 * plug-ins/common/mng.c 17576 * plug-ins/common/png.c 17577 * plug-ins/common/postscript.c 17578 * plug-ins/common/psd.c 17579 * plug-ins/common/psd_save.c 17580 * plug-ins/common/sunras.c 17581 * plug-ins/common/svg.c 17582 * plug-ins/common/tga.c 17583 * plug-ins/common/tiff.c 17584 * plug-ins/common/wmf.c 17585 * plug-ins/common/xbm.c 17586 * plug-ins/common/xpm.c 17587 * plug-ins/common/xwd.c 17588 * plug-ins/faxg3/faxg3.c 17589 * plug-ins/winicon/main.c: register a mimetype, set a translatable 17590 action name (taken from shared-mime-info) and register to the <Load> 17591 and <Save> menus using gimp_plugin_menu_register(). 17592 175932004-05-13 Sven Neumann <sven@gimp.org> 17594 17595 * tools/pdbgen/lib.pl 17596 * tools/pdbgen/pdbgen.pl: added new procedure variable 'since' 17597 that allows to specify when a new function was added. Use that 17598 info to generate an appropriate gtk-doc comment. 17599 17600 * tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new 17601 function gimp_plugin_menu_register(). 17602 17603 * libgimp/gimpplugin_pdb.c: regenerated. 17604 176052004-05-13 Michael Natterer <mitch@gimp.org> 17606 17607 * menus/tool-options-menu.xml: added "name" attributes to all 17608 submenus. 17609 17610 * app/menus/tool-options-menu.c: use the menu names instead of the 17611 overly long action names. 17612 17613 * app/actions/colormap-editor-commands.c 17614 * app/actions/tool-options-commands.c: added some callback 17615 implementations. 17616 17617 * app/widgets/gimpcolormapeditor.c 17618 * app/widgets/gimptooloptionseditor.c: removed the callbacks here 17619 and use action buttons. 17620 17621 * app/actions/actions.c 17622 * app/actions/colormap-editor-actions.c 17623 * app/actions/edit-actions.c: code review / cleanup. 17624 176252004-05-13 Michael Natterer <mitch@gimp.org> 17626 17627 * app/core/gimpcontainer.c (gimp_container_add_handler): don't 17628 try to lookup detailed "notify::foo" signal specs. 17629 176302004-05-13 Michael Natterer <mitch@gimp.org> 17631 17632 * app/widgets/gimptoolview.[ch]: if in list mode, add an "eye" 17633 column which toggles tool visibility. 17634 176352004-05-13 Michael Natterer <mitch@gimp.org> 17636 17637 * app/actions/tools-actions.c (tools_actions_update): don't use 17638 action_data_get_context() to update the "tools" action group 17639 because it may return NULL. Use gimp_get_user_context() instead 17640 because the active tool is global regardless of the action group's 17641 context. Fixes accidential tool hiding when closing the last 17642 display. 17643 176442004-05-13 Sven Neumann <sven@gimp.org> 17645 17646 * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops. 17647 176482004-05-13 Michael Natterer <mitch@gimp.org> 17649 17650 Added GimpViewable infrastructure which enables migrating from 17651 TempBuf to GdkPixbuf for both providing and getting previews: 17652 17653 * app/core/gimpviewable.[ch]: added new virtual functions 17654 GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf() 17655 which are implemented exactly as get_preview() and 17656 get_new_preview() except that get_new_pixbuf() has a default 17657 implementation which creates the pixbuf from a TempBuf. 17658 17659 Renamed public functions _get_preview_pixbuf() and 17660 _get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf(). 17661 17662 Added gimp_viewable_get_dummy_pixbuf() and use it from 17663 gimp_viewable_get_dummy_preview(). 17664 17665 * app/core/gimpimagefile.c (gimp_imagefile_save_thumb) 17666 * app/display/gimpdisplayshell.c (gimp_display_shell_update_icon) 17667 * app/gui/resize-dialog.c (resize_dialog_new): changed accordingly. 17668 176692004-05-13 Sven Neumann <sven@gimp.org> 17670 17671 * libgimpthumb/gimpthumbnail.[ch]: added mime-type support. 17672 176732004-05-13 Michael Natterer <mitch@gimp.org> 17674 17675 * app/menus/Makefile.am: added file-menu.[ch] and 17676 file-dialog-menu.[ch] 17677 17678 * app/menus/menus.[ch]: removed menus_open_recent_add()... 17679 17680 * app/menus/file-menu.[ch]: ...and added it here as file_menu_setup(). 17681 17682 * app/menus/image-menu.c 17683 * app/menus/toolbox-menu.c: changed accordingly. 17684 17685 * app/menus/file-dialog-menu.[ch]: added factored out code from the 17686 file-open and file-save menus as file_dialog_menu_setup(). 17687 17688 * app/menus/file-open-menu.c 17689 * app/menus/file-save-menu.c: call file_dialog_menu_setup(). 17690 176912004-05-12 Michael Natterer <mitch@gimp.org> 17692 17693 * app/actions/documents-actions.c 17694 * app/actions/documents-commands.c 17695 * app/actions/edit-actions.c 17696 * app/actions/edit-commands.[ch] 17697 * app/actions/layers-actions.c 17698 * app/actions/layers-commands.c 17699 * app/actions/select-actions.c 17700 * app/actions/select-commands.[ch] 17701 * app/actions/vectors-actions.c 17702 * app/actions/vectors-commands.[ch]: added tooltips for actions 17703 which are now used for dialog buttons, added callback 17704 implementations which formerly lived in various widgets, moved 17705 some actions around and did some general cleanups. 17706 17707 * menus/image-menu.xml.in: s/edit-stroke/select-stroke/ 17708 17709 * menus/Makefile.am 17710 * menus/selection-editor-menu.xml: new popup menu. 17711 17712 * app/menus/menus.c: register <SelectionEditor> and <UndoEditor> 17713 UI managers. 17714 17715 * app/widgets/gimpeditor.[ch]: added construct properties 17716 "menu-factory", "menu-identifier", "ui-path" and "popup-data". 17717 Implement GObject::constructor() and create the UI manager 17718 if all needed properties were set. Enables creating action 17719 buttons at widget construction time because they need a 17720 UI manager. 17721 17722 (gimp_editor_add_action_button): extended to take a va_list of 17723 "extended" actions which are invoked if the resp. button emits 17724 "extended_clicked". Store the actions and their modifier masks in 17725 a list attached to the button. 17726 17727 * app/widgets/gimpcontainerview.c 17728 (gimp_container_view_item_selected): if the view has container 17729 *and* context, simply change the context and return. 17730 17731 (gimp_container_view_context_changed): don't emit "select_item" 17732 manually but simply call gimp_container_view_select_item(). 17733 17734 (gimp_container_view_viewable_dropped): use 17735 gimp_container_view_item_selected() instead of changing the 17736 context directly. 17737 17738 * app/widgets/gimpcontainereditor.c 17739 (gimp_container_editor_select_item): update the UI manager. 17740 17741 * app/widgets/gimpdockable.c: don't try to fiddle with the 17742 dialog's menu if it doesn't have a ui_path (happens if the UI 17743 manager is just a collection of actions for the dialog buttons and 17744 has no menu registered). 17745 17746 * app/widgets/gimpimageeditor.c: connect to the image's "flush" 17747 signal and update the UI manager in the callback. 17748 17749 * app/widgets/gimpitemtreeview.c: use GimpEditor's construct 17750 properties to create the UI manager so GimpItemTreeView subclasses 17751 can have action buttons. Update the UI manager in 17752 gimp_item_tree_view_select_item(). 17753 17754 * app/widgets/gimpbufferview.c 17755 * app/widgets/gimpcolormapeditor.c 17756 * app/widgets/gimpcontainergridview.c 17757 * app/widgets/gimpdatafactoryview.c 17758 * app/widgets/gimpfontview.c 17759 * app/widgets/gimpimageview.c 17760 * app/widgets/gimptemplateview.c 17761 * app/widgets/gimptoolview.c: changed calls to 17762 gimp_editor_add_action_button() accordingly and removed some 17763 unneeded select_item() implementations. 17764 17765 * app/widgets/gimpchanneltreeview.c 17766 * app/widgets/gimpvectorstreeview.[ch] 17767 * app/widgets/gimpdocumentview.[ch] 17768 * app/widgets/gimplayertreeview.c 17769 * app/widgets/gimpselectioneditor.[ch] 17770 * app/widgets/gimpundoeditor.[ch]: use action buttons and removed 17771 lots of callbacks which went to the resp. action callbacks. 17772 17773 * app/widgets/widgets-types.h: removed some now unneeded function 17774 prototypes. 17775 17776 * app/gui/dialogs-constructors.c: changed (simplified) many dialog 17777 constructors accordingly. 17778 177792004-05-12 Sven Neumann <sven@gimp.org> 17780 17781 * libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal) 17782 * app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock): 17783 left-align the label. 17784 17785 * app/actions/channels-commands.c 17786 * app/actions/layers-commands.c 17787 * app/actions/qmask-commands.c 17788 * app/actions/vectors-commands.c 17789 * app/display/gimpdisplayshell-scale.c 17790 * app/gui/brush-select.c 17791 * app/gui/file-new-dialog.c 17792 * app/gui/info-dialog.c 17793 * app/gui/info-window.c 17794 * app/gui/module-browser.c 17795 * app/gui/offset-dialog.c 17796 * app/gui/palette-import-dialog.c 17797 * app/gui/preferences-dialog.c 17798 * app/gui/resize-dialog.c 17799 * app/tools/gimpblendoptions.c 17800 * app/tools/gimpcroptool.c 17801 * app/tools/gimpmeasuretool.c 17802 * app/tools/gimppaintoptions-gui.c 17803 * app/tools/gimpscaletool.c 17804 * app/tools/gimpselectionoptions.c 17805 * app/tools/gimpsheartool.c 17806 * app/tools/gimptextoptions.c 17807 * app/widgets/gimpcolormapeditor.c 17808 * app/widgets/gimpgrideditor.c 17809 * app/widgets/gimphistogrameditor.c 17810 * app/widgets/gimplayertreeview.c 17811 * app/widgets/gimpstrokeeditor.c 17812 * app/widgets/gimpwidgets-utils.c: left-align labels as suggested 17813 by the HIG. 17814 178152004-05-12 Michael Natterer <mitch@gimp.org> 17816 17817 * app/config/gimpconfig-deserialize.c 17818 * app/config/gimpscanner.c 17819 * app/core/gimp-edit.c 17820 * app/core/gimpchannel-combine.c 17821 * app/core/gimpcontainer.c 17822 * app/core/gimpdrawable-bucket-fill.c 17823 * app/core/gimpdrawable-combine.c 17824 * app/core/gimpdrawable.c 17825 * app/core/gimpgradient.c 17826 * app/core/gimpimage-flip.c 17827 * app/core/gimpimage-merge.c 17828 * app/core/gimpimage-projection.c 17829 * app/core/gimpimage.c 17830 * app/display/gimpdisplay-handlers.c 17831 * app/display/gimpdisplayshell-callbacks.c 17832 * app/display/gimpprogress.c 17833 * app/gui/info-dialog.c 17834 * app/gui/module-browser.c 17835 * app/gui/offset-dialog.c 17836 * app/plug-in/plug-in.c 17837 * app/tools/gimpdrawtool.c 17838 * app/tools/tool_manager.c 17839 * app/widgets/gimpactiongroup.c 17840 * app/widgets/gimpdialogfactory.c 17841 * app/widgets/gimpgradienteditor.c 17842 * app/widgets/gimpitemfactory.c 17843 * app/widgets/gimppropwidgets.c 17844 * app/widgets/gimpwidgets-utils.c 17845 * app/xcf/xcf-save.c 17846 * libgimp/gimpexport.c 17847 * libgimpwidgets/gimphelpui.c 17848 * libgimpwidgets/gimppixmap.c 17849 * libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION, 17850 G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in 17851 g_warning()s by G_STRFUNC. 17852 178532004-05-12 Michael Natterer <mitch@gimp.org> 17854 17855 * app/actions/gradients-actions.c 17856 * app/actions/palettes-actions.c 17857 * app/actions/patterns-actions.c: added/fixed tooltips. 17858 178592004-05-11 Michael Natterer <mitch@gimp.org> 17860 17861 * configure.in: define G*_DISABLE_DEPRECATED for all G* modules 17862 except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0 17863 and Pango >= 1.5.0 17864 17865 * libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/ 17866 17867 * app/config/gimpconfig-deserialize.c 17868 * app/widgets/gimpdeviceinfo.c: 17869 s/g_value_set_foo_take_ownership/g_value_take_foo/ 17870 17871 * app/text/gimptext-vectors.c 17872 * app/text/gimptext-bitmap.c: 17873 s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/ 17874 178752004-05-11 Michael Natterer <mitch@gimp.org> 17876 17877 * app/actions/images-commands.c: added missing #includes. 17878 178792004-05-11 Michael Natterer <mitch@gimp.org> 17880 17881 * app/widgets/Makefile.am 17882 * app/widgets/widgets-types.h 17883 * app/widgets/gimpcontainermenu.[ch] 17884 * app/widgets/gimpcontainermenuimpl.[ch] 17885 * app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by 17886 GimpContainerViewInterface implemented by GimpContainerComboBox. 17887 178882004-05-11 Michael Natterer <mitch@gimp.org> 17889 17890 * app/actions/actions.[ch]: added action_data_get_context() and 17891 macro return_if_no_context(). 17892 17893 * app/actions/brushes-actions.c 17894 * app/actions/buffers-actions.c 17895 * app/actions/buffers-commands.c 17896 * app/actions/data-commands.c 17897 * app/actions/fonts-actions.c 17898 * app/actions/fonts-commands.c 17899 * app/actions/gradients-actions.c 17900 * app/actions/images-actions.c 17901 * app/actions/images-commands.c 17902 * app/actions/palettes-actions.c 17903 * app/actions/patterns-actions.c 17904 * app/actions/templates-actions.c 17905 * app/actions/templates-commands.[ch] 17906 * app/actions/tools-actions.c 17907 * app/actions/tools-commands.c: moved lots of code from widgets/ 17908 to the resp. action callbacks. 17909 17910 * app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button() 17911 which creates a GtkButton connected to the resp. action. 17912 17913 * app/widgets/gimpdatafactoryview.[ch]: added "action_group" 17914 parameters so we can distinguish brushes, patterns etc. actions. 17915 17916 * app/widgets/gimpimageview.[ch] 17917 * app/widgets/gimpbrushfactoryview.c 17918 * app/widgets/gimpbufferview.c 17919 * app/widgets/gimpfontview.c 17920 * app/widgets/gimpgradienteditor.c 17921 * app/widgets/gimppatternfactoryview.c 17922 * app/widgets/gimptemplateview.[ch] 17923 * app/widgets/gimptoolview.c: removed tons of GtkButton::clicked() 17924 callbacks and use gimp_editor_add_action_button() instead 17925 of simply _add_button(). 17926 17927 * app/gui/dialogs-constructors.c 17928 * app/gui/gradient-select.c 17929 * app/gui/palette-select.c 17930 * app/gui/pattern-select.c: changed accordingly. 17931 179322004-05-11 Michael Natterer <mitch@gimp.org> 17933 17934 * app/widgets/gimpcontainercombobox.c: correctly get the default 17935 GimpContainerViewInterface implementation and chain up to it for 17936 clear_items(). Update the preview renderers on "update", enable 17937 deselecting everything. 17938 17939 * app/widgets/gimpimagedock.[ch] 17940 * app/gui/file-new-dialog.c 17941 * app/gui/palette-import-dialog.c 17942 * app/gui/preferences-dialog.c 17943 * app/gui/stroke-dialog.c: use GimpContainerComboBox instead of 17944 GimpContainerMenuImpl. 17945 17946 * app/gui/palette-import-dialog.c: cleanup. 17947 179482004-05-11 Sven Neumann <sven@gimp.org> 17949 17950 * docs/gimptool.1.in: fixed spelling. 17951 179522004-05-11 Sven Neumann <sven@gimp.org> 17953 17954 * app/widgets/gimpcontainertreeview.c: minor cleanup. 17955 179562004-05-11 Michael Schumacher <schumaml@cvs.gnome.org> 17957 17958 * libgimp/gimp.def 17959 * libgimpbase/gimpbase.def: updated 17960 179612004-05-11 Sven Neumann <sven@gimp.org> 17962 17963 * app/gui/user-install-dialog.c: removed the "Aborting 17964 Installation" page. We added it as a nice little gimmick but 17965 obviously people don't understand it's purpose. Fixes bug #142281. 17966 179672004-05-11 Sven Neumann <sven@gimp.org> 17968 17969 * app/widgets/Makefile.am 17970 * app/widgets/widgets-types.h 17971 * app/widgets/gimpcontainercombobox.[ch]: added new widget, almost 17972 finished. 17973 17974 * app/widgets/gimpcontainerview.[ch]: added convenience functions 17975 to get and set the GimpContainerView properties. 17976 17977 * app/widgets/gimpcontainerbox.c: use the convenience functions. 17978 17979 * app/gui/file-new-dialog.c: use the new GimpContainerComboBox. 17980 17981 * etc/templaterc: use "pixels" as the unit for pixel sized templates. 17982 179832004-05-11 Michael Natterer <mitch@gimp.org> 17984 17985 * app/widgets/gimpchanneltreeview.c 17986 * app/widgets/gimpcontainerbox.[ch] 17987 * app/widgets/gimpcontainereditor.c 17988 * app/widgets/gimpcontainergridview.[ch] 17989 * app/widgets/gimpcontainerpopup.c 17990 * app/widgets/gimpcontainertreeview.[ch] 17991 * app/widgets/gimpdatafactoryview.c 17992 * app/widgets/gimpdocumentview.c 17993 * app/widgets/gimpfontview.c 17994 * app/widgets/gimpimageview.c 17995 * app/widgets/gimpitemtreeview.c 17996 * app/widgets/gimplayertreeview.c 17997 * app/widgets/gimppatternfactoryview.c 17998 * app/widgets/gimptemplateview.c 17999 * app/widgets/gimpvectorstreeview.c: code review / cleanup. 18000 180012004-05-11 Michael Natterer <mitch@gimp.org> 18002 18003 * app/widgets/widgets-types.h 18004 * app/widgets/gimpcontainerview.[ch]: made GimpContainerView an 18005 interface. Added accessors for all members in the private struct 18006 and made it really private. 18007 18008 * app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and 18009 implement GimpContainerViewInterface and its properties. 18010 18011 * app/widgets/gimpchanneltreeview.c 18012 * app/widgets/gimpcontainergridview.c 18013 * app/widgets/gimpcontainertreeview.c 18014 * app/widgets/gimpcontainertreeview-dnd.c 18015 * app/widgets/gimpdrawabletreeview.c 18016 * app/widgets/gimpitemtreeview.c 18017 * app/widgets/gimplayertreeview.c 18018 * app/widgets/gimpvectorstreeview.c: implement 18019 GimpContainerViewInterface and use the new accessor functions. 18020 18021 * app/widgets/gimpcontainerpopup.c 18022 * app/widgets/gimpdocumentview.c: changed accordingly. 18023 18024 * app/widgets/gimptemplateview.c 18025 * app/widgets/gimpcontainereditor.c 18026 * app/widgets/gimpundoeditor.c 18027 * app/actions/palettes-commands.c: #include "gimpcontainerview.h" 18028 180292004-05-11 Sven Neumann <sven@gimp.org> 18030 18031 * libgimp/gimp.def 18032 * libgimp/gimpui.def 18033 * libgimpbase/gimpbase.def 18034 * libgimpwidgets/gimpwidgets.def: updated. 18035 180362004-05-10 Sven Neumann <sven@gimp.org> 18037 18038 * libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a 18039 redundant call to gtk_widget_queue_resize(). 18040 180412004-05-10 Sven Neumann <sven@gimp.org> 18042 18043 * app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap 18044 property. Patch by Daniel Kobras, fixes bug #142149. 18045 180462004-05-10 Henrik Brix Andersen <brix@gimp.org> 18047 18048 * plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing 18049 of the dialog, thanks to Sven for pointing out my mistake. 18050 180512004-05-10 Sven Neumann <sven@gimp.org> 18052 18053 * app/widgets/gimptexteditor.c (gimp_text_editor_set_direction): 18054 don't call gtk_widget_set_direction() on a non-existant widget. 18055 Fixes bug #141792. 18056 180572004-05-10 Sven Neumann <sven@gimp.org> 18058 18059 * app/gui/tips-dialog.c: added missing newline in error message. 18060 180612004-05-10 Michael Natterer <mitch@gimp.org> 18062 18063 More GimpContainerView chopping: 18064 18065 * app/widgets/gimpcontainerview.[ch]: added 18066 GimpContainerViewPrivate struct (which is currently public :-) and 18067 removed all members from the GimpContainerView struct. Added 18068 accessors for "context", "container" and "preview_size / 18069 preview_border_width". Added macro to get the private struct 18070 (*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable 18071 for interfaces). 18072 18073 * app/widgets/gimpbrushfactoryview.c 18074 * app/widgets/gimpbufferview.c 18075 * app/widgets/gimpchanneltreeview.c 18076 * app/widgets/gimpcontainerbox.c 18077 * app/widgets/gimpcontainereditor.c 18078 * app/widgets/gimpcontainergridview.c 18079 * app/widgets/gimpcontainerpopup.c 18080 * app/widgets/gimpcontainertreeview-dnd.c 18081 * app/widgets/gimpcontainertreeview.c 18082 * app/widgets/gimpdatafactoryview.c 18083 * app/widgets/gimpdocumentview.c 18084 * app/widgets/gimpfontview.c 18085 * app/widgets/gimpimageview.c 18086 * app/widgets/gimpitemtreeview.c 18087 * app/widgets/gimplayertreeview.c 18088 * app/widgets/gimpsessioninfo.c 18089 * app/widgets/gimptemplateview.c 18090 * app/widgets/gimptoolview.c 18091 * app/actions/brushes-actions.c 18092 * app/actions/buffers-actions.c 18093 * app/actions/dockable-actions.c 18094 * app/actions/dockable-commands.c 18095 * app/actions/documents-actions.c 18096 * app/actions/fonts-actions.c 18097 * app/actions/gradients-actions.c 18098 * app/actions/gradients-commands.c 18099 * app/actions/images-actions.c 18100 * app/actions/palettes-actions.c 18101 * app/actions/palettes-commands.c 18102 * app/actions/patterns-actions.c 18103 * app/actions/templates-actions.c 18104 * app/actions/tools-actions.c 18105 * app/actions/tools-commands.c: changed accordingly. 18106 181072004-05-10 Sven Neumann <sven@gimp.org> 18108 18109 * app/tools/gimpmagnifyoptions.[ch] 18110 * app/tools/gimpmagnifytool.c: applied a patch from William Skaggs 18111 that changes a misleading option label. Fixes bug #137508. 18112 181132004-05-10 Sven Neumann <sven@gimp.org> 18114 18115 * app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT): 18116 removed the display scale from the default image title because 18117 it's now displayed in the statusbar. Show the image pixel size 18118 instead. 18119 18120 * app/gui/preferences-dialog.c: include a preset for the title 18121 format string that shows the image size (bug #141720). 18122 181232004-05-10 Michael Natterer <mitch@gimp.org> 18124 18125 Prepare for making an interface out of GimpContainerView: 18126 18127 * app/widgets/Makefile.am 18128 * app/widgets/widgets-types.h 18129 * app/widgets/gimpcontainerbox.[ch]: new GimpContainerView 18130 subclass which implements GimpDocked interface and contains the 18131 vbox-with-scrolled-window stuff common to GimpContainerGridView 18132 and GimpContainerTreeView. 18133 18134 * app/widgets/gimpcontainerview.[ch]: removed that functionality 18135 here. 18136 18137 * app/widgets/gimpcontainergridview.[ch] 18138 * app/widgets/gimpcontainertreeview.[ch]: derive them from 18139 GimpContainerBox. 18140 18141 * app/gui/brush-select.c 18142 * app/gui/font-select.c 18143 * app/gui/gradient-select.c 18144 * app/gui/palette-select.c 18145 * app/gui/pattern-select.c 18146 * app/widgets/gimpcontainerpopup.c: changed accordingly. 18147 181482004-05-10 Sven Neumann <sven@gimp.org> 18149 18150 * app/actions/view-actions.c: added a stock icon for "view-zoom-1-1". 18151 18152 * app/widgets/gimpunitcombobox.[ch]: added functions to get and 18153 set the active unit. 18154 18155 * app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value): 18156 need to special case GIMP_UNIT_PIXEL. 18157 18158 * app/display/Makefile.am 18159 * app/display/display-types.h 18160 * app/display/gimpscalecombobox.[ch]: new widget to be used in the 18161 display's statusbar. 18162 18163 * app/display/gimpdisplayshell-cursor.[ch]: always display the 18164 cursor position, not only if the cursor is inside the image. Added 18165 new function gimp_display_shell_clear_cursor() to clear the cursor 18166 label. 18167 18168 * app/display/gimpdisplayshell-callbacks.c: changed accordingly. 18169 18170 * app/display/gimpstatusbar.[ch] 18171 * app/display/gimpdisplayshell.c 18172 * app/display/gimpdisplayshell-handlers.c 18173 * app/display/gimpdisplayshell-scale.c: do not explicitely resize 18174 the statusbar cursor label, connect to GimpDisplayShell::scaled 18175 instead. Added a GimpScaleComboBox to the status bar. 18176 181772004-05-10 Michael Natterer <mitch@gimp.org> 18178 18179 Started making the toolbox configurable. 18180 Addresses bug #105764. Not finished yet. 18181 18182 * app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible" 18183 and made it a GObject property. 18184 18185 * app/tools/gimp-tools.[ch]: added new function 18186 gimp_tools_get_default_order() which returns a GList of tool 18187 identifiers. 18188 18189 * app/actions/tools-actions.c 18190 * app/actions/tools-commands.[ch]: added actions & callbacks for 18191 toggling the "visible" boolean and for resetting all tools. 18192 18193 * app/widgets/Makefile.am 18194 * app/widgets/widgets-types.h 18195 * app/widgets/gimptoolview.[ch]: new widget which allows to 18196 toggle a tool's visibility and to reorder the tools. 18197 18198 * app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash" 18199 and pack all tool buttons into the same wrap box. Connect to 18200 "reoder" of the tool container and to "notify::visible" of all 18201 tool infos and update the toolbox accordingly. 18202 18203 * app/gui/dialogs-constructors.c: create a GimpToolView for the 18204 tools list/grid. 18205 18206 * app/menus/menus.c: register a <Tools> menu for the dialog above. 18207 18208 * menus/Makefile.am 18209 * menus/tools-menu.xml: added the menu. 18210 182112004-05-10 Michael Natterer <mitch@gimp.org> 18212 18213 * app/widgets/gimpuimanager.c: re-added help for menu items. Still 18214 incomplete because there is no fallback help ID yet when pressing 18215 F1 over a menu item which has a submenu. Added evil workaround and 18216 version check for signal brokenness of GtkUIManager in GTK+ 2.4.1. 18217 182182004-05-09 Hans Breuer <hans@breuer.org> 18219 18220 Merge from stable branch : 18221 18222 * plug-ins/common/winclipboard.c : support gray images; 18223 fixes bug #141382 18224 18225 * plug-ins/common/winprint.c : dito; fixes bug #141145 18226 182272004-05-09 Maurits Rijk <m.rijk@chello.nl> 18228 18229 * plug-ins/common/aa.c 18230 * plug-ins/common/apply_lens.c 18231 * plug-ins/common/autocrop.c 18232 * plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in 18233 some plug-ins, minor code clean-up. 18234 182352004-05-08 Maurits Rijk <m.rijk@chello.nl> 18236 18237 * plug-ins/common/spread.c: HIGified, simplified and fixes #141733 18238 182392004-05-08 Henrik Brix Andersen <brix@gimp.org> 18240 18241 * plug-ins/common/screenshot.c (shoot_dialog): HIGify the 18242 screenshot plug-in. Fixes part of bug #141772. 18243 182442004-05-08 Sven Neumann <sven@gimp.org> 18245 18246 * app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor): 18247 added 1 pixel horizontal padding around the label. 18248 182492004-05-08 Sven Neumann <sven@gimp.org> 18250 18251 * app/display/gimpstatusbar.[ch]: renamed struct member combo to 18252 unit_combo. Place the combobox into the cursor frame. 18253 182542004-05-08 Sven Neumann <sven@gimp.org> 18255 18256 * app/widgets/Makefile.am 18257 * app/widgets/widgets-types.h 18258 * app/widgets/gimpunitcombobox.[ch] 18259 * app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu 18260 based on GtkComboBox. Will move this to libgimpwidgets later... 18261 18262 * app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and 18263 GimpUnitStore. 18264 18265 * themes/Default/gtkrc 18266 * themes/Small/gtkrc: hardcode the appearance of the 18267 GimpUnitComboBox. It uses a hack that doesn't work in list mode. 18268 182692004-05-07 Sven Neumann <sven@gimp.org> 18270 18271 * app/core/gimpimage-colormap.[ch]: added a const qualifier. 18272 18273 Changed how the image unit and dot-for-dot mode is handled. Might 18274 break things and certainly needs more changes (mainly in tools): 18275 18276 * app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit. 18277 18278 * app/display/gimpdisplayshell-handlers.c 18279 * app/display/gimpdisplayshell-scale.c 18280 * app/display/gimpdisplayshell-title.c 18281 * app/display/gimpstatusbar.c: always use the image unit for the 18282 rulers and to display lengths. 18283 18284 * app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor 18285 based on a dialog mockup from Jimmac and Tigert. 18286 18287 * app/core/core-enums.[ch]: changed some descriptions used by the 18288 template editor. 18289 182902004-05-07 Michael Natterer <mitch@gimp.org> 18291 18292 * plug-ins/common/AlienMap2.c 18293 * plug-ins/common/CML_explorer.c 18294 * plug-ins/common/animationplay.c 18295 * plug-ins/common/despeckle.c 18296 * plug-ins/fp/fp.c 18297 * plug-ins/gfig/gfig.c 18298 * plug-ins/gflare/gflare.c 18299 * plug-ins/script-fu/script-fu.c 18300 * plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register(). 18301 183022004-05-07 Michael Natterer <mitch@gimp.org> 18303 18304 * plug-ins/FractalExplorer/FractalExplorer.c 18305 * plug-ins/Lighting/lighting_main.c 18306 * plug-ins/MapObject/mapobject_main.c 18307 * plug-ins/dbbrowser/dbbrowser.c 18308 * plug-ins/flame/flame.c 18309 * plug-ins/gimpressionist/gimp.c 18310 * plug-ins/ifscompose/ifscompose.c 18311 * plug-ins/imagemap/imap_main.c 18312 * plug-ins/maze/maze.c 18313 * plug-ins/pagecurl/pagecurl.c 18314 * plug-ins/print/print.c 18315 * plug-ins/rcm/rcm.c 18316 * plug-ins/winsnap/winsnap.c 18317 * plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some 18318 formatting cleanups in some query() functions. 18319 183202004-05-07 Michael Natterer <mitch@gimp.org> 18321 18322 * app/plug-in/plug-in-proc.[ch]: removed member "accelerator". 18323 It was never set and this is the conceptually wrong place to store 18324 it anyway. 18325 18326 * app/actions/file-dialog-actions.c 18327 * app/actions/plug-in-actions.c 18328 * app/plug-in/plug-in-message.c 18329 * app/xcf/xcf.c: changed accordingly. 18330 18331 * tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL 18332 as accelerator. Cleaned up the function a bit and made it aware of 18333 proc_def->menu_label added below. 18334 18335 * app/pdb/plug_in_cmds.c: regenerated. 18336 183372004-05-07 Michael Natterer <mitch@gimp.org> 18338 18339 Changed plug-in menu registration again to allow passing just the 18340 menu item's label (not the full path) in gimp_install_procedure() 18341 and only the path (excluding the item's label) in 18342 gimp_plugin_menu_register(). Matches the internal action system 18343 better and makes translating the menu paths much easier. 18344 18345 (Of yourse it's still possible to use the old syntax for backward 18346 compatibility). 18347 18348 * app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label". 18349 18350 * app/plug-in/plug-in-params.[ch]: added new functions 18351 plug_in_param_defs_check() and plug_in_proc_args_check() which 18352 check if a procedure's parameters match its menu location 18353 (e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE). 18354 18355 * app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if 18356 registering an old-style (full) menu_path, use 18357 plug_in_param_defs_check(), set proc_def->menu_label otherwise. 18358 18359 * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use 18360 plug_in_proc_args_check() on the passed menu_path and make sure 18361 old and new style menu registration are not mixed. 18362 18363 * app/pdb/plug_in_cmds.c: regenerated. 18364 18365 * app/plug-in/plug-in-rc.c: save/restore "menu_label". 18366 18367 * app/actions/file-dialog-actions.c 18368 * app/actions/plug-in-actions.c 18369 * app/menus/plug-in-menus.c: changed action/menu creation 18370 accordingly. Some hacks needed to allow both old and new style 18371 menu_label/menu_paths. 18372 18373 * app/plug-in/plug-in.c 18374 * app/widgets/gimpfiledialog.c 18375 * app/xcf/xcf.c: changed accordingly. 18376 18377 * plug-ins/common/align_layers.c 18378 * plug-ins/common/animationplay.c 18379 * plug-ins/common/animoptimize.c 18380 * plug-ins/common/apply_lens.c 18381 * plug-ins/common/autocrop.c 18382 * plug-ins/common/autostretch_hsv.c 18383 * plug-ins/common/blinds.c 18384 * plug-ins/common/blur.c 18385 * plug-ins/common/borderaverage.c 18386 * plug-ins/common/bumpmap.c 18387 * plug-ins/common/c_astretch.c 18388 * plug-ins/common/ccanalyze.c 18389 * plug-ins/common/channel_mixer.c 18390 * plug-ins/common/checkerboard.c 18391 * plug-ins/common/color_enhance.c 18392 * plug-ins/common/colorify.c 18393 * plug-ins/common/colortoalpha.c 18394 * plug-ins/common/compose.c 18395 * plug-ins/common/convmatrix.c 18396 * plug-ins/common/cubism.c 18397 * plug-ins/common/curve_bend.c 18398 * plug-ins/common/decompose.c 18399 * plug-ins/common/deinterlace.c 18400 * plug-ins/common/depthmerge.c 18401 * plug-ins/common/destripe.c 18402 * plug-ins/common/diffraction.c 18403 * plug-ins/common/displace.c 18404 * plug-ins/common/edge.c 18405 * plug-ins/common/emboss.c 18406 * plug-ins/common/engrave.c 18407 * plug-ins/common/exchange.c 18408 * plug-ins/common/film.c 18409 * plug-ins/common/flarefx.c 18410 * plug-ins/common/fractaltrace.c 18411 * plug-ins/common/screenshot.c: ported the first few plug-ins 18412 to the new registration scheme. 18413 184142004-05-06 Manish Singh <yosh@gimp.org> 18415 18416 * tools/pdbgen/pdb/app.pl: make libgimp* headers always included 18417 before any app headers. 18418 18419 * tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo. 18420 18421 * app/pdb/*_cmds.c: regenerated. 18422 184232004-05-06 Sven Neumann <sven@gimp.org> 18424 18425 * app/core/gimpdrawable-preview.c 18426 * app/core/gimpimage-projection.c: added sanity so we don't just 18427 plain crash when an indexed image doesn't have a colormap. 18428 18429 * plug-ins/common/png.c: keep at least one entry in the colormap. 18430 Fixes bug #142029. 18431 184322004-05-06 Maurits Rijk <m.rijk@chello.nl> 18433 18434 * plug-ins/common/sobel.c: replaced RMS macro by smarter one, 18435 resulting in a doubling in speed for this plug-in. 18436 18437 * plug-ins/fp/fp.c: include stdlib for free, malloc and abs. 18438 184392004-05-06 Maurits Rijk <m.rijk@chello.nl> 18440 18441 * plug-ins/fp/fp_gdk.c 18442 * plug-ins/fp/fp_gtk.c 18443 * plug-ins/fp/fp_misc.c 18444 * plug-ins/fp/fp.h: removed 18445 18446 * plug-ins/fp/Makefile.am: changed accordingly 18447 18448 * plug-ins/fp/fp.c: merged into one single file to get rid of all 18449 global variables and functions. Major clean-up. Still more to come. 18450 184512004-05-06 Sven Neumann <sven@gimp.org> 18452 18453 * app/gui/about-dialog.c: center the about dialog on the monitor, 18454 not on the screen. Fixes window position on xinerama setups. 18455 184562004-05-06 Michael Natterer <mitch@gimp.org> 18457 18458 * tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to 18459 gimp_plugin_menu_register() for consistency with other 18460 gimp_plugin_foo_register() functions which can be called during 18461 query(). 18462 18463 * app/pdb/plug_in_cmds.c 18464 * libgimp/gimpplugin_pdb.[ch]: regenerated. 18465 18466 * plug-ins/common/ccanalyze.c 18467 * plug-ins/common/colortoalpha.c 18468 * plug-ins/common/screenshot.c 18469 * plug-ins/winsnap/winsnap.c: changed accordingly. 18470 184712004-05-06 Michael Natterer <mitch@gimp.org> 18472 18473 Enabled multiple menu entries per plug-in procedure: 18474 18475 * app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to 18476 "GList *menu_paths". 18477 18478 * app/plug-in/plug-in-message.c 18479 * app/plug-in/plug-in-rc.c 18480 * app/plug-in/plug-in.c 18481 * app/plug-in/plug-ins.c 18482 * app/menus/menus.c 18483 * app/widgets/gimpfiledialog.c 18484 * app/xcf/xcf.c: changed accordingly. 18485 18486 * app/actions/file-dialog-actions.c 18487 * app/actions/plug-in-actions.c: create an action for the first 18488 element of proc_def->menu_paths. 18489 18490 * app/gui/gui-vtable.c 18491 * app/menus/plug-in-menus.[ch]: create proxy widgets for each 18492 element of proc_def->menu_paths. 18493 18494 * tools/pdbgen/pdb/plug_in.pdb: added new function 18495 gimp_plugin_menu_add() which can be called during query() and adds 18496 a menu path to a procedure registered by the calling plugin. 18497 18498 * app/pdb/internal_procs.c 18499 * app/pdb/plug_in_cmds.c 18500 * libgimp/gimpplugin_pdb.[ch]: regenerated. 18501 18502 * menus/image-menu.xml.in 18503 * menus/toolbox-menu.xml.in: added lots of <placeholder>s for 18504 logical groups (like Image/Resize, Image/Scale, Image/Crop 18505 etc.). Added empty placeholder File/Send for stuff like print and 18506 mail. Added an "Acquire" menu under <Image>/File 18507 18508 * plug-ins/common/mail.c 18509 * plug-ins/print/print.c 18510 * plug-ins/common/winprint.c: register under File/Send. 18511 18512 * plug-ins/common/screenshot.c 18513 * plug-ins/winsnap/winsnap.c: also register under 18514 <Image>/File/Acquire. 18515 18516 * plug-ins/common/autocrop.c 18517 * plug-ins/common/ccanalyze.c 18518 * plug-ins/common/colortoalpha.c 18519 * plug-ins/common/threshold_alpha.c 18520 * plug-ins/common/zealouscrop.c: register additional menu entries 18521 under placeholders in the "Image" and "Layer" menus. This is not 18522 meant to be final but just a hint to keep in mind when 18523 reorganizing the plug-in menus. 18524 185252004-05-06 Sven Neumann <sven@gimp.org> 18526 18527 * app/gui/resize-dialog.[ch]: cleaned up variable names and 18528 external API. Still quite a mess. 18529 18530 * app/Makefile.am 18531 * app/actions/image-commands.c 18532 * app/actions/layers-commands.c: changed accordingly. 18533 185342004-05-06 Sven Neumann <sven@gimp.org> 18535 18536 * app/menus/menus.c: no need for including gimp-intl.h. 18537 185382004-05-06 Michael Natterer <mitch@gimp.org> 18539 18540 * configure.in 18541 * app/Makefile.am 18542 * app/menus/.cvsignore 18543 * app/menus/Makefile.am 18544 * app/menus/menus-types.h 18545 * app/menus/menus.[ch] 18546 * app/menus/file-open-menu.[ch] 18547 * app/menus/file-save-menu.[ch] 18548 * app/menus/image-menu.[ch] 18549 * app/menus/plug-in-menus.[ch] 18550 * app/menus/tool-options-menu.[ch] 18551 * app/menus/toolbox-menu.[ch]: moved all menus files to their 18552 own directory. 18553 18554 * app/gui/Makefile.am 18555 * app/gui/menus.[ch] 18556 * app/gui/file-open-menu.[ch] 18557 * app/gui/file-save-menu.[ch] 18558 * app/gui/image-menu.[ch] 18559 * app/gui/plug-in-menus.[ch] 18560 * app/gui/tool-options-menu.[ch] 18561 * app/gui/toolbox-menu.[ch]: removed them here. 18562 18563 * app/actions/debug-commands.c 18564 * app/actions/file-commands.c 18565 * app/gui/brush-select.c 18566 * app/gui/dialogs.c 18567 * app/gui/font-select.c 18568 * app/gui/gradient-select.c 18569 * app/gui/gui-vtable.c 18570 * app/gui/gui.c 18571 * app/gui/palette-select.c 18572 * app/gui/pattern-select.c 18573 * app/gui/preferences-dialog.c: changed #includes accordingly. 18574 185752004-05-05 Sven Neumann <sven@gimp.org> 18576 18577 * app/gui/file-new-dialog.c: use a normal GimpDialog instead of a 18578 GimpViewableDialog that never has a viewable set. 18579 185802004-05-05 Michael Natterer <mitch@gimp.org> 18581 18582 * app/gui/brush-select.[ch] (brush_select_new): reordered parameters 18583 so the first four are the same for all foo_select_new() functions. 18584 18585 * tools/pdbgen/pdb/brush_select.pdb: changed accordingly. 18586 18587 * app/pdb/brush_select_cmds.c: regenerated. 18588 18589 * app/gui/font-select.c (font_select_new): set the vbox' 18590 border width to 6 to match the other foo_select dialogs. 18591 185922004-05-05 Michael Natterer <mitch@gimp.org> 18593 18594 * app/actions/debug-actions.c 18595 * app/actions/debug-commands.[ch] 18596 * menus/toolbox-menu.xml.in: added action & callback which XML-dump 18597 all UI managers. 18598 185992004-05-05 Michael Natterer <mitch@gimp.org> 18600 18601 * app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed 18602 bug which would have leaked broken menu translations. 18603 18604 * app/gui/plug-in-menus.c: removed useless #includes. 18605 186062004-05-05 Michael Natterer <mitch@gimp.org> 18607 18608 * app/actions/file-actions.c 18609 * app/actions/file-commands.[ch]: remove "file-close" action and 18610 callback... 18611 18612 * app/actions/view-actions.c 18613 * app/actions/view-commands.[ch]: ...and added it here as 18614 "view-close" because that's what it does. 18615 18616 * app/actions/qmask-actions.c 18617 * app/actions/qmask-commands.c: s/QMask/QuickMask/g 18618 18619 * app/gui/menus.c: add the "channels" action group to the <Image> 18620 and <Dock> UI managers, renamed UI manager <Dialogs> to 18621 <Dockable>. 18622 18623 * app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/. 18624 18625 * menus/image-menu.xml.in: s/file-close/view-close/, added 18626 separators at the end of most menus, moved the bottom group of the 18627 "View" menu after the zoom group. 18628 186292004-05-05 Michael Natterer <mitch@gimp.org> 18630 18631 * app/actions/select-actions.c: removed action "select-by-color". 18632 18633 * app/tools/gimpbycolorselecttool.c: add the shortcut here. 18634 18635 * app/actions/tools-actions.c: added alternative tool actions for 18636 "by-color-select" and "rotate" which are identical to the ones 18637 generated from the GimpToolInfo except for their label. Make sure 18638 they have the same accelerators as the generated ones. 18639 18640 * menus/image-menu.xml.in: use the alternative actions for 18641 "<Image>/Select/By Color" and 18642 "<Layer>/Transform/Arbitrary Rotation...". 18643 186442004-05-05 Sven Neumann <sven@gimp.org> 18645 18646 * libgimpwidgets/gimphelpui.c: documentation. 18647 186482004-05-05 Michael Natterer <mitch@gimp.org> 18649 18650 Finally enable global accelerators in all docks: 18651 18652 * app/widgets/gimpimagedock.c (gimp_image_dock_constructor): 18653 iterate all of the UI manager's actions and enable their 18654 accelerators manually. Fixes bug #119878. 18655 186562004-05-05 Sven Neumann <sven@gimp.org> 18657 18658 * app/widgets/gimpviewabledialog.c: added construct properties to 18659 make it possible to derive from GimpViewableDialog. 18660 18661 * app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real 18662 object, not just a convenience constructor. 18663 18664 * themes/Default/gtkrc 18665 * themes/Small/gtkrc: set a smaller border_width of 6 pixels for 18666 the action area of tool dialogs. 18667 18668 * app/tools/gimpcolorpickertool.c 18669 * app/tools/gimpimagemaptool.c: set a smaller border_width of 6 18670 pixels on tool dialogs to make them more compact. 18671 186722004-05-05 Michael Natterer <mitch@gimp.org> 18673 18674 * libgimpwidgets/gimpoffsetarea.[ch]: added new function 18675 gimp_offset_area_set_pixbuf(). Started to clean up the 18676 code a bit. 18677 18678 * app/gui/resize-dialog.c (resize_widget_new): use the new feature 18679 and set a preview of the image. Fixes bug #78733. 18680 186812004-05-05 Sven Neumann <sven@gimp.org> 18682 18683 * app/gui/info-dialog.c 18684 * app/tools/gimpcolorbalancetool.c 18685 * app/tools/gimpcolorizetool.c 18686 * app/tools/gimpcurvestool.c 18687 * app/tools/gimphuesaturationtool.c 18688 * app/tools/gimpimagemaptool.c 18689 * app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings. 18690 18691 * app/widgets/gimptexteditor.c: tweaked. 18692 186932004-05-05 Jakub Steiner <jimmac@ximian.com> 18694 18695 * data/images/gimp_splash.png: ustable splash 18696 186972004-05-04 Michael Natterer <mitch@gimp.org> 18698 18699 * app/gui/menus.c: register a <Dock> UI manager which has all 18700 action groups <Image> has except "view". 18701 18702 * app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts, 18703 using UI manager instead of item factory. Unfortunately actions 18704 without proxy widgets can't be activated so this change is pretty 18705 useless. Oh well, will find a hack to work around this later... 18706 187072004-05-04 Sven Neumann <sven@gimp.org> 18708 18709 * app/tools/gimpblendoptions.c 18710 * app/tools/gimpbucketfilloptions.c 18711 * app/tools/gimpcoloroptions.c 18712 * app/tools/gimpinkoptions.c 18713 * app/tools/gimppaintoptions-gui.c 18714 * app/tools/gimpselectionoptions.c 18715 * app/tools/gimptooloptions-gui.c 18716 * app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame 18717 was used. Put "Pressure Sensitivity" frame into a GtkExpander. 18718 187192004-05-04 Sven Neumann <sven@gimp.org> 18720 18721 * libgimpwidgets/gimpframe.c: added a style property to control 18722 boldening of the frame title. 18723 18724 * themes/Default/gtkrc 18725 * themes/Small/gtkrc: suppress the bold title for GimpFrames in 18726 GimpDockables, 18727 187282004-05-04 Sven Neumann <sven@gimp.org> 18729 18730 * libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate 18731 the full width for the label widget, looks better and is more 18732 convenient to use with activatable widgets such as toggle buttons. 18733 187342004-05-04 Michael Natterer <mitch@gimp.org> 18735 18736 * app/widgets/gimpfiledialog.c: removed debugging output, added 18737 #warning about runtime version check that can be removed as soon 18738 as we depend on GTK+ 2.4.1. 18739 187402004-05-04 Michael Natterer <mitch@gimp.org> 18741 18742 * app/actions/file-dialog-actions.c (file_dialog_actions_setup): 18743 don't forget to set the action's accelerator. 18744 187452004-05-04 Sven Neumann <sven@gimp.org> 18746 18747 * app/actions/channels-commands.c 18748 * app/actions/gradient-editor-commands.c 18749 * app/actions/image-commands.c 18750 * app/actions/layers-commands.c 18751 * app/actions/qmask-commands.c 18752 * app/actions/templates-commands.c 18753 * app/actions/vectors-commands.c 18754 * app/display/gimpdisplayshell-filter-dialog.c 18755 * app/gui/convert-dialog.c 18756 * app/gui/module-browser.c 18757 * app/gui/offset-dialog.c 18758 * app/gui/palette-import-dialog.c 18759 * app/gui/resize-dialog.c 18760 * app/gui/resolution-calibrate-dialog.c 18761 * app/gui/tips-dialog.c 18762 * app/gui/user-install-dialog.c 18763 * app/widgets/gimpwidgets-utils.c 18764 * libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12. 18765 187662004-05-04 Sven Neumann <sven@gimp.org> 18767 18768 * app/gui/preferences-dialog.c 18769 * app/widgets/widgets-enums.[ch] 18770 * app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added 18771 new window hint "keep-above" to force toolbox and/or dock windows 18772 to be kept above (if the WM supports this hint). Fixes bug #131672. 18773 187742004-05-04 Michael Natterer <mitch@gimp.org> 18775 18776 Fix bug #141719: 18777 18778 * app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT() 18779 instead of ROUND() to round double coords to guide positions. 18780 18781 * app/display/gimpdisplayshell-callbacks.c 18782 (gimp_display_shell_canvas_tool_events): pass RINT()-rounded 18783 coords to gimp_display_shell_update_cursor() instead of implicitly 18784 truncating by casting to int. 18785 187862004-05-04 Michael Natterer <mitch@gimp.org> 18787 18788 * app/widgets/gimpundoeditor.c: removed code duplication by adding 18789 utility function gimp_undo_editor_update_buttons(), some general 18790 cleanups. 18791 187922004-05-04 Michael Natterer <mitch@gimp.org> 18793 18794 * app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the 18795 "undo-freeze" and "undo-thaw" signals only on the first freeze and 18796 last thaw, not on any of them. 18797 18798 * app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR. 18799 18800 * app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History" 18801 button. Fixes bug #136300. 18802 18803 Also don't attach to the image's undo stack if the image's undo is 18804 disabled and set the buttons' sensitivity accordingly. Should fix 18805 all kinds of unpredictable undo history brokenness. 18806 188072004-05-04 Michael Natterer <mitch@gimp.org> 18808 18809 Treat FG/BG just like all other context properties: 18810 18811 * app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK 18812 and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify 18813 that they are used by GimpPaintOptions (automatically affects all 18814 paint tools). 18815 18816 * app/tools/gimpblendtool.c 18817 * app/tools/gimpbucketfilltool.c 18818 * app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK 18819 manually here. 18820 18821 * app/tools/tool_manager.c (tool_manager_tool_changed): decide 18822 about the globality of FG and BG at the same place where we decide 18823 about the brush's, pattern's etc. globality, but hardcode them to 18824 global = TRUE instead of looking at GimpConfig. 18825 18826 Fixes bug #141786. 18827 188282004-05-04 Sven Neumann <sven@gimp.org> 18829 18830 * plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted 18831 spacing, fixes bug #141773. 18832 188332004-05-04 Sven Neumann <sven@gimp.org> 18834 18835 * app/gui/stroke-dialog.c: 18836 * app/widgets/gimpstrokeeditor.c: moved line style options into a 18837 GtkExpander. Changed dialog spacings. 18838 188392004-05-03 Manish Singh <yosh@gimp.org> 18840 18841 * app/actions/qmask-actions.c: initialize is_active for qmask-toggle. 18842 18843 * app/actions/tools-actions.c: set entry help_id from tool_info, 18844 since gimp_action_group_add_string_actions expects it to be there 18845 now. 18846 188472004-05-03 Sven Neumann <sven@gimp.org> 18848 18849 * libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that 18850 allows to get the label_spacing but no label. Useful when the frame 18851 is packed into a GtkExpander. 18852 18853 * app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame 18854 into a GtkExpander to reduce clutter and dialog size. 18855 188562004-05-03 Michael Natterer <mitch@gimp.org> 18857 18858 * libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark() 18859 which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut. 18860 18861 * app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions): 18862 attach the help ID to the action using the new quark key. Call 18863 gtk_action_group_add_action() instead of the _with_accel() variant 18864 if the accel is the empty string (== if we explicitely want no 18865 accel even if the stock item specifies one). Fixes warning flood 18866 with GTK+ 2.4.1. 18867 188682004-05-03 Sven Neumann <sven@gimp.org> 18869 18870 * libgimpwidgets/gimpframe.c: if the label_widget is a button, set 18871 the button label as bold. Cache the indentation instead of 18872 calculating it over and over again. 18873 18874 * themes/Default/gtkrc: set HIG-compliant spacing for the 18875 action_area. 18876 18877 * app/widgets/gimppropwidgets.[ch]: added 18878 gimp_prop_enum_radio_box_new() for a radio group that is no 18879 embedded in a frame. 18880 18881 * app/widgets/gimpstrokeeditor.c: use a frame-less radio box for 18882 the Stroke style. 18883 18884 * app/gui/file-new-dialog.c 18885 * app/gui/grid-dialog.c 18886 * app/gui/stroke-dialog.c: HIG-compliant spacings. 18887 188882004-05-03 Michael Natterer <mitch@gimp.org> 18889 18890 * app/widgets/gimpdock.c (gimp_dock_key_press_event): new function 18891 which overrides GtkWindow's default handler in order to give the 18892 focus widget precedence over accelerators for keys without any 18893 modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s 18894 accelerator while still being able to enter 'S' in an entry. 18895 Thanks to Tim Janik for the code. 18896 188972004-05-03 Michael Natterer <mitch@gimp.org> 18898 18899 * app/actions/actions.h. added the various return_if_no_foo() 18900 macros here. 18901 18902 * app/actions/channels-commands.c 18903 * app/actions/dialogs-commands.c 18904 * app/actions/drawable-commands.c 18905 * app/actions/edit-commands.c 18906 * app/actions/file-commands.c 18907 * app/actions/image-commands.c 18908 * app/actions/layers-commands.c 18909 * app/actions/qmask-commands.c 18910 * app/actions/select-commands.c 18911 * app/actions/vectors-commands.c 18912 * app/actions/view-commands.c: removed them here. Some cleanup. 18913 189142004-05-03 Michael Natterer <mitch@gimp.org> 18915 18916 * app/actions/actions.[ch]: added some utility functions to get a 18917 Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer 18918 passed to action callbacks. 18919 18920 * app/actions/channels-actions.c 18921 * app/actions/channels-commands.c 18922 * app/actions/drawable-actions.c 18923 * app/actions/drawable-commands.c 18924 * app/actions/edit-actions.c 18925 * app/actions/edit-commands.c 18926 * app/actions/file-actions.c 18927 * app/actions/file-commands.c 18928 * app/actions/help-commands.c 18929 * app/actions/image-actions.c 18930 * app/actions/image-commands.c 18931 * app/actions/layers-actions.c 18932 * app/actions/layers-commands.c 18933 * app/actions/plug-in-actions.c 18934 * app/actions/plug-in-commands.c 18935 * app/actions/qmask-actions.c 18936 * app/actions/qmask-commands.c 18937 * app/actions/select-actions.c 18938 * app/actions/select-commands.c 18939 * app/actions/tools-commands.c 18940 * app/actions/vectors-actions.c 18941 * app/actions/vectors-commands.c 18942 * app/actions/view-commands.c: use the new functions instead of 18943 duplicating insane macros and if() constructs over and over again. 18944 189452004-05-03 Sven Neumann <sven@gimp.org> 18946 18947 * libgimpwidgets/gimpwidgets.c: use a GimpFrame for 18948 gimp_radio_group_new() and friends. 18949 18950 * themes/Default/gtkrc 18951 * themes/Small/gtkrc: set a smaller label_spacing for GimpFrame 18952 widgets in GimpDockables. Lame hack to keep the tool options 18953 compact. 18954 18955 * app/actions/image-commands.c: changed spacing. 18956 18957 * app/gui/offset-dialog.c: merged check and radio buttons into a 18958 single radio button group; changed spacing. 18959 189602004-05-03 Sven Neumann <sven@gimp.org> 18961 18962 * libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect 18963 the frame's border width. 18964 18965 * app/widgets/gimpcolorframe.[ch]: derive from GimpFrame. 18966 18967 * app/gui/convert-dialog.c 18968 * app/gui/info-window.c 18969 * app/gui/palette-import-dialog.c 18970 * app/gui/resize-dialog.c: use GimpFrames, changed some spacings. 18971 189722004-05-03 Michael Natterer <mitch@gimp.org> 18973 18974 * app/actions/dockable-commands.c (dockable_add_tab_cmd_callback): 18975 truncate the passed dialog identifier at the first '|'. Fixes 18976 creating brushes, paterns etc. dialogs from the dockables' 18977 "Add Tab" menu. 18978 189792004-05-02 Sven Neumann <sven@gimp.org> 18980 18981 * libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the 18982 left margin into account. 18983 18984 * app/widgets/gimpgrideditor.c 18985 * app/widgets/gimptemplateeditor.c: removed container borders that 18986 aren't needed any longer. 18987 189882004-05-02 Sven Neumann <sven@gimp.org> 18989 18990 * app/widgets/gimpenumwidgets.c 18991 * app/widgets/gimpgrideditor.c 18992 * app/widgets/gimptemplateeditor.c: use the GimpFrame widget, 18993 changed some spacings to better comply with the HIG. 18994 189952004-05-02 Sven Neumann <sven@gimp.org> 18996 18997 * libgimpwidgets/Makefile.am 18998 * libgimpwidgets/gimpwidgets.h 18999 * libgimpwidgets/gimpwidgetstypes.h 19000 * libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG 19001 compliant variant of GtkFrame. 19002 19003 * app/gui/preferences-dialog.c: enable the HIG compliant mode by 19004 default and use the new GimpFrame widget for it. 19005 19006 * themes/Small/gtkrc: set a smaller spacing between the GimpFrame 19007 title label and the frame content. 19008 190092004-05-02 Michael Natterer <mitch@gimp.org> 19010 19011 * app/actions/qmask-actions.c: renamed action "qmask-toggle" to 19012 "qmask-active" and added new action "qmask-toggle" with a label 19013 and shortcut suited for the "Select" menu. 19014 19015 * app/actions/select-actions.c: removed "select-toggle-qmask". 19016 19017 * app/actions/select-commands.[ch]: removed callback 19018 select_toggle_quickmask_cmd_callback(). 19019 19020 * app/actions/channels-actions.c (channels_actions_update) 19021 * app/actions/vectors-actions.c (vectors_actions_update): handle 19022 "data" being both GimpDisplay and GimpDisplayShell so the actions 19023 can be used in the image menu. 19024 19025 * menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/. 19026 19027 * menus/qmask-menu.xml: s/qmask-toggle/qmask-active/. 19028 190292004-05-02 Sven Neumann <sven@gimp.org> 19030 19031 * menus/image-menu.xml.in 19032 * menus/tool-options-menu.xml 19033 * menus/toolbox-menu.xml.in: use empty elements for empty menus. 19034 Makes the XML somewhat easier to read. 19035 190362004-05-02 Sven Neumann <sven@gimp.org> 19037 19038 * menus/Makefile.am 19039 * menus/dialogs-menuitems.xml: new file that holds menuitems that 19040 appear in several places. 19041 19042 * menus/dockable-menu.xml.in: new file used to generate 19043 dockable-menu.xml. 19044 19045 * menus/toolbox-menu.xml.in: new file used to generate 19046 toolbox-menu.xml. 19047 19048 * menus/image-menu.xml.in: include dialogs-menuitems.xml. 19049 19050 * menus/menus.xsl: allow inclusion of menuitems using XInclude. 19051 190522004-05-02 Michael Natterer <mitch@gimp.org> 19053 19054 * app/actions/Makefile.am 19055 * app/actions/file-dialog-actions.[ch]: new files containing 19056 factored out code to set up the <Load> and <Save> actions. 19057 Use GimpPlugInActions instead of just GtkActions. 19058 19059 * app/actions/file-dialog-commands.[ch]: new files containing 19060 file_dialog_type_cmd_callback() which is a 19061 GimpPlugInAction::selected() callback now. 19062 19063 * app/actions/file-commands.[ch]: removed the callback here. 19064 19065 * app/actions/file-open-actions.c 19066 * app/actions/file-save-actions.c: removed code duplication and 19067 use file_dialog_actions_setup() instead. 19068 190692004-05-02 Michael Natterer <mitch@gimp.org> 19070 19071 * app/actions/*-actions.c: added help IDs to all actions 19072 representing the toplevel popups and menus (as fallbacks for the 19073 still-to-be-written help system intrgration of GimpUIManager). 19074 19075 * app/display/gimpdisplayshell.c (gimp_display_shell_new): removed 19076 call to gtk_ui_manager_ensure_update() because that's done by 19077 gimp_ui_manager_ui_get() now. 19078 19079 * app/widgets/gimpmenufactory.[ch]: removed API to register and 19080 create item factories. 19081 19082 * app/gui/menus.c: changed accordingly. 19083 19084 * app/gui/dialogs.c 19085 * app/actions/plug-in-commands.c 19086 * app/gui/file-dialog-utils.c 19087 * app/gui/file-save-dialog.c 19088 * app/widgets/gimpdataeditor.c 19089 * app/widgets/gimpdockable.c 19090 * app/widgets/gimpdockbook.[ch] 19091 * app/widgets/gimpimagedock.c 19092 * app/widgets/gimpitemtreeview.c: removed leftover item factory 19093 cruft. 19094 19095 * app/widgets/widgets-types.h: removed item factory typedefs... 19096 19097 * app/widgets/gimpitemfactory.h: ...and added them here. 19098 19099 * app/widgets/gimpactiongroup.[ch]: added new function 19100 gimp_action_group_add_plug_in_actions(). 19101 19102 * app/actions/plug-in-actions.c: use it here instead of adding 19103 the actions manually. 19104 19105 * app/widgets/gimptoolbox.c: ported the code which dynamically 19106 updates the tool button tooltips on accelerator changes to 19107 GtkAction. Disabled the whole stuff because GTK+ lacks 19108 gtk_action_get_accel_closure(). 19109 191102004-05-02 Sven Neumann <sven@gimp.org> 19111 19112 * menus/Makefile.am: added a rule to generate gtkuimanager XML 19113 files using an XSL transformation. 19114 19115 * menus/menus.xsl: a simple XSLT to generate a menubar and a popup 19116 menu with identical content. 19117 19118 * menus/image-menu.xml: removed this file from CVS ... 19119 19120 * menus/image-menu.xml.in: ... and added this instead. 19121 19122 * HACKING: xsltproc is now needed to build from CVS. 19123 191242004-05-01 Sven Neumann <sven@gimp.org> 19125 19126 * configure.in: check for xmllint and xsltproc but don't require 19127 these tools. 19128 19129 * menus/Makefile.am 19130 * tips/Makefile.am: simplified "validate" targets. 19131 191322004-04-30 Pedro Gimeno <pggimeno@wanadoo.es> 19133 19134 * app/tools/gimprectselecttool.c: Cleanups. 19135 (gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for 19136 bug #138103, which led to bug #140649. 19137 19138 * app/pdb/procedural_db.c (procedural_db_init_procs): Add missing 19139 compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset. 19140 191412004-04-30 Sven Neumann <sven@gimp.org> 19142 19143 * app/gui/tool-options-menu.c: added casts to please the compiler. 19144 191452004-04-30 Michael Natterer <mitch@gimp.org> 19146 19147 * app/widgets/gimpuimanager.[ch]: added signal "update" which 19148 is G_SIGNAL_RUN_LAST, so handlers can hook in before and after 19149 the default implementation. Update the action groups 19150 in the default implementations. 19151 19152 (gimp_ui_manager_ui_get): make sure we always return a widget 19153 by calling gtk_ui_manager_ensure_update(). 19154 19155 * app/widgets/gimpdockable.c (gimp_dockable_show_menu): make 19156 sure the dockable menu is loaded before trying to access its 19157 widgets/actions. 19158 19159 Resurrected the dynamic tool options menus: 19160 19161 * app/actions/tool-options-actions.c: dynamically destroy/create 19162 actions for the tool options' presets. 19163 19164 * app/actions/tool-options-commands.[ch]: all callbacks are 19165 GimpEnumAction::selected() callbacks now. 19166 19167 * app/gui/tool-options-menu.[ch]: connect and connect_after to 19168 GimpUIManager::update(). Remove the old preset menu items 19169 in the former callback, create the new ones in the latter. 19170 Removed the last item factory entries. 19171 19172 * app/gui/menus.c 19173 * app/widgets/gimptooloptionseditor.c: changed accordingly. 19174 191752004-04-29 Simon Budig <simon@gimp.org> 19176 19177 * app/main.c: when glibc is used, call mallopt, so that memory 19178 chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile) 19179 get allocated via mmap. This ensures that after closing an image 19180 the memory allocated for image data gets returned to the system. 19181 19182 Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt 19183 to my attention. 19184 19185 Please watch closely for performance problems. 19186 191872004-04-29 Michael Natterer <mitch@gimp.org> 19188 19189 * app/actions/Makefile.am 19190 * app/actions/file-open-actions.[ch] 19191 * app/actions/file-save-actions.[ch]: actions for the <Load> and 19192 <Save> menus... 19193 19194 * menus/Makefile.am 19195 * menus/file-open-menu.xml 19196 * menus/file-save-menu.xml: ...and the menus. 19197 19198 * app/gui/file-open-menu.[ch] 19199 * app/gui/file-save-menu.[ch]: ported to UI Manager. 19200 19201 * app/widgets/gimpfiledialog.[ch]: ditto. 19202 19203 * app/actions/actions.c 19204 * app/gui/menus.c 19205 * app/gui/file-open-dialog.c 19206 * app/gui/file-save-dialog.c: changed accordingly. 19207 19208 * app/widgets/gimpuimanager.c: removed debugging code which 19209 automatically loaded all registered menus. They are now loaded on 19210 demand only. 19211 192122004-04-29 Michael Natterer <mitch@gimp.org> 19213 19214 * libgimpbase/gimputils.[ch] (gimp_escape_uline): new function 19215 which does the opposite of gimp_strip_uline(). 19216 19217 * app/actions/file-actions.c (file_actions_last_opened_update): 19218 escape ulines in filenames so they don't end up as mnemonics. 19219 Spotted by Pedro Gimeno. 19220 192212004-04-29 Manish Singh <yosh@gimp.org> 19222 19223 * plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase 19224 tags work properly. 19225 192262004-04-29 Michael Natterer <mitch@gimp.org> 19227 19228 * app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu 19229 paths from the "menu_path". Will be renamed to "action_name" or 19230 something soon... 19231 19232 * plug-ins/dbbrowser/dbbrowser.c 19233 * plug-ins/common/plugindetails.c 19234 * plug-ins/common/uniteditor.c: register under the new 19235 "Extensions" placeholder. 19236 192372004-04-29 Michael Natterer <mitch@gimp.org> 19238 19239 Switch from GtkItemFactory to GtkUIManager. The migration is 19240 almost complete, still stuff missing/incomplete, definitely added 19241 a bunch of new bugs... 19242 19243 * app/actions/*-commands.[ch]: converted all callback from 19244 GtkItemFactory callbacks to GtkAction callbacks. 19245 19246 * app/actions/debug-actions.c 19247 * app/actions/gradient-editor-actions.c 19248 * app/actions/help-actions.c 19249 * app/actions/plug-in-actions.c 19250 * app/actions/qmask-actions.c 19251 * app/actions/tool-options-actions.c: various fixes. 19252 19253 * app/display/gimpdisplay.[ch] 19254 * app/display/gimpdisplayshell-appearance.[ch] 19255 * app/display/gimpdisplayshell-callbacks.c 19256 * app/display/gimpdisplayshell.[ch]: move everything from 19257 GtkItemFactory to GtkUIManager. 19258 19259 * app/gui/dialogs.[ch]: added new function dialogs_get_toolbox(). 19260 Needed because the action callbacks don't have a widget parameter 19261 and sometimes we need a parent window for showing dialogs. 19262 19263 * app/gui/Makefile.am 19264 * app/gui/brushes-menu.[ch] 19265 * app/gui/buffers-menu.[ch] 19266 * app/gui/channels-menu.[ch] 19267 * app/gui/colormap-editor-menu.[ch] 19268 * app/gui/dialogs-menu.[ch] 19269 * app/gui/documents-menu.[ch] 19270 * app/gui/error-console-menu.[ch] 19271 * app/gui/fonts-menu.[ch] 19272 * app/gui/gradient-editor-menu.[ch] 19273 * app/gui/gradients-menu.[ch] 19274 * app/gui/images-menu.[ch] 19275 * app/gui/layers-menu.[ch] 19276 * app/gui/palette-editor-menu.[ch] 19277 * app/gui/palettes-menu.[ch] 19278 * app/gui/patterns-menu.[ch] 19279 * app/gui/qmask-menu.[ch] 19280 * app/gui/templates-menu.[ch] 19281 * app/gui/vectors-menu.[ch]: removed these files. 19282 19283 * app/gui/gui.c: create a global UI manager for the image popup 19284 menu and the toolbox menubar. 19285 19286 * app/gui/menus.[ch]: removed all GtkItemFactory code. 19287 19288 * app/gui/image-menu.[ch] 19289 * app/gui/toolbox-menu.[ch]: removed everything except the trivial 19290 setup_funcs. 19291 19292 * app/gui/file-open-menu.c 19293 * app/gui/file-save-menu.c 19294 * app/gui/tool-options-menu.c: don't use the macros from menus.h 19295 any more, they are gone. 19296 19297 * app/gui/gui-vtable.c 19298 * app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in 19299 menu entries. 19300 19301 * app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/ 19302 gimp_ui_manager_update/g 19303 19304 * app/widgets/gimpuimanager.[ch]: added API to get an action 19305 group by name. 19306 19307 * app/widgets/gimpmenufactory.c: don't choke on the item_factory 19308 entries being NULL. 19309 19310 * app/widgets/gimpactiongroup.c: make sure booleans set using 19311 g_object_set() only have TRUE or FALSE values. 19312 19313 * app/widgets/gimpcolormapeditor.c 19314 * app/widgets/gimpcomponenteditor.c 19315 * app/widgets/gimpcontainereditor.[ch] 19316 * app/widgets/gimpcontainergridview.c 19317 * app/widgets/gimpcontainertreeview.c 19318 * app/widgets/gimpdockable.[ch] 19319 * app/widgets/gimpdocked.[ch] 19320 * app/widgets/gimpeditor.[ch] 19321 * app/widgets/gimperrorconsole.c 19322 * app/widgets/gimpgradienteditor.c 19323 * app/widgets/gimpitemtreeview.c 19324 * app/widgets/gimppaletteeditor.c 19325 * app/widgets/gimptoolbox.c 19326 * app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory 19327 code and enable the #if 0'ed UI manager stuff. 19328 19329 * menus/gradient-editor-menu.xml: fixed typos. 19330 19331 * menus/image-menu.xml: duplicate everything so we have both 19332 an image menubar and an image popup menu. Badly cries for an 19333 XSL processor. 19334 19335 * menus/toolbox-menu.xml: added an "Extensions" placeholder. 19336 193372004-04-27 Michael Natterer <mitch@gimp.org> 19338 19339 * app/widgets/Makefile.am 19340 * app/widgets/widgets-types.h 19341 * app/widgets/gimppluginaction.[ch]: new GtkAction subclass which 19342 remembers the PlugInProcDef. 19343 19344 * app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to 19345 the GimpActionGroup struct and to gimp_action_group_new(). Removed 19346 the user_data parameter from gimp_action_group_add_*_actions(). 19347 19348 * app/widgets/gimpactionfactory.[ch]: changed accordingly. 19349 19350 * app/actions/*-actions.[ch]: removed user_data from all setup_funcs. 19351 19352 * app/actions/plug-in-actions.c: use a GimpPlugInAction and 19353 finally use the right user_data for the callback so plug-in 19354 callbacks have a proper context. 19355 19356 * app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to 19357 plug_in_menus_setup(). 19358 19359 * app/gui/image-menu.c 19360 * app/gui/toolbox-menu.c: changed accordingly. 19361 193622004-04-27 Michael Natterer <mitch@gimp.org> 19363 19364 * app/widgets/gimpactiongroup.[ch]: removed "translation-domain" 19365 property and simply use gettext(). Plug-In domains are handled 19366 by plug-in-actions.c 19367 19368 The following change finally starts breaking the old menu system 19369 while the new one is not fully in place yet. Have fun: 19370 19371 * menus/image-menu.xml: added several <placeholder>s for plug-ins 19372 to register their menu entries in the middle of already existing 19373 menus. 19374 19375 * app/gui/menus.c 19376 * plug-ins/common/mail.c 19377 * plug-ins/print/print.c 19378 * plug-ins/script-fu/scripts/copy-visible.scm: use the new 19379 placeholders to register menu entries. 19380 193812004-04-27 Michael Natterer <mitch@gimp.org> 19382 19383 Correctly translated & sorted plug-in actions & menu entries: 19384 19385 * app/widgets/gimpuimanager.[ch]: added a "gchar *name" property 19386 and a hash table which keeps all created UI managers (similar to 19387 GimpActionGroup's hash table). Added function 19388 gimp_ui_managers_from_name() which returns a list of all managers 19389 with the given name. 19390 19391 * app/widgets/gimpmenufactory.c: register a name per UI manager 19392 and pass the name to gimp_ui_manager_new(). 19393 19394 * app/actions/plug-in-actions.c: added code which correctly 19395 translates the created plug-in actions and also creates translated 19396 menu actions for the plug-in's menu_path elements. 19397 19398 * app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries 19399 using a GTree. For each entry, recursivlely create submenus 19400 from the dynamic menu actions created above before creating 19401 the plug-in's menu entry itself. 19402 19403 * app/gui/image-menu.c (image_menu_setup2) 19404 * app/gui/toolbox-menu.c (toolbox_menu_setup2): call 19405 plug_in_menus_create2(). 19406 19407 * app/gui/gui-vtable.c (gui_menus_create_entry) 19408 (gui_menus_delete_entry): added some uglyness which maps old <Prefix> 19409 menu identifiers to new-style UI manager plus ui_path tuples and 19410 call plug_in_menus_add,remove_proc() accordingly. 19411 19412 * menus/image-menu.xml 19413 * menus/toolbox-menu.xml: added name="Foo" attributes to all menus 19414 so plug-in entries find their place. 19415 194162004-04-27 Michael Natterer <mitch@gimp.org> 19417 19418 * app/gui/gui.c (gui_restore_callback): call actions_init() 19419 (gui_exit_after_callback): call actions_exit(). 19420 19421 * app/gui/menus.c (menus_init) 19422 (menu_exit): don't call them here. 19423 194242004-04-26 Michael Natterer <mitch@gimp.org> 19425 19426 * app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef. 19427 19428 * app/widgets/gimpuimanager.[ch]: added the setup_func to the 19429 GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register(). 19430 Call the setup_func after creating the UI. Replaced the term 19431 "identifier" by "ui_path". 19432 19433 * app/widgets/gimpmenufactory.c: ditto. 19434 19435 * app/gui/menus.c (menus_init): register the new setup_funcs below. 19436 19437 * app/gui/menus.[ch] (menus_open_recent_add) 19438 * app/gui/image-menu.[ch] (image_menu_setup2) 19439 * app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs 19440 which add the "Open Recent" menu items. 19441 19442 * app/actions/file-actions.c: removed "file-open-recent-empty" 19443 action because it's not needed. 19444 19445 * menus/image-menu.xml 19446 * menus/toolbox-menu.xml: removed "file-open-recent-empty" menu 19447 items and added <placeholder>s for the "Open Recent" menu items. 19448 194492004-04-26 Michael Natterer <mitch@gimp.org> 19450 19451 * app/core/gimp.[ch]: removed "locale_domain" and "help_domain" 19452 parameters from GimpMenusCreateFunc. 19453 19454 * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add) 19455 * app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def): 19456 changed accordingly. 19457 19458 * app/widgets/gimpactiongroup.[ch]: remember all created action 19459 groups is a hash table in GimpActionGroupClass. Added 19460 gimp_action_groups_from_name() which returns a GList of all groups 19461 with the given name. 19462 19463 * app/actions/plug-in-actions.[ch] (plug_in_actions_setup): 19464 removed the tree sorting code. Actions don't need to be ordered 19465 alphabetically. 19466 19467 (plug_in_actions_update): copied & ported plug_in_menus_update(). 19468 19469 * app/gui/gui-vtable.c (gui_menus_create,delete_entry): 19470 dynamically add/remove plug-in actions in all "plug-in" action 19471 groups. 19472 194732004-04-25 Michael Natterer <mitch@gimp.org> 19474 19475 * app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take 19476 a PlugInProcDef* instead of a const gchar*. 19477 19478 * app/plug-in/plug-ins.c 19479 * app/gui/gui-vtable.c 19480 * app/gui/plug-in-menus.[ch]: changed accordingly. 19481 194822004-04-25 Sven Neumann <sven@gimp.org> 19483 19484 * plug-ins/common/AlienMap2.c: some UI improvements based on a 19485 patch by William Skaggs (bug #140079). 19486 194872004-04-22 Sven Neumann <sven@gimp.org> 19488 19489 * app/gui/dialogs-constructors.c 19490 * app/gui/preferences-dialog.c: silent the compiler. 19491 19492 * plug-ins/winicon/icodialog.c: simplified by using a 19493 GimpIntComboBox. 19494 194952004-04-22 Michael Natterer <mitch@gimp.org> 19496 19497 * app/widgets/gimpuimanager.[ch]: remember and ref the created 19498 widgets. Added gimp_ui_manager_ui_popup() which pops up a GtkMenu 19499 with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is 19500 called on popdown. 19501 19502 * app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize): 19503 don't forget to free the list of managed UIs. 19504 19505 * app/widgets/gimpdockable.[ch] 19506 * app/widgets/gimpdockbook.[ch] 19507 * app/widgets/gimpdocked.[ch] 19508 * app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel 19509 to the to-be-removed GtkItemFactory stuff. 19510 19511 * app/widgets/gimpcolormapeditor.c 19512 * app/widgets/gimpcomponenteditor.c 19513 * app/widgets/gimpcontainereditor.c 19514 * app/widgets/gimpcontainergridview.c 19515 * app/widgets/gimpcontainertreeview.c 19516 * app/widgets/gimperrorconsole.c 19517 * app/widgets/gimpgradienteditor.c 19518 * app/widgets/gimpitemtreeview.c 19519 * app/widgets/gimppaletteeditor.c 19520 * app/widgets/gimptooloptionseditor.c: changed accordingly and added 19521 #if 0'ed code which actually uses all the UI managers. 19522 19523 * app/display/gimpdisplay.c 19524 * app/display/gimpdisplayshell.c 19525 * app/gui/gui-vtable.c: disabled some gimp_ui_manager_update() 19526 calls because they were invoking toggle and radio callbacks 19527 which still have the wrong signature. 19528 195292004-04-22 Sven Neumann <sven@gimp.org> 19530 19531 * plug-ins/gflare/gflare.c: ported the last plug-in from 19532 GtkOptionMenu to GimpIntComboBox. 19533 19534 * plug-ins/common/newsprint.c: changed a comment that was still 19535 talking about option menus. 19536 195372004-04-22 Michael Natterer <mitch@gimp.org> 19538 19539 * app/gui/menus.c (menus_init): fixed some typos in the UI Manager 19540 registration code. 19541 195422004-04-22 Michael Natterer <mitch@gimp.org> 19543 19544 * app/widgets/gimpactiongroup.[ch]: implemented 19545 gimp_action_group_set_action_color() and 19546 gimp_action_group_set_action_viewable(). 19547 19548 * app/actions/*-actions.c: added stock IDs to all actions which 19549 represent toplevel popup menus. Fixed typos. 19550 19551 * menus/brushes-menu.xml 19552 * menus/colormap-editor-menu.xml 19553 * menus/dockable-menu.xml 19554 * menus/gradients-menu.xml 19555 * menus/patterns-menu.xml 19556 * menus/toolbox-menu.xml: fixed typos. 19557 195582004-04-22 Sven Neumann <sven@gimp.org> 19559 19560 * plug-ins/rcm/rcm_callback.[ch] 19561 * plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to 19562 GimpIntComboBox. 19563 195642004-04-22 Sven Neumann <sven@gimp.org> 19565 19566 * libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)" 19567 item if the store is empty and remove it as soon as other items 19568 are being added. 19569 19570 * libgimp/gimpdrawablecombobox.c 19571 * libgimp/gimpimagecombobox.c: removed handling of the empty list; 19572 the store does this for us now. 19573 195742004-04-22 Sven Neumann <sven@gimp.org> 19575 19576 * libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new): 19577 removed the check for first_label != NULL. Passing a NULL label 19578 makes a perfect empty combo_box. 19579 19580 * plug-ins/common/newsprint.c 19581 * plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to 19582 GimpIntComboBox. 19583 195842004-04-22 Sven Neumann <sven@gimp.org> 19585 19586 * plug-ins/flame/flame.c 19587 * plug-ins/gimpressionist/brush.c: ported the last two users of 19588 gimpmenu.h to GimpDrawableComboBox. 19589 19590 * libgimp/gimpmenu.[ch]: declared the functions found here as 19591 deprecated. 19592 19593 * plug-ins/common/plugindetails.c 19594 * plug-ins/ifscompose/ifscompose.c: silent the compiler. 19595 195962004-04-21 Sven Neumann <sven@gimp.org> 19597 19598 * libgimp/gimpdrawablecombobox.c 19599 * libgimp/gimpimagecombobox.c 19600 * libgimp/gimpmenu.c: changed the label for the empty menu from 19601 "None" to "Empty" since that's what GTK+ uses. 19602 19603 * libgimpwidgets/gimpintcombobox.[ch]: added convenience function 19604 gimp_int_combo_box_connect(). 19605 19606 * plug-ins/common/bumpmap.c 19607 * plug-ins/common/compose.c 19608 * plug-ins/common/depthmerge.c 19609 * plug-ins/common/displace.c 19610 * plug-ins/common/lic.c 19611 * plug-ins/common/warp.c: ported to GimpDrawableComboBox. 19612 19613 * plug-ins/Lighting/lighting_ui.c 19614 * plug-ins/MapObject/mapobject_ui.c 19615 * plug-ins/common/sample_colorize.c: use 19616 gimp_int_combo_box_connect(). This restores the correct behaviour 19617 of setting the drawable_ID to the first drawable from the list if 19618 it's invalid. 19619 196202004-04-21 Michael Natterer <mitch@gimp.org> 19621 19622 * app/widgets/Makefile.am 19623 * app/widgets/widgets-types.h 19624 * app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds 19625 API to update all action groups and knows which UIs it can create 19626 from which XML files. 19627 19628 * app/widgets/gimpmenufactory.[ch]: register the XML file 19629 basenames along with path of their toplevel menus. Create 19630 GimpUIManagers instead of GtkUIManagers and register the 19631 XML files and menu paths with them. 19632 19633 * app/gui/menus.c: register all XML files and their toplevel 19634 menu paths. 19635 19636 * app/widgets/gimpeditor.[ch]: also create a GimpUIManager when 19637 creating the GtkItemFactory. Added "const gchar *ui_identifier" 19638 parameter to gimp_editor_create_menu(). 19639 19640 * app/widgets/gimpcontainereditor.[ch] 19641 * app/widgets/gimpdataeditor.[ch] 19642 * app/widgets/gimpdatafactoryview.[ch] 19643 * app/widgets/gimpitemtreeview.[ch]: added "ui_identifier" 19644 parameters to all constructors. 19645 19646 * app/widgets/gimpbrusheditor.c 19647 * app/widgets/gimpbrushfactoryview.c 19648 * app/widgets/gimpbufferview.c 19649 * app/widgets/gimpcolormapeditor.c 19650 * app/widgets/gimpcomponenteditor.c 19651 * app/widgets/gimpcontainerpopup.c 19652 * app/widgets/gimpdocumentview.c 19653 * app/widgets/gimperrorconsole.c 19654 * app/widgets/gimpfontview.c 19655 * app/widgets/gimpgradienteditor.c 19656 * app/widgets/gimpimageview.c 19657 * app/widgets/gimppaletteeditor.c 19658 * app/widgets/gimppatternfactoryview.c 19659 * app/widgets/gimptemplateview.c 19660 * app/widgets/gimptooloptionseditor.c 19661 * app/gui/dialogs-constructors.c 19662 * app/gui/gradient-select.c 19663 * app/gui/palette-select.c 19664 * app/gui/pattern-select.c: pass UI identifiers to the changed 19665 functions above. 19666 19667 * app/display/gimpdisplayshell.[ch]: added a GimpUIManager for 19668 the menubar (menubar creating code still commented out). 19669 19670 * app/display/gimpdisplay.c 19671 * app/gui/gui-vtable.c: update the ui manager. 19672 196732004-04-21 Michael Natterer <mitch@gimp.org> 19674 19675 * app/actions/actions.c: forgot to register the "patterns" actions. 19676 19677 * app/actions/*-actions.c: added actions representing the toplevel 19678 menus (popups and menubars). Fixed some typos. 19679 19680 * menus/*-menu.xml: added action="foo" attributes to all toplevel 19681 menus. Fixed typos here too. 19682 19683 * menus/gtkuimanager.dtd: fixed possible attributes. 19684 196852004-04-21 Sven Neumann <sven@gimp.org> 19686 19687 * libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as 19688 in the new combo_box widgets. 19689 19690 * libgimpwidgets/gimpintcombobox.[ch] 19691 * libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers. 19692 196932004-04-21 Sven Neumann <sven@gimp.org> 19694 19695 * libgimp/gimpdrawablecombobox.c 19696 * libgimp/gimpimagecombobox.c 19697 * libgimp/gimppixbuf.c 19698 * libgimpwidgets/gimpintcombobox.c 19699 * libgimpwidgets/gimpintstore.c: API documentation. 19700 197012004-04-21 Sven Neumann <sven@gimp.org> 19702 19703 * libgimpwidgets/gimpintcombobox.[ch]: added new functions 19704 gimp_int_combo_box_[prepend|append]. 19705 19706 * plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox. 19707 197082004-04-21 Michael Natterer <mitch@gimp.org> 19709 19710 * app/actions/qmask-actions.c 19711 * app/actions/qmask-commands.c: prepared qmask_actions_update() 19712 and the qmask callbacks to be merged into the image ui manager. 19713 19714 * app/actions/dialogs-actions.c 19715 * app/actions/edit-actions.c 19716 * app/actions/file-actions.c 19717 * app/actions/image-actions.c 19718 * app/actions/layers-actions.c 19719 * app/actions/plug-in-actions.c 19720 * app/actions/tools-actions.c 19721 * app/actions/view-actions.c: fixed lots of typos and buglets 19722 spotted in my first test run. 19723 19724 * app/gui/menus.c: register the needed action groups with the 19725 <Image> menu. 19726 19727 * app/tools/gimp-tools.c 19728 * app/tools/gimpdodgeburntool.[ch] 19729 * app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g. 19730 19731 * app/widgets/gimpactionfactory.c 19732 * app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g, 19733 updated copyright header. 19734 19735 * menus/image-menu.xml: fixed typos and added the "Filters" 19736 submenus. 19737 197382004-04-21 Michael Natterer <mitch@gimp.org> 19739 19740 More unused action stuff: 19741 19742 * app/widgets/Makefile.am 19743 * app/widgets/widgets-types.h 19744 * app/widgets/gimpactionfactory.[ch]: added a simple factory which 19745 produces GimpActionGroups. 19746 19747 * app/widgets/gimpactiongroup.[ch]: added an "update_func" member 19748 to the GimpActionGroup struct. Added it as parameter to 19749 gimp_action_group_new(). Added function gimp_action_group_update(). 19750 19751 * app/widgets/gimpmenufactory.[ch]: added an "action_factory" 19752 member and constructor parameter. Added code to create 19753 GtkUIManagers from registered action group identifiers. 19754 19755 * app/actions/Makefile.am 19756 * app/actions/actions.[ch]: new files: create a 19757 "global_action_factory" and register all action groups with it. 19758 19759 * app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/ 19760 19761 * app/actions/plug-in-actions.[ch]: added API to add/remove 19762 plug-in procedure actions dynamically (unfinished). 19763 19764 * app/gui/menus.c (menus_init): call actions_init(). 19765 (menus_exit): call actions_exit(). 19766 197672004-04-21 Sven Neumann <sven@gimp.org> 19768 19769 * plug-ins/Lighting/lighting_ui.c 19770 * plug-ins/MapObject/mapobject_ui.c: ported to the new API. 19771 197722004-04-21 Sven Neumann <sven@gimp.org> 19773 19774 * libgimp/Makefile.am 19775 * libgimp/gimpui.h 19776 * libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors 19777 to gimp data (drawable and image thumbnails for now). 19778 19779 * libgimp/gimpdrawablecombobox.[ch] 19780 * libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox 19781 constructors for image, drawable, channel and layer menus. 19782 19783 * plug-ins/script-fu/script-fu-scripts.c: use the new functions 19784 instead of the gimpmenu API that is about to be deprecated. 19785 197862004-04-20 Sven Neumann <sven@gimp.org> 19787 19788 * tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed 19789 color cast. Merged from stable branch. 19790 19791 * app/pdb/fileops_cmds.c: regenerated. 19792 197932004-04-20 Sven Neumann <sven@gimp.org> 19794 19795 * libgimpwidgets/Makefile.am 19796 * libgimpwidgets/gimpwidgets.h 19797 * libgimpwidgets/gimpwidgetstypes.h 19798 * libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived 19799 from GtkListStore, to be used by GimpIntComboBox and also by the 19800 image and drawable menus. 19801 19802 * libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore. 19803 19804 * app/widgets/gimpenumstore.[ch]: derive from GimpIntStore, 19805 removed API that is provided by the parent class. 19806 19807 * app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox, 19808 removed API that is provided by the parent class. 19809 19810 * app/gui/resize-dialog.c 19811 * app/tools/gimpcurvestool.c 19812 * app/tools/gimplevelstool.c 19813 * app/widgets/gimpcolorframe.c 19814 * app/widgets/gimphistogrameditor.c 19815 * app/widgets/gimppropwidgets.c 19816 * app/widgets/gimpstrokeeditor.c: changed accordingly. 19817 198182004-04-20 Sven Neumann <sven@gimp.org> 19819 19820 * app/widgets/gimpenumstore.[ch] 19821 * app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care 19822 of rendering the pixbuf from the stock_id. 19823 198242004-04-20 Sven Neumann <sven@gimp.org> 19825 19826 * libgimpwidgets/gimpmemsizeentry.c 19827 * modules/cdisplay_colorblind.c 19828 * modules/cdisplay_proof.c: ported to GimpIntComboBox. 19829 19830 * libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu 19831 API as deprecated and removed the code here. 19832 19833 * libgimpwidgets/Makefile.am 19834 * libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated 19835 code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif. 19836 19837 * libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS. 19838 19839 * configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED. 19840 19841 * app/widgets/gimpwidgets-constructors.c: added a #warning and 19842 #undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last 19843 remaining user of gimp_int_option_menu_new(). 19844 198452004-04-20 Michael Natterer <mitch@gimp.org> 19846 19847 * app/gui/convert-dialog.[ch]: renamed convert_to_indexed() 19848 to convert_dialog_new() and return the dialog. Removed 19849 convert_to_rgb() and convert_to_grayscale(). 19850 19851 * app/gui/offset-dialog.[ch]: renamed offset_dialog_create() 19852 to offset_dialog_new() and return the dialog. 19853 19854 * app/Makefile.am 19855 * app/actions/drawable-commands.c 19856 * app/actions/image-commands.c: changed accordingly. 19857 198582004-04-20 Michael Natterer <mitch@gimp.org> 19859 19860 * app/gui/*-commands.[ch]: removed... 19861 19862 * app/actions/*-commands.[ch]: ...and added here. 19863 19864 * app/gui/Makefile.am 19865 * app/gui/*-menu.c 19866 * app/gui/dialogs-constructors.c 19867 * app/gui/gui.c 19868 * app/gui/menus.c 19869 * app/actions/Makefile.am 19870 * app/actions/*-actions.c: changed accordingly. 19871 19872 * app/actions/plug-in-actions.[ch] 19873 * app/actions/tools-actions.[ch]: new files. 19874 19875 * app/Makefile.am: had to add more -u evilness because gui/ 19876 and actions/ have cyclic dependencies. 19877 19878 * menus/image-menu.xml: added some more items. 19879 198802004-04-20 Sven Neumann <sven@gimp.org> 19881 19882 * app/widgets/gimpwidgets-constructors.[ch]: added new function 19883 gimp_paint_mode_menu_set_history(). 19884 19885 * app/gui/brush-select.c 19886 * app/widgets/gimplayertreeview.c 19887 * app/widgets/gimppropwidgets.c: use the new function instead of 19888 the deprecated gimp_int_option_menu API. 19889 198902004-04-20 Sven Neumann <sven@gimp.org> 19891 19892 * plug-ins/common/align_layers.c 19893 * plug-ins/common/borderaverage.c 19894 * plug-ins/common/channel_mixer.c 19895 * plug-ins/common/gif.c 19896 * plug-ins/common/mng.c 19897 * plug-ins/flame/flame.c 19898 * plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox. 19899 199002004-04-20 Sven Neumann <sven@gimp.org> 19901 19902 * plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL 19903 before unrefing it. Fixes bug #140554; merged from stable branch. 19904 199052004-04-20 Sven Neumann <sven@gimp.org> 19906 19907 * app/widgets/gimpenumcombobox.c: added more sanity checks. 19908 19909 * libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox 19910 constructor: gimp_int_combo_box_new_array(). 19911 19912 * plug-ins/Lighting/lighting_ui.c 19913 * plug-ins/MapObject/mapobject_ui.c 19914 * plug-ins/common/CML_explorer.c: ported to GimpIntComboBox. 19915 199162004-04-20 Sven Neumann <sven@gimp.org> 19917 19918 * libgimpwidgets/Makefile.am 19919 * libgimpwidgets/gimpwidgets.h 19920 * libgimpwidgets/gimpwidgetstypes.h 19921 * libgimpwidgets/gimpintcombobox.[ch]: added new widget 19922 GimpIntComboBox, a GtkComboBox with a simple list store to hold a 19923 label and an associated integer value. This is going to replace 19924 gimp_int_option_menu. 19925 19926 * plug-ins/common/jpeg.c 19927 * plug-ins/print/gimp_main_window.c: ported these two plug-ins to 19928 the newly added widget. 19929 199302004-04-20 Sven Neumann <sven@gimp.org> 19931 19932 * plug-ins/gfig/gfig.c: removed unused return locations for menu 19933 item pointers. 19934 199352004-04-19 Sven Neumann <sven@gimp.org> 19936 19937 * configure.in: set gimp_plugin_version, gimp_sysconf_version and 19938 gimp_data_version to 2.1 so that the development version is 19939 clearly separated from stable gimp 2.0. 19940 199412004-04-19 Michael Natterer <mitch@gimp.org> 19942 19943 * menus/Makefile.am 19944 * menus/image-menu.xml 19945 * menus/tool-options-menu.xml: more menus. 19946 199472004-04-19 Sven Neumann <sven@gimp.org> 19948 19949 * app/widgets/gimpactiongroup.c 19950 * app/widgets/gimpenumcombobox.c 19951 * app/widgets/gimpenumstore.c: fixed inline docs. 19952 19953 * app/widgets/gimpenumaction.c: fixed property declaration. 19954 199552004-04-19 Michael Natterer <mitch@gimp.org> 19956 19957 * app/gui/colormap-editor-commands.[ch] 19958 * app/gui/debug-commands.[ch] 19959 * app/gui/dockable-commands.[ch] 19960 * app/gui/error-console-commands.[ch] 19961 * app/gui/file-commands.[ch] 19962 * app/gui/gradient-editor-commands.[ch] 19963 * app/gui/help-commands.[ch] 19964 * app/gui/qmask-commands.[ch] 19965 * app/gui/tool-options-commands.[ch]: removed "guint action" 19966 parameter from all callbacks which don't need it. 19967 199682004-04-19 Sven Neumann <sven@gimp.org> 19969 19970 * menus/Makefile.am 19971 * menus/gtkuimanager.dtd: added a DTD (basically copied from the 19972 GTK+ API docs). Added a "validate" rule that allows to easily 19973 validate the XML files. 19974 19975 * menus/*.xml: added a DOCTYPE declaration that refers to the 19976 newly added DTD. 19977 19978 * app/widgets/gimpenumstore.[ch]: 19979 * app/widgets/gimpenumcombobox.c: documented the new API. 19980 199812004-04-19 Michael Natterer <mitch@gimp.org> 19982 19983 * app/actions/Makefile.am 19984 * app/actions/actions-types.h: oops, forgot to commit this one. 19985 199862004-04-19 Michael Natterer <mitch@gimp.org> 19987 19988 * menus/Makefile.am 19989 * menus/toolbox-menu.xml: added the toolbox menu. 19990 199912004-04-19 Michael Natterer <mitch@gimp.org> 19992 19993 More GtkAction stuff (still unused): 19994 19995 * configure.in: added new directories menus/ and app/actions/ 19996 19997 * Makefile.am: build menus/ 19998 19999 * menus/.cvsignore 20000 * menus/Makefile.am 20001 * menus/*-menu.xml: new files: XML menu descriptions for each menu 20002 which is now defined in gui/*-menu.c. 20003 20004 * app/widgets/widgets-types.h: some typedefs for GimpActionGroup. 20005 20006 * app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only 20007 property. Added APIs to set actions visible/sensitive/active 20008 and an unimplemented stub for setting the action's color. 20009 20010 * app/Makefile.am: build actions/ and link libappactions.a 20011 20012 * app/actions/.cvsignore 20013 * app/actions/Makefile.am 20014 * app/actions/*-actions.[ch]: new files: GtkActions for each 20015 *-commands.c file in gui/. Ported all "update" functions from the 20016 *-menu.c files. 20017 (everything completely unused, untested and partly #if 0'ed) 20018 20019 * app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added 20020 API to raise/lower channels/vectors to top/bottom. 20021 20022 * app/gui/channels-commands.[ch] 20023 * app/gui/vectors-commands.[ch]: added callbacks for the new 20024 to top/bottom functions. 20025 20026 * app/gui/Makefile.am 20027 * app/gui/dockable-commands.[ch]: new files split out of 20028 dialogs-commands.[ch]. 20029 20030 * app/gui/dialogs-commands.[ch] 20031 * app/gui/dialogs-menu.c: changed accordingly. 20032 20033 * app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback() 20034 and remove usage of "guint action". 20035 20036 * app/gui/image-menu.c: changed accordingly. 20037 20038 * app/gui/palette-editor-commands.[ch]: split 20039 +palette_editor_new_color_cmd_callback() into separate callbacks 20040 for adding from FG and BG. 20041 20042 * app/gui/palette-editor-menu.c: changed accordingly. 20043 200442004-04-19 Henrik Brix Andersen <brix@gimp.org> 20045 20046 * plug-ins/script-fu/scripts/gimp-headers.scm 20047 * plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from 20048 William Skaggs which changes the sub menu title for the gimp web 20049 theme to classic.gimp.org. Fixes bug #137036. 20050 200512004-04-19 Sven Neumann <sven@gimp.org> 20052 20053 * app/widgets/gimpdrawabletreeview.c: removed unused includes. 20054 200552004-04-19 Sven Neumann <sven@gimp.org> 20056 20057 * app/widgets/gimppropwidgets.[ch] 20058 * app/gui/preferences-dialog.c: replaced 20059 gimp_prop_boolean_option_menu_new() with 20060 gimp_prop_boolean_combo_box_new(). 20061 200622004-04-19 Sven Neumann <sven@gimp.org> 20063 20064 * app/widgets/gimpenumstore.[ch]: avoid unnecessary casts. 20065 20066 * app/widgets/gimpenumcombobox.[ch]: added an API that inserts a 20067 GtkTreeModelFilter to make items invisible. This is a kludge to 20068 workaround bug #135875. 20069 20070 * app/tools/gimpcurvestool.c 20071 * app/tools/gimplevelstool.c 20072 * app/widgets/gimphistogrameditor.c: use the new function to hide 20073 channels that are not available. 20074 200752004-04-18 Henrik Brix Andersen <brix@gimp.org> 20076 20077 * app/widgets/gimptemplateeditor.c 20078 (gimp_template_editor_constructor): use g_signal_connect_object() 20079 instead of g_signal_connect(). Fixes bug #140315. 20080 200812004-04-18 Pedro Gimeno <pggimeno@wanadoo.es> 20082 20083 * plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix. 20084 200852004-04-18 Pedro Gimeno <pggimeno@wanadoo.es> 20086 20087 * plug-ins/common/gauss_iir.c: Change tabs to spaces all over the 20088 file, in preparation for other changes. Minor cleanup. 20089 20090 * plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the 20091 returned value from make_curve(). 20092 20093 * plug-ins/common/tga.c (load_image): Fix a condition which was 20094 preventing GRAYA images from loading. 20095 200962004-04-18 Sven Neumann <sven@gimp.org> 20097 20098 * app/widgets/Makefile.am 20099 * app/widgets/widgets-types.h 20100 * app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu. 20101 20102 * app/widgets/gimpenumwidgets.[ch]: moved widget constructors that 20103 don't use GimpEnumMenu from gimpenummenu.[ch] to these new files. 20104 20105 * app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget 20106 using GimpEnumStore; replaces GimpEnumMenu. 20107 20108 * app/widgets/gimpenumstore.[ch]: added new function 20109 gimp_enum_store_lookup_by_value(). 20110 20111 * app/widgets/gimppropwidgets.[ch]: replaced 20112 gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new(). 20113 20114 * app/gui/brush-select.[ch] 20115 * app/gui/convert-dialog.c 20116 * app/gui/layers-commands.c 20117 * app/gui/preferences-dialog.c 20118 * app/gui/resize-dialog.c 20119 * app/tools/gimpblendoptions.c 20120 * app/tools/gimpcolorbalancetool.c 20121 * app/tools/gimpcroptool.c 20122 * app/tools/gimpcurvestool.c 20123 * app/tools/gimplevelstool.c 20124 * app/tools/gimpmagnifytool.c 20125 * app/tools/gimppaintoptions-gui.c 20126 * app/tools/gimpselectionoptions.c 20127 * app/tools/gimptransformoptions.c 20128 * app/widgets/gimpcolorframe.c 20129 * app/widgets/gimpeditor.c 20130 * app/widgets/gimpgrideditor.c 20131 * app/widgets/gimphistogrameditor.c 20132 * app/widgets/gimpstrokeeditor.c 20133 * app/widgets/gimptemplateeditor.c 20134 * app/widgets/gimptexteditor.c: ported to GimpEnumComboBox. 20135 201362004-04-18 Sven Neumann <sven@gimp.org> 20137 20138 * app/widgets/Makefile.am 20139 * app/widgets/widgets-types.h 20140 * app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore, 20141 a GtkListStore for enum values. 20142 201432004-04-18 Sven Neumann <sven@gimp.org> 20144 20145 * plug-ins/print/gimp_main_window.c: replaced wrong use of 20146 gimp_option_menu with gimp_int_option_menu. 20147 201482004-04-18 Sven Neumann <sven@gimp.org> 20149 20150 * plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for 20151 SF-OPTION. 20152 201532004-04-18 Sven Neumann <sven@gimp.org> 20154 20155 * plug-ins/winicon/icodialog.c 20156 * plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox. 20157 201582004-04-17 Sven Neumann <sven@gimp.org> 20159 20160 * app/widgets/gimpwidgets-constructors.[ch]: 20161 s/GtkSignalFunc/GCallback/ 20162 201632004-04-17 Henrik Brix Andersen <brix@gimp.org> 20164 20165 * app/tools/gimphuesaturationtool.c 20166 (gimp_hue_saturation_tool_dialog): resolved conflicting 20167 mnemonic. Fixes bug #139868. 20168 201692004-04-17 Henrik Brix Andersen <brix@gimp.org> 20170 20171 * plug-ins/common/jpeg.c (save_dialog): live preview doesn't 20172 modify the undo history of the image anymore, label changed 20173 accordingly. Fixes bug #140296. 20174 201752004-04-16 Pedro Gimeno <pggimeno@wanadoo.es> 20176 20177 * plug-ins/common/tile.c (tile): changed a call to 20178 gimp_image_undo_enable to _undo_disable which was obviously the 20179 intention of the author. Added a call to gimp_drawable_update to 20180 get the previews refreshed. 20181 201822004-04-16 Sven Neumann <sven@gimp.org> 20183 20184 * app/tools/gimpcolorpickertool.c 20185 * app/tools/gimpmeasuretool.c: don't use gtk_window_present() to 20186 raise the tool dialog since it also moves the focus away from the 20187 image window. Fixes the problem described in bug #139349. 20188 201892004-04-16 Sven Neumann <sven@gimp.org> 20190 20191 * app/tools/gimpcroptool.c: some code cleanup that I forgot to do 20192 when applying the patch. 20193 201942004-04-16 Sven Neumann <sven@gimp.org> 20195 20196 * plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the 20197 help browser window. 20198 201992004-04-16 Sven Neumann <sven@gimp.org> 20200 20201 * plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of 20202 GtkCombo and keep the history in a GtkListStore. 20203 202042004-04-16 Michael Natterer <mitch@gimp.org> 20205 20206 * app/core/gimpmarshal.list: new marshaller VOID:STRING 20207 20208 * app/widgets/Makefile.am 20209 * app/widgets/widgets-types.h 20210 * app/widgets/gimpactiongroup.[ch] 20211 * app/widgets/gimpenumaction.[ch] 20212 * app/widgets/gimpstringaction.[ch]: added some completely unused 20213 GtkAction infrastructure. 20214 202152004-04-15 Manish Singh <yosh@gimp.org> 20216 20217 * tools/Makefile.am 20218 * app/Makefile.am 20219 * configure.in: app, tools, and user dir bumped to version 2.1 names. 20220 20221 * app/text/gimpfontlist.c: since we now depend on pango 1.4, we can 20222 use pango_fc_font_description_from_pattern() instead of our 20223 cut-n-paste function, gimp_font_list_font_desc_from_pattern(). 20224 202252004-04-15 Tor Lillqvist <tml@iki.fi> 20226 20227 * app/plug-in/plug-in-message.c (plug_in_handle_proc_install) 20228 * app/plug-in/plug-in-proc.h (struct _PlugInProcDef) 20229 * app/plug-in/plug-in-rc.c (plug_in_rc_write) 20230 * app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures 20231 (including their menu entries) installed during a plug-ins init() 20232 phase show up. Add a flag to PlugInProcDef that tells whether the 20233 proc was installed during the init() phase. Such procs aren't 20234 saved to the pluginrc. Move the code that initializes plug-ins 20235 that need initialization earlier, before the procs are added to 20236 the PDB and menus are built. Fixes bug #139969. 20237 202382004-04-16 Sven Neumann <sven@gimp.org> 20239 20240 * plug-ins/common/Makefile.am 20241 * plug-ins/common/plugin-defs.pl 20242 * plug-ins/common/AlienMap.c: removed the AlienMap plug-in since 20243 AlienMap2 duplicates its functionality. 20244 20245 * plug-ins/common/AlienMap2.c: applied patch from William Skaggs 20246 with a couple of user interface improvements (bug #140079). 20247 202482004-04-15 Tor Lillqvist <tml@iki.fi> 20249 20250 * libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like 20251 the .def files of the other libgimp* libs. 20252 20253 * app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS. 20254 20255 * gimp-zip.in: Put also libgimpthumb in the developer package. 20256 202572004-04-15 Sven Neumann <sven@gimp.org> 20258 20259 * plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a 20260 warning that deprecated widgets are being used. 20261 202622004-04-15 Sven Neumann <sven@gimp.org> 20263 20264 * configure.in 20265 * plug-ins/Makefile.am 20266 * plug-ins/winicon/Makefile.am 20267 * plug-ins/winicon/icodialog.[ch] 20268 * plug-ins/winicon/icoload.[ch] 20269 * plug-ins/winicon/icosave.[ch] 20270 * plug-ins/winicon/main.[ch]: added plug-in to load and save 20271 Windows icon files. Plug-in written by Christian Kreibich, port to 20272 GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes 20273 bug #139160. 20274 202752004-04-15 Michael Natterer <mitch@gimp.org> 20276 20277 * app/widgets/gimpdnd.c (gimp_dnd_data_source_add) 20278 (gimp_dnd_data_source_remove): use the new dynamic GtkTargetList 20279 based API for changing the widget's drag source types. 20280 20281 * app/widgets/gimpdocumentview.c (gimp_document_view_new): simply 20282 call gimp_dnd_file_source_add() instead of duplicating the whole 20283 GtkTargetEntry array insanity just for adding one source type. 20284 202852004-04-15 Michael Natterer <mitch@gimp.org> 20286 20287 * plug-ins/FractalExplorer/Dialogs.c 20288 * plug-ins/flame/flame.c 20289 * plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser. 20290 202912004-04-15 Michael Natterer <mitch@gimp.org> 20292 20293 * app/display/gimpdisplayshell-callbacks.c 20294 * app/display/gimpdisplayshell.c 20295 * app/widgets/gimpcontainertreeview.c: removed runtime version 20296 checks and workarounds for bugs which are fixed in GTK+ 2.4. 20297 20298 * app/widgets/gimpfiledialog.c 20299 (gimp_file_dialog_selection_changed): added runtime check for GTK+ 20300 2.4.1 and work around GtkFileChooser's missing "update_preview" 20301 functionality for multiple selections if the dependency is not 20302 met. 20303 20304 * app/widgets/gimpwidgets-utils.c (gimp_menu_position) 20305 (gimp_menu_button_position): call gtk_menu_set_monitor() until 20306 bug #139187 is fixed. 20307 203082004-04-15 Michael Natterer <mitch@gimp.org> 20309 20310 * app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser 20311 instead of GtkFileSelection. 20312 20313 * app/gui/file-dialog-utils.c 20314 * app/gui/file-open-dialog.c 20315 * app/gui/file-save-dialog.c 20316 * app/widgets/gimpthumbbox.c: changed accordingly. 20317 20318 * app/gui/gradients-commands.c 20319 * app/gui/vectors-commands.c 20320 * app/tools/gimpimagemaptool.c 20321 * app/widgets/gimperrorconsole.c 20322 * app/widgets/gimptexteditor.c 20323 * libgimpwidgets/gimpfileentry.c: use file choosers instead of 20324 file selectors. 20325 203262004-04-15 Michael Natterer <mitch@gimp.org> 20327 20328 * configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0 20329 20330 * app/sanity.c: changed accordingly. 20331 203322004-04-15 Sven Neumann <sven@gimp.org> 20333 20334 * app/tools/gimpcropoptions.[ch] 20335 * app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that 20336 allows to keep the aspect ratio fixed. 20337 203382004-04-15 Michael Natterer <mitch@gimp.org> 20339 20340 * app/core/gimplayermask.c (gimp_layer_mask_class_init): set 20341 translate_desc to "Move Layer Mask". 20342 20343 * app/tools/gimpeditselectiontool.c: take the undo desc 20344 from the moved item's class instead of duplicating all 20345 strings here. 20346 203472004-04-15 Sven Neumann <sven@gimp.org> 20348 20349 * app/core/gimppalette-import.[ch] 20350 * app/gui/palette-import-dialog.c: added palette import from RIFF 20351 palette files based on a patch from ÉRDI Gergõ (bug #129788). 20352 203532004-04-15 Michael Natterer <mitch@gimp.org> 20354 20355 * app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot 20356 to add context parameters to this non-generated PDB invokers. 20357 Fixes XCF loading/saving. 20358 203592004-04-15 Michael Natterer <mitch@gimp.org> 20360 20361 * app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to 20362 the GimpItemClass struct and always push an undo group 20363 around GimpItem::stroke(). 20364 20365 * app/core/gimpchannel.c 20366 * app/core/gimpselection.c 20367 * app/vectors/gimpvectors.c: set the stroke_desc accordingly 20368 and don't push undo groups. 20369 20370 * app/text/gimptextlayer.c (gimp_text_layer_class_init): set 20371 all of GimpItemClass' undo_descs. 20372 20373 * app/text/gimptextlayer-transform.c: don't push undo groups here. 20374 203752004-04-15 Sven Neumann <sven@gimp.org> 20376 20377 * libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch 20378 from Marco Munari that removes a redundant "if" (bug #133540). 20379 203802004-04-15 Sven Neumann <sven@gimp.org> 20381 20382 * plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that 20383 adds spinbuttons instead of simple text entries (bug #138132). 20384 203852004-04-15 Sven Neumann <sven@gimp.org> 20386 20387 * plug-ins/common/Makefile.am 20388 * plug-ins/common/plugin-defs.pl 20389 * plug-ins/common/gicon.c: removed the GIcon plug-in (addresses 20390 one aspect of bug #139160). 20391 203922004-04-15 Michael Natterer <mitch@gimp.org> 20393 20394 Context cleanup continued: 20395 20396 * app/core/gimpitem.[ch]: added context parameter to 20397 GimpItem::stroke(). 20398 20399 * app/core/gimpchannel.c (gimp_channel_stroke) 20400 * app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get 20401 default values from instead of gimp_get_user_context(). 20402 20403 * app/core/gimpselection.c 20404 * app/gui/stroke-dialog.c 20405 * tools/pdbgen/pdb/edit.pdb 20406 * tools/pdbgen/pdb/paths.pdb: changed accordingly. 20407 20408 * app/pdb/edit_cmds.c 20409 * app/pdb/paths_cmds.c: regenerated. 20410 20411 * app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn 20412 struct. Added context parameter to plug_in_new(), 20413 plug_in_call_query() and plug_in_call_init(). 20414 20415 * app/plug-in/plug-in-run.[ch]: added context parameters to 20416 plug_in_run() and plug_in_repeat(). 20417 20418 * app/gui/plug-in-commands.c 20419 * app/gui/vectors-commands.c 20420 * app/pdb/procedural_db.c 20421 * app/widgets/gimphelp.c: pass a context to plug_in_run() and 20422 plug_in_repeat(). 20423 20424 * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call 20425 procedures with the plug-in's context. 20426 20427 * app/plug-in/plug-ins.c: use a temporary context for running the 20428 plug-ins' query() and init() functions. Use the same context for 20429 running automatic extensions. This temporarily separates the main 20430 Script-Fu extension from the user context (i.e. scripts have no 20431 way of setting/getting the global FG, BG, brush etc.). 20432 204332004-04-15 Sven Neumann <sven@gimp.org> 20434 20435 * NEWS 20436 * README: mention that this is the development branch. 20437 204382004-04-15 Sven Neumann <sven@gimp.org> 20439 20440 * app/paint-funcs/paint-funcs.[ch]: 20441 * app/paint-funcs/paint-funcs-generic.h: header cleanup, added 20442 some const qualifiers, converted tabs to spaces. Fixes bug #140115 20443 for the HEAD branch. 20444 204452004-04-15 Michael Natterer <mitch@gimp.org> 20446 20447 Get rid of the "current_context" which was in fact just a bunch of 20448 global variables. Instead, pass the needed context all the way 20449 from the GUI and the PDB to the core. This is a prerequisite for 20450 macro recording and generally helps separating the various 20451 subsystems from each other. Work in progress... 20452 20453 * app/core/gimp.[ch]: removed member "current_context" and 20454 gimp_[get|set]_current_context(). 20455 20456 * app/core/gimp-edit.[ch] 20457 * app/core/gimpdrawable-blend.[ch] 20458 * app/core/gimpdrawable-bucket-fill.[ch] 20459 * app/core/gimpdrawable-offset.[ch] 20460 * app/core/gimpdrawable-transform.[ch] 20461 * app/core/gimpimage-crop.[ch] 20462 * app/core/gimpimage-flip.[ch] 20463 * app/core/gimpimage-merge.[ch] 20464 * app/core/gimpimage-resize.[ch] 20465 * app/core/gimpimage-rotate.[ch] 20466 * app/core/gimpimage.[ch] 20467 * app/core/gimpimagefile.[ch] 20468 * app/core/gimpitem-linked.[ch] 20469 * app/core/gimpitem.[ch] 20470 * app/core/gimplayer.[ch] 20471 * app/core/gimpselection.[ch] 20472 * app/core/gimptemplate.[ch] 20473 * app/file/file-open.[ch] 20474 * app/file/file-save.[ch] 20475 * app/pdb/procedural_db.[ch] 20476 * app/text/gimptext-compat.[ch] 20477 * app/text/gimptextlayer-transform.[ch] 20478 * app/gui/brush-select.[ch] 20479 * app/gui/font-select.[ch] 20480 * app/gui/gradient-select.[ch] 20481 * app/gui/palette-select.[ch] 20482 * app/gui/pattern-select.[ch]: added tons of "GimpContext *context" 20483 parameters and use the passed context instead of 20484 gimp_get_current_context(). 20485 20486 * app/app_procs.c 20487 * app/batch.c 20488 * app/core/gimpchannel.c 20489 * app/core/gimpdrawable.c 20490 * app/paint/gimperaser.c 20491 * app/paint/gimppaintbrush.c 20492 * app/plug-in/plug-in-message.c 20493 * app/plug-in/plug-ins.c 20494 * app/text/gimptextlayer.c 20495 * app/tools/gimpblendtool.c 20496 * app/tools/gimpbucketfilltool.c 20497 * app/tools/gimpcroptool.c 20498 * app/tools/gimpeditselectiontool.c 20499 * app/tools/gimpfliptool.c 20500 * app/tools/gimpinktool.c 20501 * app/tools/gimptransformtool.c 20502 * app/vectors/gimpvectors.c 20503 * app/gui/convert-dialog.c 20504 * app/gui/drawable-commands.c 20505 * app/gui/edit-commands.c 20506 * app/gui/file-commands.c 20507 * app/gui/file-new-dialog.c 20508 * app/gui/file-open-dialog.c 20509 * app/gui/file-save-dialog.c 20510 * app/gui/image-commands.c 20511 * app/gui/layers-commands.c 20512 * app/gui/offset-dialog.c 20513 * app/gui/select-commands.c 20514 * app/gui/vectors-commands.c 20515 * app/widgets/gimpdnd.c 20516 * app/widgets/gimpdocumentview.c 20517 * app/widgets/gimphelp.c 20518 * app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or 20519 GIMP_CONTEXT(tool_options) or whatever is the right context 20520 to the changed core functions. 20521 20522 * tools/pdbgen/app.pl: pass "GimpContext *context" to all 20523 generated PDB invokers. 20524 20525 * tools/pdbgen/pdb/brush_select.pdb 20526 * tools/pdbgen/pdb/brushes.pdb 20527 * tools/pdbgen/pdb/drawable.pdb 20528 * tools/pdbgen/pdb/edit.pdb 20529 * tools/pdbgen/pdb/font_select.pdb 20530 * tools/pdbgen/pdb/gradient_select.pdb 20531 * tools/pdbgen/pdb/gradients.pdb 20532 * tools/pdbgen/pdb/image.pdb 20533 * tools/pdbgen/pdb/layer.pdb 20534 * tools/pdbgen/pdb/paint_tools.pdb 20535 * tools/pdbgen/pdb/palette.pdb 20536 * tools/pdbgen/pdb/palette_select.pdb 20537 * tools/pdbgen/pdb/palettes.pdb 20538 * tools/pdbgen/pdb/paths.pdb 20539 * tools/pdbgen/pdb/pattern_select.pdb 20540 * tools/pdbgen/pdb/patterns.pdb 20541 * tools/pdbgen/pdb/selection.pdb 20542 * tools/pdbgen/pdb/text_tool.pdb 20543 * tools/pdbgen/pdb/transform_tools.pdb: pass the new context 20544 parameter to the changed core functions. 20545 20546 * app/pdb/*_cmds.c: regenerated. 20547 205482004-04-14 Raphaël Quinet <quinet@gamers.org> 20549 20550 * plug-ins/script-fu/scripts/copy-visible.scm: New version of the 20551 script that works on a temporary copy of the image instead of 20552 copying the visible layers. Fixes bug #139989. 20553 205542004-04-14 Sven Neumann <sven@gimp.org> 20555 20556 * plug-ins/common/film.c: fixed typo (bug #140039). 20557 205582004-04-14 Sven Neumann <sven@gimp.org> 20559 20560 * configure.in: bumped version to 2.1.0, interface age 0, binary 20561 age 0. Changed library versioning to include gimp_minor_version 20562 similar to how gtk+ does it. 20563 205642004-04-14 Sven Neumann <sven@gimp.org> 20565 20566 * Made 2.0.1 release. 20567 205682004-04-13 Raphaël Quinet <quinet@gamers.org> 20569 20570 * plug-ins/common/mng.c (query, run): Workaround for bug #139947: 20571 do not register the plug-in for INDEXED* modes and do not declare 20572 that it can handle INDEXED images in gimp_export_image(). This 20573 forces a conversion to RGB instead of generating broken indexed 20574 images. The generation of correct indexed MNG files is likely to 20575 require a newer release of libmng. 20576 (mng_data): Set default compression level to 9 instead of 6. 20577 205782004-04-13 Sven Neumann <sven@gimp.org> 20579 20580 * plug-ins/imagemap/imap_cern_parse.c 20581 * plug-ins/imagemap/imap_csim_parse.c 20582 * plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison 20583 version 1.875a. Fixes bug #139894. 20584 205852004-04-13 Sven Neumann <sven@gimp.org> 20586 20587 * tools/gimp-remote.c: reverted last change and go back to the 20588 solution using fork(). Hopefully fixes bug #139158 this time. 20589 205902004-04-13 Sven Neumann <sven@gimp.org> 20591 20592 * app/core/gimp-utils.[ch] (gimp_get_default_language): added a 20593 category parameter to make this function more flexible. 20594 20595 * app/text/gimptext.c: changed accordingly. 20596 20597 * app/widgets/gimphelp.c (gimp_help): localize the help pages 20598 according to the value of LC_MESSAGES. Fixes bug #139917. 20599 206002004-04-13 Michael Natterer <mitch@gimp.org> 20601 20602 Moved the calls to floating_sel_relax()/rigor() from various 20603 places to two single spots in the core where they are actually 20604 needed. Fixes bug #138356 (which was caused by the projection 20605 being triggered in the middle of changing the floating selection's 20606 size or the size of the drawable it is attached to). This commit 20607 effectively removes floating selection fiddling from the core's 20608 public API. 20609 20610 * app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new 20611 function which returns TRUE if there is a floating selection 20612 attached to the drawable. 20613 20614 * app/core/gimpdrawable.c (gimp_drawable_translate) 20615 (gimp_drawable_set_tiles_full): if the drawable *has* a floating 20616 selection, relax/rigor it before/after modifying the drawable. 20617 20618 * app/core/gimplayer.c (gimp_layer_translate) 20619 (gimp_layer_set_tiles): if the layer *is* the floating selection, 20620 relax/rigor it before/after modifying it. 20621 20622 * app/core/gimpdrawable-transform.c 20623 * app/core/gimpimage-convert.c 20624 * app/core/gimpimage-crop.c 20625 * app/core/gimpimage-flip.c 20626 * app/core/gimpimage-resize.c 20627 * app/core/gimpimage-rotate.c 20628 * app/core/gimpimage-scale.c 20629 * app/gui/layers-commands.c 20630 * app/tools/gimpeditselectiontool.c 20631 * tools/pdbgen/pdb/layer.pdb: removed calls to 20632 floating_sel_rigor()/relax() all over the place. Also removed 20633 lots of undo groups which are obsolete now. 20634 20635 * app/pdb/layer_cmds.c: regenerated. 20636 206372004-04-13 Sven Neumann <sven@gimp.org> 20638 20639 * plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert 20640 the filename to UTF-8 before displaying it. 20641 206422004-04-13 Michael Natterer <mitch@gimp.org> 20643 20644 GimpItem undo group cleanup in preparation of fixing bug #138356: 20645 20646 * app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE 20647 undo groups to ITEM_SCALE and ITEM_RESIZE. 20648 20649 * app/core/gimpitem.[ch]: always push undo groups around 20650 GimpItem::translate(), scale(), resize(), flip(), rotate() and 20651 transform(). Added the resp. undo_desc strings to GimpItemClass. 20652 20653 * app/core/gimpchannel.[ch] 20654 * app/core/gimpdrawable.[ch] 20655 * app/core/gimplayer.c: removed all undo groups from 20656 implementations of the above methods. Removed the undo_desc 20657 strings which were moved to GimpItemClass. 20658 20659 * app/core/gimpimage-crop.c 20660 * app/core/gimpselection.c 20661 * app/gui/layers-commands.c 20662 * app/vectors/gimpvectors.c 20663 * tools/pdbgen/pdb/layer.pdb: changed accordingly. 20664 20665 * app/pdb/layer_cmds.c: regenerated. 20666 206672004-04-12 Sven Neumann <sven@gimp.org> 20668 20669 * configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h> 20670 when testing for Xmu.h. Fixes bug #139803. 20671 206722004-04-12 Sven Neumann <sven@gimp.org> 20673 20674 * libgimpmath/Makefile.am: remove test-md5 on make clean. 20675 206762004-04-11 Manish Singh <yosh@gimp.org> 20677 20678 * plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for 20679 images, actually prepend the dir to the img srcs in the html. Allow 20680 only horizontal or vertical guides in an image, do not require both. 20681 A bit smarter path handling. Addresses most of bug #138714. 20682 206832004-04-11 Hans Breuer <hans@breuer.org> 20684 20685 * app/makefile.msc : build sanity.obj 20686 app/text/makefile.msc : gimptextundo.obj 20687 app/widgets/makefile.msc : gimppatternfactoryview.obj 20688 20689 * plug-ins/common/winclipboard.c : don't call 20690 gimp_image_undo_enable() when it's not switched off. 20691 Otherwise the undo history would be destroyed with 20692 Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion 20693 `gimage->undo_freeze_count > 0' failed 20694 206952004-04-10 Sven Neumann <sven@gimp.org> 20696 20697 * app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo 20698 group only when it's needed. This resurrects text undo compression 20699 that broke when bug #137767 got fixed. 20700 207012004-04-10 Sven Neumann <sven@gimp.org> 20702 20703 * docs/gimp-remote.1.in: updated example URL. 20704 207052004-04-10 Pedro Gimeno <pggimeno@wanadoo.es> 20706 20707 * app/core/gimpdrawable-transform.c 20708 (gimp_drawable_transform_tiles_affine): Applied patch from William 20709 Skaggs that addresses bug #120490. 20710 20711 * app/sanity.c (sanity_check): Modified the message that reports 20712 an old version of Fontconfig in an attempt to make it more 20713 informative. 20714 207152004-04-10 Sven Neumann <sven@gimp.org> 20716 20717 * tools/gimp-remote.c (start_new_gimp): reverted the last change 20718 and did a different fix that involves closing the X display before 20719 starting gimp (bug #139158). 20720 207212004-04-09 Manish Singh <yosh@gimp.org> 20722 20723 * plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since 20724 the previous one did break error handling. Fixes bug #139571. 20725 207262004-04-09 Henrik Brix Andersen <brix@gimp.org> 20727 20728 * README.i18n: s/14/20/ plus whitespace clean-up. 20729 207302004-04-08 Sven Neumann <sven@gimp.org> 20731 20732 * plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin 20733 Cozens that makes the Script-Fu PDB marshaller handle NULL 20734 strings. Some minor code cleanup. Fixes bug #139386. 20735 207362004-04-08 Sven Neumann <sven@gimp.org> 20737 20738 * tools/gimp-remote.c (start_new_gimp): applied a patch from 20739 Michael Matz that calls fork() before starting gimp. This is to 20740 avoid X server authentification problems (bug #139158). 20741 207422004-04-07 Henrik Brix Andersen <brix@gimp.org> 20743 20744 * configure.in (ALL_LINGUAS): revert addition of "is" until all 20745 .po files are there. 20746 207472004-04-07 Samúel Jón Gunnarsson <sammi@techattack.nu> 20748 20749 * configure.in: Added "is" to ALL_LINGUAS 20750 207512004-04-06 Iñaki Larrañaga <dooteo@euskalgnu.org> 20752 20753 * configure.in: Added "eu" (Basque) to ALL_LINGUAS. 20754 207552004-04-05 Pedro Gimeno <pggimeno@wanadoo.es> 20756 20757 * plug-ins/script-fu/scripts/copy-visible.scm: Use 20758 gimp-image-get-active-layer/channel instead of the passed 20759 drawable for later restoring the initially active layer/channel. 20760 Addresses bug #138662. 20761 20762 * plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to 20763 gimp-image-set-active-layer in order for it to fail early instead 20764 of failing with the undo group open in case the drawable is not 20765 suitable for applying the effect. 20766 207672004-04-05 Michael Natterer <mitch@gimp.org> 20768 20769 * app/core/gimpimage.c (gimp_image_real_mode_changed): update the 20770 whole image. 20771 20772 * app/display/gimpdisplay-handlers.c: removed obsolete 20773 "mode_changed" and "colormap_changed" handlers because GimpImage's 20774 default handlers already update the whole image. 20775 207762004-04-05 Pedro Gimeno <pggimeno@wanadoo.es> 20777 20778 Sanitize rectangle and ellipse selection handling (bug #138237 20779 and bug #138103): 20780 20781 * app/tools/gimprectselecttool.h 20782 * app/tools/gimprectselecttool.c (GimpRectSelectTool): new 20783 member "moved" indicating whether the cursor was moved after 20784 the click. 20785 (gimp_rect_select_tool_coords_to_integer): New function for 20786 consistent conversion of the rectangle FP coords to pixels. 20787 (gimp_rect_select_tool_button_press, 20788 gimp_rect_select_tool_button_release, 20789 gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use 20790 it instead of fiddling with the FP coordinates. Update "moved" 20791 and use it to detect whether the selection needs to be cleared. 20792 20793 * app/tools/gimpellipseselecttool.c 20794 (gimp_ellipse_select_tool_draw): use the new coords_to_integer 20795 function. 20796 207972004-04-05 Sven Neumann <sven@gimp.org> 20798 20799 * plug-ins/Lighting/lighting_ui.c: applied the second patch 20800 attached to bug #138788 by William Skaggs. Removes some user 20801 interface elements that have no corresponding implementation and 20802 fixes preview updates. 20803 208042004-04-04 Sven Neumann <sven@gimp.org> 20805 20806 * Makefile.am 20807 * NEWS.pre-2-0: moved old NEWS to this new file. 20808 20809 * NEWS: list bugs fixed since 2.0.0. 20810 208112004-04-04 Sven Neumann <sven@gimp.org> 20812 20813 * Makefile.am 20814 * docs/Makefile.am: don't install gimptool symlinks to 20815 gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2 20816 looks for gimptool (bug #139024). 20817 208182004-04-04 Sven Neumann <sven@gimp.org> 20819 20820 * app/display/gimpdisplayshell-callbacks.c 20821 * app/display/gimpdisplayshell-draw.[ch] pass the bounding box of 20822 the exposed area to gimp_display_shell_draw_grid() and draw only 20823 the relevant part of the grid. Fixes bug #138081. 20824 208252004-04-04 Sven Neumann <sven@gimp.org> 20826 20827 Cache the GC for drawing the grid as suggested in bug #138081: 20828 20829 * app/display/gimpdisplayshell.[ch]: added a grid_gc member to 20830 GimpDisplayShell. 20831 20832 * app/display/gimpdisplayshell-handlers.c 20833 (gimp_display_shell_grid_notify_handler) 20834 (gimp_display_shell_disconnect): invalidate the grid GC. 20835 20836 * app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid): 20837 use the cached grid_gc. Also applied the fix that Pedro Gimeno did 20838 for bug #138606. 20839 208402004-04-04 Sven Neumann <sven@gimp.org> 20841 20842 * app/core/gimpundo.c (gimp_undo_type_to_name): added a missing 20843 call to gettext(). Fixes bug #139000. 20844 208452004-04-03 Manish Singh <yosh@gimp.org> 20846 20847 * gimptool-2.0.in: Create any directories in the install path that do 20848 not already exist. Fixes bug #138980. 20849 20850 * docs/gimptool.1.in: s/dont/don't/g 20851 208522004-04-04 Sven Neumann <sven@gimp.org> 20853 20854 * app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the 20855 selection is empty. Fixes bug #138973. 20856 208572004-04-03 Sven Neumann <sven@gimp.org> 20858 20859 * app/text/gimptextlayer.c (gimp_text_layer_new): create the 20860 initial text layer with a size of 1 x 1 since tile_manager_new() 20861 does not any longer accept 0 x 0. 20862 20863 * app/core/gimpdrawable.c (gimp_drawable_configure): check that 20864 width and height are > 0. 20865 208662004-04-03 Sven Neumann <sven@gimp.org> 20867 20868 * plug-ins/Lighting/lighting_main.c 20869 * plug-ins/Lighting/lighting_shade.c: applied the first of two 20870 patches attached to bug #138788 by William Skaggs. 20871 208722004-04-02 Simon Budig <simon@gimp.org> 20873 20874 * plug-ins/common/whirlpinch.c: set a proper pixelfetcher 20875 edge mode for bigger radii. Avoids getting garbage at the 20876 image borders. 20877 208782004-04-02 Dave Neary <bolsh@gimp.org> 20879 20880 * plug-ins/common/jpeg.c: Added .jpe to the list of extensions 20881 that the jpeg plug-in recognises. Fixes bug #138776. 20882 208832004-04-01 Sven Neumann <sven@gimp.org> 20884 20885 * app/gui/user-install-dialog.c: unset the bg_pixmap and tweak 20886 style colors for all states. Sort of ugly but makes the dialog 20887 work better with more obscure themes (bug #138379). 20888 208892004-04-01 Sven Neumann <sven@gimp.org> 20890 20891 * tools/kernelgen.c: updated a comment. 20892 208932004-04-01 Michael Natterer <mitch@gimp.org> 20894 20895 * app/core/core-enums.[ch] (enum GimpUndoType): added undo type 20896 GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types 20897 GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD. 20898 20899 * app/core/gimpimage-undo-push.[ch]: added new new function 20900 gimp_image_undo_push_text_layer_modified() which makes 20901 modifications of the text_layer's "modified" boolean undoable. 20902 20903 * app/core/gimpdrawable.[ch]: added new virtual function 20904 GimpDrawable::push_undo() and moved the actual undo pushing into 20905 the default implementation gimp_drawable_real_push_undo(). 20906 20907 * app/text/gimptextlayer.c (gimp_text_layer_push_undo): new 20908 function. Pushes the text_layer's modified state to the undo stack 20909 after upchaining and sets modified to TRUE. 20910 20911 (gimp_text_layer_set_tiles): ditto. 20912 20913 (gimp_lext_layer_apply_region) 20914 (gimp_text_layer_replace_region): removed because their default 20915 implementations already call gimp_drawable_push_undo(). 20916 20917 (gimp_text_layer_swap_pixels): removed because swap_pixels() is 20918 used by undo only and doesn't need to care about the text_layer's 20919 modified state. 20920 20921 (gimp_text_layer_render): don't set modified to FALSE here because 20922 we can't push an undo step here. 20923 20924 (gimp_text_layer_set): push the modified state to the undo stack 20925 and set it to FALSE here. Also push the layer's tiles if the 20926 layer was modified. 20927 20928 * app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified" 20929 to the undo stack and set it to FALSE here, too. 20930 20931 Fixes bug #137767. 20932 209332004-03-31 Simon Budig <simon@gimp.org> 20934 20935 * app/tools/gimptransformtool.c: One really should use braces 20936 when mixing additions and multiplication and the operator 20937 precedence is not the desired one... 20938 20939 I feel stupid... :-) 20940 209412004-03-31 Michael Natterer <mitch@gimp.org> 20942 20943 * app/core/gimp-transform-utils.c 20944 (gimp_transform_matrix_perspective): make sure 0.0/0.0 results 20945 in 1.0, not NaN. 20946 20947 * app/core/gimpdrawable-transform.c 20948 (gimp_drawable_transform_tiles_affine): instead of returning NULL 20949 if the transformation shrinks the tiles completely away, return at 20950 least the pixel (or the row or column of pixels) which best covers 20951 the sub-pixel area of the transform result: 20952 20953 - Changed rounding of the transformed coordinates from RINT() 20954 to floor()/ceil() so we don't cut off sub-pixel portions of the 20955 transform result. 20956 - Force the minimal size if the changed rounding didn't help. 20957 20958 Fixes bug #138117. 20959 20960 Also added paranoia code which falls back to clip_result if the 20961 passed matrix produces NaN coordinates (copied the FINITE() macro 20962 from image_cmds.c). 20963 209642004-03-30 Sven Neumann <sven@gimp.org> 20965 20966 * plug-ins/script-fu/scripts/grid-system.scm: define "map" here, 20967 the script used to take the definition from alien-glow-arrow.scm 20968 or beveled-pattern-arrow.scm. Also added an undo group around all 20969 operations. Fixes bug #138524. 20970 209712004-03-30 Michael Natterer <mitch@gimp.org> 20972 20973 * app/Makefile.am 20974 * app/sanity.[ch]: new files implementing sanity_check() for 20975 run-time checking library versions. Added a check for FreeType but 20976 disabled it until we figured if and how freetype causes some of 20977 the DLL hell bugs. 20978 20979 * app/main.c (main): call it and abort if it fails. 20980 20981 * app/app_procs.[ch]: added app_gui_abort() so main.c doesn't 20982 need to #include "gui/gui.h" 20983 20984 * app/gui/gui.[ch] (gui_libs_init): removed library sanity checking. 20985 20986 (gui_abort): new function which shows the abort message. 20987 209882004-03-30 Michael Natterer <mitch@gimp.org> 20989 20990 * configure.in (ALL_LINGUAS): revert addition of "pa" until 20991 all .po files are there. 20992 209932004-03-20 Guntupalli Karunakar <karunakar@freedomink.org> 20994 20995 * configure.in: Added "pa" for Punjabi to ALL_LINGUAS. 20996 209972004-03-29 Manish Singh <yosh@gimp.org> 20998 20999 * plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer 21000 to the beginning of the structure, to make sure it is aligned on a 21001 16-byte boundary for ia64, even with icc. Fixes #138357. 21002 210032004-03-29 Sven Neumann <sven@gimp.org> 21004 21005 * app/config/gimpguiconfig.c: changed the default for "help-locales" 21006 from NULL to an empty string. Fixes the generated gimprc man-page. 21007 21008 * app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing 21009 whitespace. 21010 21011 * app/widgets/gimphelp.c: use the user's locale if "help-locales" 21012 is NULL or the empty string. 21013 21014 * docs/gimprc.5.in 21015 * etc/gimprc: regenerated. 21016 210172004-03-29 Michael Natterer <mitch@gimp.org> 21018 21019 * app/core/core-enums.[ch] (enum GimpUndoType): added new group 21020 GIMP_UNDO_GROUP_FS_REMOVE. 21021 21022 * app/core/gimplayer-floating-sel.c (floating_sel_remove): push an 21023 undo group. Fixes undo corruption spotted by Pedro Gimeno. 21024 210252004-03-29 Michael Natterer <mitch@gimp.org> 21026 21027 * plug-ins/common/guillotine.c (guillotine): Don't just skip 21028 guides at the image edges but any guide which is at a position we 21029 already remembered. Should catch all instances of bug #138312 this 21030 time. 21031 210322004-03-28 Sven Neumann <sven@gimp.org> 21033 21034 * plug-ins/ifscompose/ifscompose.c: applied patch from David Necas 21035 that updates the sensitivity of the Delete button and menu entry. 21036 Fixes bug #138212. 21037 210382004-03-28 Sven Neumann <sven@gimp.org> 21039 21040 * plug-ins/MapObject/mapobject_main.c: fixed non-interactive call. 21041 21042 * plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as 21043 drawable ID for unused drawables. Fixes bug #138253. 21044 210452004-03-28 Sven Neumann <sven@gimp.org> 21046 21047 * app/text/gimpfontlist.c (gimp_font_list_add_font): validate the 21048 font name. This should work around the crashes that Windows users 21049 were experiencing on startup (bug #132366). The real problem needs 21050 to be fixed elsewhere though. 21051 210522004-03-28 Michael Natterer <mitch@gimp.org> 21053 21054 * app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding 21055 a layer with mask, don't forget to set layer->mask->removed to FALSE. 21056 210572004-03-28 Michael Natterer <mitch@gimp.org> 21058 21059 * app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem 21060 struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed(). 21061 Added public function gimp_item_is_removed(). 21062 21063 * app/core/gimpimage-undo-push.c (undo_pop_layer) 21064 (undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors): 21065 set it to FALSE manually when re-adding something from the 21066 undo stack. 21067 21068 * tools/pdbgen/app.pl 21069 * tools/pdbgen/pdb.pl: don't allow any operation on items which 21070 are removed from the image (and exist on the undo stack only). 21071 Fixes bug #138311. 21072 21073 * app/pdb/channel_cmds.c 21074 * app/pdb/color_cmds.c 21075 * app/pdb/drawable_cmds.c 21076 * app/pdb/edit_cmds.c 21077 * app/pdb/floating_sel_cmds.c 21078 * app/pdb/image_cmds.c 21079 * app/pdb/layer_cmds.c 21080 * app/pdb/paint_tools_cmds.c 21081 * app/pdb/parasite_cmds.c 21082 * app/pdb/selection_cmds.c 21083 * app/pdb/selection_tools_cmds.c 21084 * app/pdb/transform_tools_cmds.c: regenerated. 21085 210862004-03-28 Sven Neumann <sven@gimp.org> 21087 21088 * plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch 21089 from Nils Philippsen that fixes bug #138310. 21090 210912004-03-28 Michael Natterer <mitch@gimp.org> 21092 21093 * plug-ins/common/guillotine.c (guillotine): applied a (modified) 21094 patch from Joao S. O. Bueno which removes any guides from the 21095 cropped images. Fixes bug #138314. 21096 21097 Skip guides which are at the image's edges because the algorithm 21098 already assumes that there are always guides at these positions. 21099 Fixes bug #138312. 21100 211012004-03-27 Tor Lillqvist <tml@iki.fi> 21102 21103 * plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows 21104 to avoid a console window popping up. 21105 211062004-03-26 Manish Singh <yosh@gimp.org> 21107 21108 * tools/pdbgen/app.pl: don't generate code with tabs. 21109 21110 * tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in 21111 helper function declaration. 21112 21113 * app/pdb/procedural_db.c: convert tabs to spaces. 21114 21115 * app/pdb/*.c: regenerated, no code changes, only tabs->spaces. 21116 211172004-03-26 Manish Singh <yosh@gimp.org> 21118 21119 * tools/pdbgen/app.pl: kill whitespace in blank lines. 21120 21121 * app/pdb/*.c: regenerated, no code changes, only whitespace. 21122 211232004-03-26 Michael Natterer <mitch@gimp.org> 21124 21125 * app/core/gimpdrawable-transform.c 21126 (gimp_drawable_transform_tiles_affine): return NULL tiles if the 21127 matrix would transform the drawable into nothing. Fixes the 21128 core-crashing part of bug #138117 and makes the script fail 21129 with an execution error. 21130 211312004-03-25 Sven Neumann <sven@gimp.org> 21132 21133 * README: mention the gimp-perl pre-release and provide a link. 21134 211352004-03-25 Michael Natterer <mitch@gimp.org> 21136 21137 * app/base/tile-manager.c (tile_manager_new): g_return_if_fail() 21138 on width, height or bpp <= 0. Doesn't fix anything but badly 21139 warns (and helps debugging) on bug #138117. 21140 211412004-03-25 Michael Natterer <mitch@gimp.org> 21142 21143 * app/tools/gimpvectortool.c (gimp_vector_tool_button_release): 21144 fixed condition which triggers the path tool's undo hack. Fixes 21145 bug #138086. Also g_object_unref() the undo step. 21146 21147 Removed trailing whitespace. 21148 211492004-03-25 Manish Singh <yosh@gimp.org> 21150 21151 * libgimp/gimp.c 21152 * app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX 21153 shm case. We were leaking an fd here. 21154 21155 * app/tools/gimptexttool.c (gimp_text_tool_connect): remove 21156 unnecessary G_OBJECT() cast in g_object_set() call. 21157 211582004-03-23 Michael Natterer <mitch@gimp.org> 21159 21160 * autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the 21161 message that is printed if no arguments were passed. 21162 211632004-03-23 Sven Neumann <sven@gimp.org> 21164 Michael Natterer <mitch@gimp.org> 21165 21166 * Made 2.0.0 release. 21167
